HHsearch alignment for GI: 254780130 and conserved domain: TIGR01587

>TIGR01587 cas3_core CRISPR-associated helicase Cas3; InterPro: IPR006474 This entry represents a highly conserved core region of the Cas3 sequences. The proteins are found in association with CRISPR repeat elements in a broad range of bacteria and Archaea . Cas3 appears to be a helicase, containing a DEAD/DEAH box region and conserved C-terminal domain. Some but not all members have an N-terminal HD domain region (IPR006674 from INTERPRO), these sequences are not included within this group..
Probab=96.10  E-value=0.017  Score=33.34  Aligned_cols=116  Identities=12%  Similarity=0.246  Sum_probs=69.1

Q ss_pred             HHHHHHHHH-HHHC-CCCCEEEHHHHHHHHHHHHHHHHCC-----------------CCHHHH--HHHHHHHHC-----C
Q ss_conf             343349999-8614-8997110578999999987653047-----------------782348--999999727-----8
Q gi|254780130|r   54 EKIKALEVI-IEKA-NAAPIIVAYHFNSDLARLQKAFPQG-----------------RTLDKD--PCTIQEWNE-----G  107 (205)
Q Consensus        54 ~Kl~~l~~i-i~~~-~~~kviVf~~f~~~l~~l~~~~~~~-----------------~~~~~r--~~~i~~f~~-----~  107 (205)
T Consensus       253 ~~~~~~~~~~~~~~~~~~~~~ii~NtV~~A~~~Y~~~kE~~p~~~~~~L~HsRF~~~DR~~KEde~~~l~e~~~S~~~~~  332 (424)
T TIGR01587       253 GEISSLERLLLEELKKGGKVLIIVNTVDRAQEFYQKLKEKAPELEEVILLHSRFTEKDRAKKEDEAELLKELKKSAWKDN  332 (424)
T ss_pred             CCHHHHHHHHHHHCCCCCCEEEEEECHHHHHHHHHHHHHCCCCCCCEEEEECCCCHHHHHHHHHHHHHHHHHHCCCCCCC
T ss_conf             31346666778741577866999854389999999985126520021244044770036677679999998510135445


Q ss_pred             CCCEEEECHHHHHHHHHHHHHCCEEEEECCCCCHHHHHHHHHHHHHHHHHCCC--CCCCEEEEEEEECCC
Q ss_conf             98699972144323322432067589726899988802255557666542026--577539999983889
Q gi|254780130|r  108 KIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAG--FKRAVFVYYLIAQNT  175 (205)
Q Consensus       108 ~~~Vll~~~~a~g~GlnL~~a~~~vI~~~~~~n~~~~~Qa~~Ri~~~r~hR~G--Q~~~v~v~~l~~~~t  175 (205)
T Consensus       333 ~~~v~V~T-Qv~E~SlD~-s-~D~~i-Te~-aP~d~LiQR~GR~~R~~~-~~~d~~~~~~y~~~~~~~~~  396 (424)
T TIGR01587       333 EKFVIVAT-QVIEVSLDI-S-VDVMI-TEL-APIDSLIQRLGRLNRYGR-KIGDIENREVYILTILLEDK  396 (424)
T ss_pred             CCEEEEEE-EEEEEEEEC-C-CCHHH-HHC-CCHHHHHHHHHHHCCCCC-CCCCCCCCCEEEEEECCCCC
T ss_conf             77069987-878886420-4-44134-311-501233554211101135-65788987203785257888