RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780130|ref|YP_003064543.1| hypothetical protein CLIBASIA_00045 [Candidatus Liberibacter asiaticus str. psy62] (205 letters) >gnl|CDD|128766 smart00490, HELICc, helicase superfamily c-terminal domain. Length = 82 Score = 35.3 bits (82), Expect = 0.011 Identities = 16/53 (30%), Positives = 28/53 (52%), Gaps = 2/53 (3%) Query: 100 TIQEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIG 152 ++++N GKI +L A GL+L G ++++ + L W + Q I R G Sbjct: 29 ILEKFNNGKIKVLVA-TDVAERGLDLP-GVDLVIIYDLPWSPASYIQRIGRAG 79 >gnl|CDD|134340 PRK00650, PRK00650, 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase; Provisional. Length = 288 Score = 30.2 bits (68), Expect = 0.34 Identities = 21/95 (22%), Positives = 36/95 (37%), Gaps = 5/95 (5%) Query: 113 FAHPASCGHGLNLQYGGNIL--VFFSLWWDLEEHQQMIERIGVTRQRQAGFKRA---VFV 167 + P+ C NL+Y N L F L DL+E + +E + G + +FV Sbjct: 179 YVQPSDCSSRKNLEYTQNDLEKPVFRLRLDLKEKKHWLESLWAELPVHVGLTGSGATLFV 238 Query: 168 YYLIAQNTIDELVLQRLRTKSTIQDLLLNALKKET 202 Y Q R + LL + ++++ Sbjct: 239 RYPEILEKDPSYAAQIQRAITLSGGLLTSPIRRDP 273 >gnl|CDD|171518 PRK12463, PRK12463, chorismate synthase; Reviewed. Length = 390 Score = 29.3 bits (65), Expect = 0.75 Identities = 15/44 (34%), Positives = 23/44 (52%) Query: 59 LEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQ 102 L VI+E A + A H N +L R QK +GR + + T++ Sbjct: 14 LTVILEGVPAGLTLAAEHINKELLRRQKGHGRGRRMQIETDTVE 57 >gnl|CDD|184796 PRK14701, PRK14701, reverse gyrase; Provisional. Length = 1638 Score = 26.8 bits (59), Expect = 3.8 Identities = 11/31 (35%), Positives = 18/31 (58%), Gaps = 2/31 (6%) Query: 56 IKALEVIIEKANAAPIIVAYHFNSDLARLQK 86 ++ +E EKAN +V YH S+L + +K Sbjct: 139 VEKIESFCEKANLDVRLVYYH--SNLRKKEK 167 >gnl|CDD|179519 PRK02983, lysS, lysyl-tRNA synthetase; Provisional. Length = 1094 Score = 26.5 bits (59), Expect = 5.1 Identities = 8/12 (66%), Positives = 10/12 (83%) Query: 131 ILVFFSLWWDLE 142 +L+FFS WW LE Sbjct: 510 LLLFFSRWWQLE 521 >gnl|CDD|185588 PTZ00385, PTZ00385, lysyl-tRNA synthetase; Provisional. Length = 659 Score = 26.5 bits (58), Expect = 5.4 Identities = 14/34 (41%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Query: 2 KQYHKFQRELYCDLQGENIEAFNSASKTVKCLQL 35 +QYH+FQ++L D QG + EA +K LQ+ Sbjct: 496 EQYHRFQQQL-VDRQGGDEEAMPLDETFLKSLQV 528 >gnl|CDD|130816 TIGR01755, flav_wrbA, NAD(P)H:quinone oxidoreductase, type IV. This model represents a protein, WrbA, related to and slightly larger than flavodoxin. It was just shown, in E. coli and Archaeoglobus fulgidus (and previously for some eukaryotic homologs) to act as fourth type of NAD(P)H:quinone oxidoreductase. In E. coli, this protein was earlier reported to be produced during stationary phase, bind to the trp repressor, and make trp operon repression more efficient. WrbA does not interact with the trp operator by itself. Members are found in species in which homologs of the E. coli trp operon repressor TrpR are not detected. Length = 197 Score = 26.4 bits (58), Expect = 5.7 Identities = 15/57 (26%), Positives = 18/57 (31%), Gaps = 3/57 (5%) Query: 104 WNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAG 160 W G L S Q+GG S W L H +I + Q Q G Sbjct: 98 WASGA---LVGKVGSVFTSTGTQHGGQESTILSTWTTLLHHGMIIVPLPYAAQEQMG 151 >gnl|CDD|131661 TIGR02612, mob_myst_A, mobile mystery protein A. Members of this protein family are found in mobization-related contexts more often than not, including within a CRISPR-associated gene region in Geobacter sulfurreducens PCA, and on plasmids in Agrobacterium tumefaciens and Coxiella burnetii, always together with mobile mystery protein B, a member of the Fic protein family (pfam02661). This protein is encoded by the upstream member of the gene pair and belongs to a family of helix-turn-helix DNA binding proteins (pfam01381). Length = 150 Score = 25.9 bits (57), Expect = 8.1 Identities = 11/63 (17%), Positives = 24/63 (38%), Gaps = 20/63 (31%) Query: 146 QMIERIGVTRQRQAGFKRA--------------------VFVYYLIAQNTIDELVLQRLR 185 Q+ R+GVT QR +++ FVY + + +++ + + R Sbjct: 43 QLAGRLGVTPQRVEALEKSELSGTVTLKTLRAAAEALDCTFVYAFVPKTSLEATIRAQAR 102 Query: 186 TKS 188 + Sbjct: 103 KVA 105 >gnl|CDD|180602 PRK06521, PRK06521, hydrogenase 4 subunit B; Validated. Length = 667 Score = 25.6 bits (57), Expect = 9.1 Identities = 8/20 (40%), Positives = 13/20 (65%) Query: 153 VTRQRQAGFKRAVFVYYLIA 172 + R+A +RA F+Y L+A Sbjct: 154 IANHREAEIRRAGFLYLLMA 173 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.322 0.137 0.414 Gapped Lambda K H 0.267 0.0631 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 3,398,662 Number of extensions: 215647 Number of successful extensions: 378 Number of sequences better than 10.0: 1 Number of HSP's gapped: 377 Number of HSP's successfully gapped: 18 Length of query: 205 Length of database: 5,994,473 Length adjustment: 89 Effective length of query: 116 Effective length of database: 4,071,361 Effective search space: 472277876 Effective search space used: 472277876 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 55 (25.2 bits)