>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family; InterPro: IPR004589 The ATP-dependent DNA helicase RecQ (3.6.1 from EC) is involved in genome maintenance . All homologues tested to date unwind paired DNA, translocating in a 3' to 5' direction and several have a preference for forked or 4-way DNA structures (e.g. Holliday junctions) or for G-quartet DNA. The yeast protein, Sgs1, is present in numerous foci that coincide with sites of de novo synthesis DNA, such as the replication fork, and protein levels peak during S-phase. A model has been proposed for Sgs1p action in the S-phase checkpoint response, both as a 'sensor' for damage during replication and a 'resolvase' for structures that arise at paused forks, such as the four-way 'chickenfoot' structure. The action of Sgs1p may serve to maintain the proper amount and integrity of ss DNA that is necessary for the binding of RPA (replication protein A, the eukaryotic ss DNA-binding protein)DNA pol complexes. Sgs1p would thus function by detecting (or resolving) aberrant DNA structures, and would thus contribute to the full activation of the DNA-dependent protein kinase, Mec1p and the effector kinase, Rad53p. Its ability to bind both the large subunit of RPA and the RecA-like protein Rad51p, place it in a unique position to resolve inappropriate fork structures that can occur when either the leading or lagging strand synthesis is stalled. Thus, RecQ helicases integrate checkpoint activation and checkpoint response. ; GO: 0008026 ATP-dependent helicase activity, 0006310 DNA recombination.

Probab=98.02 E-value=1.9e-05 Score=49.67 Aligned_cols=119 Identities=15% Similarity=0.192 Sum_probs=91.8 Q ss_pred HHHHHHHHH-------HCCCCCEEEHHHHHHHHHHHHHH----------HHCCCCHHHHHHHHHHHH-CCCCCEEEECHH Q ss_conf 334999986-------14899711057899999998765----------304778234899999972-789869997214 Q gi|254780130|r 56 IKALEVIIE-------KANAAPIIVAYHFNSDLARLQKA----------FPQGRTLDKDPCTIQEWN-EGKIPLLFAHPA 117 (205) Q Consensus 56 l~~l~~ii~-------~~~~~kviVf~~f~~~l~~l~~~----------~~~~~~~~~r~~~i~~f~-~~~~~Vll~~~~ 117 (205) T Consensus 222 ~~dl~~f~~~~~~s~~~~~G~sGIIYC~SR~~~e~~a~~L~~~G~~a~aYHAGl~~~~R~~V~~~f~nrD~~QvVvATv- 300 (497) T TIGR00614 222 LEDLLRFIVKKASSAWEFKGKSGIIYCPSRKKSEQVAAELQKLGIAAGAYHAGLEISARKEVQHKFQNRDEIQVVVATV- 300 (497) T ss_pred HHHHHHHHHHHCCCCCCCCCCCEEEECCCCHHHHHHHHHHHHCCCEEEHHHCCCCHHHHHHHHHHHHCCCCCEEEEEEE- T ss_conf 9999999875203565245883027528723489999999755861002402688647789999875038857999872- Q ss_pred HHHHHHHHHHHCCEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCEEEEEEEECCCHHHHHH Q ss_conf 4323322432067589726899988802255557666542026577539999983889589999 Q gi|254780130|r 118 SCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVL 181 (205) Q Consensus 118 a~g~GlnL~~a~~~vI~~~~~~n~~~~~Qa~~Ri~~~r~hR~GQ~~~v~v~~l~~~~tiEe~i~ 181 (205) T Consensus 301 AFGMGInKpd-vRfViH~~~Pk~~EsYYQE~GR-----AGRDgl~s~c~lfy~~aD~~~~~~~l 358 (497) T TIGR00614 301 AFGMGINKPD-VRFVIHYSLPKSMESYYQESGR-----AGRDGLPSECVLFYAPADIARLRRLL 358 (497) T ss_pred ECCCCCCCCC-CCEEEEECCCCCCCCCCCCCCC-----CCCCCCCCCEEEEECHHHHHHHHHHH T ss_conf 1268887635-3678850788562110135555-----67897320102330435699998874

HHsearch alignment for GI: 254780130 and conserved domain: TIGR00614