RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780131|ref|YP_003064544.1| DNA ligase, NAD-dependent [Candidatus Liberibacter asiaticus str. psy62] (119 letters) >gnl|CDD|30621 COG0272, Lig, NAD-dependent DNA ligase (contains BRCT domain type II) [DNA replication, recombination, and repair]. Length = 667 Score = 56.7 bits (137), Expect = 2e-09 Identities = 25/66 (37%), Positives = 34/66 (51%) Query: 53 SLSKGEAMIEVEYLVKIALHHQKWYYRLDDPLFTDGLYDRVSERLDALQEQFPELFDEDH 112 + S EA E+E L ++ H YY LD P +D YD++ L L+E+ PEL D Sbjct: 1 AWSMAEAQEEIEELRELLNKHDYRYYVLDAPSVSDAEYDQLYRELQELEEKHPELITPDS 60 Query: 113 PWNTVG 118 P VG Sbjct: 61 PTQRVG 66 >gnl|CDD|145016 pfam01653, DNA_ligase_aden, NAD-dependent DNA ligase adenylation domain. DNA ligases catalyse the crucial step of joining the breaks in duplex DNA during DNA replication, repair and recombination, utilising either ATP or NAD(+) as a cofactor. This domain is the catalytic adenylation domain. The NAD+ group is covalently attached to this domain at the lysine in the KXDG motif of this domain. This enzyme- adenylate intermediate is an important feature of the proposed catalytic mechanism. Length = 315 Score = 53.5 bits (129), Expect = 1e-08 Identities = 26/61 (42%), Positives = 34/61 (55%) Query: 58 EAMIEVEYLVKIALHHQKWYYRLDDPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTV 117 EA E+ L ++ + YY LD+P D YDR+ RL AL+E+FPEL D P V Sbjct: 2 EAQQEIARLRELIRQYDYHYYVLDNPEVPDAEYDRLYRRLQALEEKFPELITPDSPTQRV 61 Query: 118 G 118 G Sbjct: 62 G 62 >gnl|CDD|29013 cd00114, LIGANc, NAD+ dependent DNA ligase adenylation domain. DNA ligases catalyze the crucial step of joining the breaks in duplex DNA during DNA replication, repair and recombination, utilizing either ATP or NAD(+) as a cofactor, but using the same basic reaction mechanism. The enzyme reacts with the cofactor to form a phosphoamide-linked AMP with the amino group of a conserved Lysine in the KXDG motif, and subsequently transfers it to the DNA substrate to yield adenylated DNA. This alignment contains members of the NAD+ dependent subfamily only.. Length = 307 Score = 51.4 bits (123), Expect = 6e-08 Identities = 22/57 (38%), Positives = 30/57 (52%) Query: 62 EVEYLVKIALHHQKWYYRLDDPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118 + L ++ H YY LD+P +D YDR+ L AL+E+ PEL D P VG Sbjct: 2 RIAELRELLNKHDYRYYVLDEPSVSDAEYDRLYRELRALEEEHPELKTPDSPTQRVG 58 >gnl|CDD|144194 pfam00508, PPV_E2_N, E2 (early) protein, N terminal. Length = 201 Score = 27.8 bits (63), Expect = 0.78 Identities = 13/18 (72%), Positives = 16/18 (88%) Query: 94 SERLDALQEQFPELFDED 111 SERLDALQEQ EL+++D Sbjct: 4 SERLDALQEQLLELYEKD 21 >gnl|CDD|143504 cd06831, PLPDE_III_ODC_like_AZI, Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzyme Ornithine Decarboxylase-like Antizyme Inhibitor. Antizyme inhibitor (AZI) is homologous to the fold type III PLP-dependent enzyme ODC but does not retain any decarboxylase activity. Like ODC, AZI is presumed to exist as a homodimer. Antizyme is a regulatory protein that binds directly to the ODC monomer to block its active site, leading to its degradation by the 26S proteasome. AZI binds to Antizyme with a higher affinity than ODC, preventing the formation of the Antizyme-ODC complex. Thus, AZI blocks the ability of Antizyme to promote ODC degradation, which leads to increased ODC enzymatic activity and polyamine levels. AZI also prevents the degradation of other proteins regulated by Antizyme, such as cyclin D1. Length = 394 Score = 26.7 bits (59), Expect = 1.5 Identities = 15/37 (40%), Positives = 21/37 (56%), Gaps = 4/37 (10%) Query: 73 HQKWYYRLDDPLFTDGLYDRVSERLDALQEQ--FPEL 107 H+K Y+ D+PLFT L+ + LD + E PEL Sbjct: 314 HKK--YKEDEPLFTSSLWGPSCDELDQIVESCLLPEL 348 >gnl|CDD|31304 COG1107, COG1107, Archaea-specific RecJ-like exonuclease, contains DnaJ-type Zn finger domain [DNA replication, recombination, and repair]. Length = 715 Score = 26.0 bits (57), Expect = 2.5 Identities = 21/63 (33%), Positives = 29/63 (46%), Gaps = 9/63 (14%) Query: 57 GEAMIEVEYLVKIA--LHHQKWYYR-------LDDPLFTDGLYDRVSERLDALQEQFPEL 107 E + E L KIA + ++ +Y R + D L T G DR E +D L EQ E Sbjct: 525 AERGYDREDLEKIALAVDYEAFYLRFMDGRGIIADILGTTGDADRHRELVDHLYEQAKEA 584 Query: 108 FDE 110 +E Sbjct: 585 VEE 587 >gnl|CDD|143492 cd06818, PLPDE_III_cryptic_DSD, Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzyme Bacterial Cryptic D-Serine Dehydratase. This subfamily is composed of Burkholderia cepacia cryptic D-serine dehydratase (cryptic DSD), which is also called D-serine deaminase, and similar bacterial proteins. Members of this subfamily are fold type III PLP-dependent enzymes with similarity to bacterial alanine racemase (AR), which contains an N-terminal PLP-binding TIM-barrel domain and a C-terminal beta-sandwich domain. AR exists as dimers with active sites that lie at the interface between the TIM barrel domain of one subunit and the beta-sandwich domain of the other subunit. Based on similarity, it is possible cryptic DSDs may also form dimers. Cryptic DSDs are distinct from the ubiquitous bacterial DSDs coded by the dsdA gene, mammalian L-serine dehydratases (LSD) and mammalian serine racemase (SerRac), which are fold type II PLP-dependent enzymes. At present, the enzymatic and biochemical properties of cryptic DSDs are still poorly understood. Typically, DSDs catalyze the dehydration of D-serine to aminoacrylate, which is rapidly hydrolyzed to pyruvate and ammonia. Length = 382 Score = 26.1 bits (58), Expect = 2.6 Identities = 9/32 (28%), Positives = 14/32 (43%), Gaps = 3/32 (9%) Query: 77 YYRLDDPLFTDG---LYDRVSERLDALQEQFP 105 + + + T G +D V+E L AL P Sbjct: 202 LFPDRELILTAGGSAWFDLVAEALAALALDGP 233 >gnl|CDD|37310 KOG2099, KOG2099, KOG2099, Glycogen phosphorylase [Carbohydrate transport and metabolism]. Length = 843 Score = 26.1 bits (57), Expect = 2.7 Identities = 15/50 (30%), Positives = 23/50 (46%), Gaps = 1/50 (2%) Query: 8 FRSSKFENEHN-ITPAQWKKLLTLEAKFLPNKRALESWLDKAKKVTSLSK 56 KF+N+ N ITP +W L L ++ E W+ ++T L K Sbjct: 476 LEPEKFQNKTNGITPRRWLLLCNPGLADLITEKIGEEWITDLDQLTKLRK 525 >gnl|CDD|176946 CHL00001, rpoB, RNA polymerase beta subunit. Length = 1070 Score = 26.0 bits (58), Expect = 2.8 Identities = 15/64 (23%), Positives = 28/64 (43%), Gaps = 16/64 (25%) Query: 41 LESWLDKAKKVTSLSKGEAMIEVEYLVKIALHHQKWYYRLDDPLFTDGLYDRVSERLDAL 100 S+L+ +K SK A++E +Q++ DP+F++ L L Sbjct: 204 FLSFLNDKEKKKIGSKENAILEF---------YQQFACVGGDPVFSESLC-------KEL 247 Query: 101 QEQF 104 Q++F Sbjct: 248 QKKF 251 >gnl|CDD|33492 COG3696, COG3696, Putative silver efflux pump [Inorganic ion transport and metabolism]. Length = 1027 Score = 25.6 bits (56), Expect = 3.0 Identities = 14/28 (50%), Positives = 16/28 (57%), Gaps = 5/28 (17%) Query: 84 LFTDG--LY---DRVSERLDALQEQFPE 106 +F DG LY RV ERL +Q Q PE Sbjct: 96 IFKDGTDLYWARQRVLERLSQVQSQLPE 123 >gnl|CDD|145808 pfam02841, GBP_C, Guanylate-binding protein, C-terminal domain. Transcription of the anti-viral guanylate-binding protein (GBP) is induced by interferon-gamma during macrophage induction. This family contains GBP1 and GPB2, both GTPases capable of binding