PSIBLAST alignment of GI: 254780131 and protein with PDB id: 1tae

>gi|56966058|pdb|1TAE|A Chain A, Structural Rearrangement Accompanying Nad+ Synthesis Within A Bacterial Dna Ligase Crystal Length = 332
>gi|56966059|pdb|1TAE|B Chain B, Structural Rearrangement Accompanying Nad+ Synthesis Within A Bacterial Dna Ligase Crystal Length = 332
 Score = 96.0 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 20/65 (30%), Positives = 30/65 (46%)

Query: 54  LSKGEAMIEVEYLVKIALHHQKWYYRLDDPLFTDGLYDRVSERLDALQEQFPELFDEDHP 113
           L+   A    + L K    +   YY  D P   D +YDR+ + L  ++ +FP+L   D P
Sbjct: 6   LTLTAATTRAQELRKQLNQYSHEYYVKDQPSVEDYVYDRLYKELVDIETEFPDLITPDSP 65

Query: 114 WNTVG 118
              VG
Sbjct: 66  TQRVG 70