HHsearch alignment for GI: 254780129 and conserved domain: PRK08840

>PRK08840 replicative DNA helicase; Provisional.
Probab=94.33  E-value=0.36  Score=25.88  Aligned_cols=141  Identities=17%  Similarity=0.141  Sum_probs=62.9

Q ss_pred             CEEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCCCCHHHHHHHHHHHCCCCCCEEEE--EECCCCCCC----CCCCC
Q ss_conf             199968999889999999999974089948997233101378899998515534606998--611210112----23456
Q gi|254780129|r   22 CALWASMGSGKTVSVLFALSTIKILDPRPVLIIAPLRVAQYVWKDEVERWSAFSDMTVSS--LIGSERQRI----KALNT   95 (220)
Q Consensus        22 ~~l~~~~G~GKT~~ai~~~~~~~~~~~~~~LIi~P~s~~~~~W~~e~~~~~~~~~~~~~~--~~~~~~~~~----~~~~~   95 (220)
T Consensus       220 iviaaRPsmGKTalalnia~n~a~~~~~~v~~fSlEMs~~ql~~Rlls~~s~i~~~~ir~g~l~~~e~~~i~~a~~~~~~  299 (464)
T PRK08840        220 IIVAARPSMGKTTFAMNLCENAAMDQDKPVLIFSLEMPAEQLMMRMLASLSRVDQTKIRTGQLDDEDWARISSTMGILME  299 (464)
T ss_pred             EEEEECCCCCHHHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHCCCCCCHHHCCCCCHHHHHHHHHHHHHHHH
T ss_conf             99983798736899999999999965996799767799899999999985389820111488899999999999999984


Q ss_pred             CCCEEEE-----CHHHHHCCCCCCC-CCCCCCCCCCCHHHCCCCCCCC-----CHHHHHHHHHHHHHCCCCEEEEECC
Q ss_conf             7662786-----5667310000000-0247200002512201365433-----2036999999985137987998316
Q gi|254780129|r   96 PAHLYII-----NFENIPWLVKMKL-DHWDFATIVVDESTKLKSFRTH-----QGTKQTRALGKVAFSKVKRFIELTG  162 (220)
Q Consensus        96 ~~~~~i~-----~~~~l~~~~~~~~-~~~~~~~iIiDEaH~~kn~~~~-----~~~k~~k~l~~~~~~~~~~~l~LTg  162 (220)
T Consensus       300 ~~~l~idd~~~~t~~~i~a~~r~~~~~~~~l~lvvIDYLqL~~~~~~~~~r~~~i~~isr~lK~lAkel~vpVv~lsQ  377 (464)
T PRK08840        300 KKNMYIDDSSGLTPTEVRSRARRVAREHGGLSMIMVDYLQLMRVPALQDNRTLEIAEISRSLKALAKELNVPVVALSQ  377 (464)
T ss_pred             CCCEEEECCCCCCHHHHHHHHHHHHHHCCCCCEEEEEHHHHCCCCCCCCHHHHHHHHHHHHHHHHHHHHCCCEEEECC
T ss_conf             799588569987579999999999986489878996188660678864036789999999999999996998999631