HHSEARCH alignment of GI: 254780131 and SCOP domain: d1ta8a_

Alignment
>d1ta8a_ d.142.2.2 (A:) Adenylation domain of NAD+-dependent DNA ligase {Enterococcus faecalis [TaxId: 1351]}
Probab=99.69  E-value=4.1e-17  Score=123.15  Aligned_cols=66  Identities=30%  Similarity=0.431  Sum_probs=64.0

Q ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCC
Q ss_conf             899999999999999999999975445898569899999999999999978742689897353889
Q gi|254780131|r   54 LSKGEAMIEVEYLVKIALHHQKWYYRLDDPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVGY  119 (119)
Q Consensus        54 Lsk~EA~~eie~L~k~I~~Hn~~YY~~D~P~ISD~EYD~L~~eL~~LE~~~PeL~~~dSPT~~VGy  119 (119)
                      |+-.+|..++++|+++|.+||++||+.++|+|||++||+|+++|.+||.+||+++.++|||++||.
T Consensus         2 ~~~~~~~~~~~~L~~~i~~~~~~Yy~~~~p~iSD~eYD~L~~~L~~le~~~p~~~~~~s~~~~vg~   67 (313)
T d1ta8a_           2 LTLTAATTRAQELRKQLNQYSHEYYVKDQPSVEDYVYDRLYKELVDIETEFPDLITPDSPTQRVGG   67 (313)
T ss_dssp             CCHHHHHHHHHHHHHHHHHHHHHHHTSSCCSSCHHHHHHHHHHHHHHHHHCGGGCCTTCGGGGGCC
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCC
T ss_conf             887899999999999999999998618999798899999999999999868022477885300245


SCOP domain information

class: Alpha and beta proteins (a+b)
fold: ATP-grasp
superfamily: DNA ligase/mRNA capping enzyme, catalytic domain
family: Adenylation domain of NAD+-dependent DNA ligase
domain: Adenylation domain of NAD+-dependent DNA ligase
species: Enterococcus faecalis [TaxId: 1351]