HHsearch alignment for GI: 254780130 and conserved domain: KOG0335

>KOG0335 consensus.
Probab=98.06  E-value=4.8e-05  Score=47.47  Aligned_cols=127  Identities=17%  Similarity=0.246  Sum_probs=87.0

Q ss_pred             CHHHHHHHHHHHHHCC---------CCCEEEHHHHHHHHHHHHHHH----------HCCCCHHHHHHHHHHHHCCCCCEE
Q ss_conf             7234334999986148---------997110578999999987653----------047782348999999727898699
Q gi|254780130|r   52 HDEKIKALEVIIEKAN---------AAPIIVAYHFNSDLARLQKAF----------PQGRTLDKDPCTIQEWNEGKIPLL  112 (205)
Q Consensus        52 ~~~Kl~~l~~ii~~~~---------~~kviVf~~f~~~l~~l~~~~----------~~~~~~~~r~~~i~~f~~~~~~Vl  112 (205)
T Consensus       312 ~~~kr~~Lldll~~~~~~~~~~~~~~e~tlvFvEt~~~~d~l~~~l~~~~~~~~sIhg~~tq~er~~al~~Fr~g~~pvl  391 (482)
T KOG0335         312 EMEKRSKLLDLLNKDDGPPSDGEPKWEKTLVFVETKRGADELAAFLSSNGYPAKSIHGDRTQIEREQALNDFRNGKAPVL  391 (482)
T ss_pred             CHHHHHHHHHHHHCCCCCCCCCCCCCCEEEEEEECCHHHHHHHHHHHCCCCCCEEECCHHHHHHHHHHHHHHHCCCCCEE
T ss_conf             11357899988613467866577643138999613003269999986179874560332556379999877646986679


Q ss_pred             EECHHHHHHHHHHHHHCCEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCEEEEEEEECC-CHHHHHHHHHHH
Q ss_conf             97214432332243206758972689998880225555766654202657753999998388-958999999999
Q gi|254780130|r  113 FAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQN-TIDELVLQRLRT  186 (205)
Q Consensus       113 l~~~~a~g~GlnL~~a~~~vI~~~~~~n~~~~~Qa~~Ri~~~r~hR~GQ~~~v~v~~l~~~~-tiEe~i~~~l~~  186 (205)
T Consensus       392 VaT-~VaaRGlDi~~-V~hVInyDmP~d~d~YvHRIGRT-----GR~Gn~G~atsf~n-~~~~~i~~~L~~~l~e  458 (482)
T KOG0335         392 VAT-NVAARGLDIPN-VKHVINYDMPADIDDYVHRIGRT-----GRVGNGGRATSFFN-EKNQNIAKALVEILTE  458 (482)
T ss_pred             EEE-HHHHCCCCCCC-CCEEEEEECCCCHHHHHHHCCCC-----CCCCCCCEEEEEEC-CCCCHHHHHHHHHHHH
T ss_conf             870-36654788768-74358863675246677741543-----55777732688764-7430068999999998