HHsearch results for GI: 254780131 and protein with PDBid: 2owo_A

>2owo_A DNA ligase; protein/DNA complex, ligase/DNA complex; HET: DNA OMC AMP; 2.30A {Escherichia coli K12}
Probab=99.72  E-value=7.7e-18  Score=129.02  Aligned_cols=62  Identities=31%  Similarity=0.463  Sum_probs=59.9

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCC
Q ss_conf             99999999999999999975445898569899999999999999978742689897353889
Q gi|254780131|r   58 EAMIEVEYLVKIALHHQKWYYRLDDPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVGY  119 (119)
Q Consensus        58 EA~~eie~L~k~I~~Hn~~YY~~D~P~ISD~EYD~L~~eL~~LE~~~PeL~~~dSPT~~VGy  119 (119)
                      +++.|++.|+++|.+||++||++++|+|||++||+|+++|.+||.+||+++.++|||++||.
T Consensus         3 ~~~~~i~~L~~~i~~~~~~YY~~~~p~isD~eYD~L~~eL~~le~~~p~~~~~~spt~~VG~   64 (671)
T 2owo_A            3 SIEQQLTELRTTLRHHEYLYHVMDAPEIPDAEYDRLMRELRELETKHPELITPDSPTQRVGA   64 (671)
T ss_dssp             CHHHHHHHHHHHHHHHHHHHHHTTCSSBCCTHHHHHHHHHHHHHHHCTTSCCTTSGGGCCSC
T ss_pred             HHHHHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCC
T ss_conf             79999999999999999987449999789899999999999999868155699998654466