HHsearch alignment for GI: 254780129 and conserved domain: pfam00580

>pfam00580 UvrD-helicase UvrD/REP helicase. The Rep family helicases are composed of four structural domains. The Rep family function as dimers. REP helicases catalyse ATP dependent unwinding of double stranded DNA to single stranded DNA. Bacillus subtilis addA and Escherichia coli exodeoxyribonuclease V beta have large insertions near to the carboxy-terminus relative to other members of the family.
Probab=96.46  E-value=0.0098  Score=34.86  Aligned_cols=62  Identities=23%  Similarity=0.225  Sum_probs=40.8

Q ss_pred             CCHHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHH-HC--CCCCEEEEECCCCCHHHHHHHH
Q ss_conf             3489999999999679819996899988999999999997-40--8994899723310137889999
Q gi|254780129|r    5 LKPHQIVMVNWLLSHDRCALWASMGSGKTVSVLFALSTIK-IL--DPRPVLIIAPLRVAQYVWKDEV   68 (220)
Q Consensus         5 Lrp~Q~~a~~~~~~~~~~~l~~~~G~GKT~~ai~~~~~~~-~~--~~~~~LIi~P~s~~~~~W~~e~   68 (220)
T Consensus         1 Ln~~Q~~av~~--~~~~llV~AgAGSGKT~~L~~Ri~~li~~~~~~p~~IL~lTFT~kAA~Em~~Ri   65 (494)
T pfam00580         1 LNPEQRKAVTH--LGGPLLVLAGAGTGKTRVLTERIAYLILEGGIDPEEILAVTFTNKAAREMKERI   65 (494)
T ss_pred             CCHHHHHHHCC--CCCCEEEEEECCHHHHHHHHHHHHHHHHHCCCCHHHEEEEECHHHHHHHHHHHH
T ss_conf             99889999809--999979997187068999999999999818999747876702899999999999