RPS-BLAST 2.2.22 [Sep-27-2009] Database: scop70_1_75 13,730 sequences; 2,407,596 total letters Searching..................................................done Query= gi|254780128|ref|YP_003064541.1| VRR-NUC domain-containing protein [Candidatus Liberibacter asiaticus str. psy62] (103 letters) >d1zj8a1 d.58.36.1 (A:327-406) Sulfite reductase NirA {Mycobacterium tuberculosis [TaxId: 1773]} Length = 80 Score = 27.4 bits (61), Expect = 0.31 Identities = 12/60 (20%), Positives = 25/60 (41%), Gaps = 11/60 (18%) Query: 51 GLWWIEVKKPTGRLSHQQMSEIEELRRR----------GQRVKVL-VSMEEVDNFLEELA 99 GL + V GR+S ++ + +L R Q++ +L + +D+ + L Sbjct: 14 GLNAVGVAPIAGRVSGTILTAVADLMARAGSDRIRFTPYQKLVILDIPDALLDDLIAGLD 73 >d3bz6a2 a.4.5.75 (A:97-180) Hypothetical protein PSPTO2686 {Pseudomonas syringae pv. tomato [TaxId: 323]} Length = 84 Score = 27.4 bits (61), Expect = 0.33 Identities = 9/26 (34%), Positives = 12/26 (46%) Query: 74 ELRRRGQRVKVLVSMEEVDNFLEELA 99 EL R R+ E+V + LE L Sbjct: 28 ELLTRSNRMHDFEDSEQVVHQLERLI 53 >d1tl2a_ b.67.1.1 (A:) Tachylectin-2 {Japanese horseshoe crab (Tachypleus tridentatus) [TaxId: 6853]} Length = 235 Score = 27.2 bits (60), Expect = 0.39 Identities = 8/50 (16%), Positives = 18/50 (36%), Gaps = 2/50 (4%) Query: 8 YQTEKDVEKRLVTGAKKLDCWVRKASFVGR--RGCPDRLIITPNGGLWWI 55 Y + + D W+ +A+ +G+ L + G L+ + Sbjct: 148 YAVHGQQFYKALPPVSNQDNWLARATKIGQGGWDTFKFLFFSSVGTLFGV 197 >d2akja1 d.58.36.1 (A:346-430) Ferredoxin--nitrite reductase, NIR {Spinach (Spinacia oleracea) [TaxId: 3562]} Length = 85 Score = 26.6 bits (59), Expect = 0.55 Identities = 13/58 (22%), Positives = 24/58 (41%), Gaps = 11/58 (18%) Query: 51 GLWWIEVKKPTGRLSHQQMSEIEELRRR----------GQRVKVL-VSMEEVDNFLEE 97 GL ++ + P GRL +M E+ + Q + + V ++D+ L E Sbjct: 18 GLSFVGLHIPVGRLQADEMEELARIADVYGSGELRLTVEQNIIIPNVENSKIDSLLNE 75 >d2akja2 d.58.36.1 (A:22-174) Ferredoxin--nitrite reductase, NIR {Spinach (Spinacia oleracea) [TaxId: 3562]} Length = 153 Score = 26.4 bits (58), Expect = 0.67 Identities = 9/61 (14%), Positives = 24/61 (39%), Gaps = 12/61 (19%) Query: 51 GLWWIEVKKPTGRLSHQQMSEIEELRRR-----------GQRVKVL-VSMEEVDNFLEEL 98 G + + +K P G + +Q + + ++ Q ++ V + +V ++ L Sbjct: 83 GRFMMRLKLPNGVTTSEQTRYLASVIKKYGKDGCADVTTRQNWQIRGVVLPDVPEIIKGL 142 Query: 99 A 99 Sbjct: 143 E 143 >d1g5ha1 c.51.1.1 (A:343-469) The aaRS-like accessory subunit of mitochondrial polymerase gamma, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 127 Score = 25.4 bits (55), Expect = 1.4 Identities = 6/25 (24%), Positives = 15/25 (60%) Query: 74 ELRRRGQRVKVLVSMEEVDNFLEEL 98 +LR R +K ++ + ++ +FL + Sbjct: 86 QLRSRDTTMKEMMHISKLRDFLVKY 110 >d1gg2g_ a.137.3.1 (G:) Transducin (heterotrimeric G protein), gamma chain {Cow (Bos taurus) [TaxId: 9913]} Length = 54 Score = 25.4 bits (56), Expect = 1.4 Identities = 8/36 (22%), Positives = 16/36 (44%), Gaps = 2/36 (5%) Query: 67 QQMSEIEELRRRG--QRVKVLVSMEEVDNFLEELAC 100 Q +E+L+ R+KV + ++ + E A Sbjct: 4 QARKLVEQLKMEANIDRIKVSKAAADLMAYCEAHAK 39 >d2ts1a_ c.26.1.1 (A:) Tyrosyl-tRNA synthetase (TyrRS) {Bacillus stearothermophilus, nca 1503 [TaxId: 1422]} Length = 319 Score = 23.9 bits (51), Expect = 3.8 Identities = 11/35 (31%), Positives = 15/35 (42%), Gaps = 1/35 (2%) Query: 69 MSEIEELRRRGQRVKVLVSMEEVDNFLEELACTLY 103 M + EL+ RG V + + L E TLY Sbjct: 1 MDLLAELQWRGL-VNQTTDEDGLRKLLNEERVTLY 34 >d1dl5a1 c.66.1.7 (A:1-213) Protein-L-isoaspartyl O-methyltransferase {Thermotoga maritima [TaxId: 2336]} Length = 213 Score = 23.4 bits (49), Expect = 5.1 Identities = 3/21 (14%), Positives = 8/21 (38%) Query: 72 IEELRRRGQRVKVLVSMEEVD 92 L++ G + + E+ Sbjct: 6 FWILKKYGVSDHIAKAFLEIP 26 >d1nppa2 b.34.5.4 (A:191-248) N-utilization substance G protein NusG, C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Length = 58 Score = 23.4 bits (51), Expect = 5.1 Identities = 4/18 (22%), Positives = 12/18 (66%) Query: 71 EIEELRRRGQRVKVLVSM 88 +EE+ +++ V++S+ Sbjct: 24 TVEEVHPEKRKLTVMISI 41 >d1g7sa1 b.43.3.1 (A:228-328) Initiation factor IF2/eIF5b, domains 2 and 4 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 101 Score = 23.2 bits (50), Expect = 5.7 Identities = 6/34 (17%), Positives = 14/34 (41%) Query: 50 GGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVK 83 + + L + + E+ E R++ Q+V Sbjct: 40 MTSKDVISTRIRSLLKPRPLEEMRESRKKFQKVD 73 >d1nz9a_ b.34.5.4 (A:) N-utilization substance G protein NusG, C-terminal domain {Thermus thermophilus [TaxId: 274]} Length = 58 Score = 23.4 bits (51), Expect = 6.3 Identities = 5/18 (27%), Positives = 11/18 (61%) Query: 71 EIEELRRRGQRVKVLVSM 88 + E+ +VKV+V++ Sbjct: 24 TVTEINPERGKVKVMVTI 41 >d1m5ya1 a.223.1.2 (A:25-164,A:395-427) Porin chaperone SurA, peptide-binding domain {Escherichia coli [TaxId: 562]} Length = 173 Score = 23.1 bits (49), Expect = 6.9 Identities = 6/27 (22%), Positives = 16/27 (59%) Query: 72 IEELRRRGQRVKVLVSMEEVDNFLEEL 98 I E+R R ++ + +EV++ +++ Sbjct: 114 ISEVRNNEVRRRITILPQEVESLAQQV 140 >d1uira_ c.66.1.17 (A:) Spermidine synthase {Thermus thermophilus [TaxId: 274]} Length = 312 Score = 22.8 bits (48), Expect = 8.4 Identities = 6/37 (16%), Positives = 13/37 (35%) Query: 49 NGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVL 85 + G+++ E P L + I + Q + Sbjct: 2 DYGMYFFEHVTPYETLVRRMERVIASGKTPFQDYFLF 38 Database: scop70_1_75 Posted date: Mar 27, 2010 6:21 PM Number of letters in database: 2,407,596 Number of sequences in database: 13,730 Lambda K H 0.322 0.137 0.428 Gapped Lambda K H 0.267 0.0690 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 13730 Number of Hits to DB: 425,694 Number of extensions: 19441 Number of successful extensions: 87 Number of sequences better than 10.0: 1 Number of HSP's gapped: 87 Number of HSP's successfully gapped: 29 Length of query: 103 Length of database: 2,407,596 Length adjustment: 64 Effective length of query: 39 Effective length of database: 1,528,876 Effective search space: 59626164 Effective search space used: 59626164 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.0 bits)