HHsearch results for GI: 254780131 and protein with PDBid: 3jsl_A

>3jsl_A DNA ligase; NAD+-dependent, DNA damage, DNA repair, DNA replication, magnesium, manganese, metal-binding, NAD, zinc; HET: DNA; 1.80A {Staphylococcus aureus} PDB: 3jsn_A*
Probab=99.61  E-value=8e-16  Score=116.71  Aligned_cols=62  Identities=27%  Similarity=0.342  Sum_probs=59.6

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCC
Q ss_conf             99999999999999999975445898569899999999999999978742689897353889
Q gi|254780131|r   58 EAMIEVEYLVKIALHHQKWYYRLDDPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVGY  119 (119)
Q Consensus        58 EA~~eie~L~k~I~~Hn~~YY~~D~P~ISD~EYD~L~~eL~~LE~~~PeL~~~dSPT~~VGy  119 (119)
                      ++..|++.|+++|.+||++||+.++|+|||++||+|+++|..||.+||+|+..+|||++||.
T Consensus         3 ~~~~~i~~L~~~i~~~~~~YY~~~~p~IsD~eYD~L~~~L~~le~~~p~l~~~~spt~~vg~   64 (318)
T 3jsl_A            3 DLSSRVNELHDLLNQYSYEYYVEDNPSVPDSEYDKLLHELIKIEEEHPEYKTVDSPTVRVGG   64 (318)
T ss_dssp             CCHHHHHHHHHHHHHHHHHHHTSCCCSSCHHHHHHHHHHHHHHHHHCGGGCCTTCGGGGGCC
T ss_pred             HHHHHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCC
T ss_conf             19999999999999999998728999798899999999999999868011478998755475