RPSBLAST alignment of GI: 254780130 and protein with PDBid: 3mwy

>3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} Length = 800
 Score = 78.0 bits (191), Expect = 1e-15
 Identities = 31/160 (19%), Positives = 61/160 (38%), Gaps = 20/160 (12%)

Query: 52  HDEKIKALEVIIE--KANAAPIIVAYHFNSDLARLQKAFPQ---------GRTLDKD-PC 99
              K+  L+ ++   K +   +++       L  L               G         
Sbjct: 554 SSGKMVLLDQLLTRLKKDGHRVLIFSQMVRMLDILGDYLSIKGINFQRLDGTVPSAQRRI 613

Query: 100 TIQEWNEG--KIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQR 157
           +I  +N       +      + G G+NL    + +V F   W+ +   Q + R    R  
Sbjct: 614 SIDHFNSPDSNDFVFLLSTRAGGLGINLM-TADTVVIFDSDWNPQADLQAMARA--HRIG 670

Query: 158 QAGFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNA 197
           Q   K  V VY L++++T++E VL+R R K  ++  +++ 
Sbjct: 671 Q---KNHVMVYRLVSKDTVEEEVLERARKKMILEYAIISL 707