GTP, GDP and GMP. Length = 297 Score = 25.7 bits (57), Expect = 3.3 Identities = 15/53 (28%), Positives = 27/53 (50%), Gaps = 2/53 (3%) Query: 12 KFENEHNITPAQWKKLLTLEAKFLPNKRALESWLDKAKKVTSLSKGEAMIEVE 64 K E ++N P + K + +FL +K A+E + + + +L+ E IE E Sbjct: 159 KLEAKYNQVPRKGVKAEEVLQEFLNSKEAVEEAILQTDQ--ALTAKEKAIEAE 209 >gnl|CDD|36524 KOG1310, KOG1310, KOG1310, WD40 repeat protein [General function prediction only]. Length = 758 Score = 25.1 bits (54), Expect = 4.3 Identities = 11/40 (27%), Positives = 14/40 (35%) Query: 73 HQKWYYRLDDPLFTDGLYDRVSERLDALQEQFPELFDEDH 112 QK ++RL L Y ALQ FP + Sbjct: 444 IQKAHFRLARALNELTRYLEALSCHWALQMSFPTDVARQN 483 >gnl|CDD|35731 KOG0511, KOG0511, KOG0511, Ankyrin repeat protein [General function prediction only]. Length = 516 Score = 25.0 bits (54), Expect = 4.7 Identities = 11/39 (28%), Positives = 18/39 (46%), Gaps = 1/39 (2%) Query: 4 FDRVFRSSKFENEHNITPAQWKKLLTLEAKFLPNKRALE 42 F + + N + Q+ LL++E KF K +LE Sbjct: 200 FSPFLKQ-LYLNTNAEWKDQYNALLSIEVKFSKEKLSLE 237 >gnl|CDD|107272 cd06277, PBP1_LacI_like_1, Ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors. This group includes the ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors. The LacI-GalR family repressors are composed of two functional domains: an N-terminal HTH (helix-turn-helix) domain, which is responsible for the DNA-binding specificity, and a C-terminal ligand-binding domain, which is homologous to the sugar-binding domain of ABC-type transport systems that contain the type I periplasmic binding protein-like fold. As also observed in the periplasmic binding proteins, the C-terminal domain of the bacterial transcription repressor undergoes a conformational change upon ligand binding which in turn changes the DNA binding affinity of the repressor. Length = 268 Score = 24.9 bits (55), Expect = 4.8 Identities = 12/49 (24%), Positives = 21/49 (42%), Gaps = 3/49 (6%) Query: 63 VEYLVKIALHHQKWYYRLDDPLFTDGLYDRVSERLDALQEQFPELFDED 111 EYL I H+K + + DPL++ +R AL + ++ Sbjct: 110 TEYL--IEKGHRKIGF-VGDPLYSPSFEERYEGYKKALLDHGIPFNEDY 155 >gnl|CDD|63864 cd04395, RhoGAP_ARHGAP21, RhoGAP_ARHGAP21: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of ArhGAP21-like proteins. ArhGAP21 is a multi-domain protein, containing RhoGAP, PH and PDZ domains, and is believed to play a role in the organization of the cell-cell junction complex. It has been shown to function as a GAP of Cdc42 and RhoA, and to interact with alpha-catenin and Arf6. Small GTPases cluster into distinct families, and all act as molecular switches, active in their GTP-bound form but inactive when GDP-bound. The Rho family of GTPases activates effectors involved in a wide variety of developmental processes, including regulation of cytoskeleton formation, cell proliferation and the JNK signaling pathway. GTPases generally have a low intrinsic GTPase hydrolytic activity but there are family-specific groups of GAPs that enhance the rate of GTP hydrolysis by several orders of magnitude.. Length = 196 Score = 24.9 bits (54), Expect = 6.0 Identities = 18/55 (32%), Positives = 28/55 (50%), Gaps = 12/55 (21%) Query: 75 KWYYR-LDDPLFTDGLY------DRVS---ERLDALQEQFPELFDEDHPWNTVGY 119 K ++R L +PLFT+ LY +R+ ERL L+ L DH + T+ + Sbjct: 81 KSFFRKLPEPLFTNELYPDFIEANRIEDPVERLKELRRLIHSL--PDHHYETLKH 133 >gnl|CDD|35737 KOG0517, KOG0517, KOG0517, Beta-spectrin [Cytoskeleton]. Length = 2473 Score = 24.6 bits (53), Expect = 6.3 Identities = 19/88 (21%), Positives = 37/88 (42%), Gaps = 14/88 (15%) Query: 34 FLPNKRALESWLDKAKKV-------TSLSKGEAMIEVEYLVKIALH-HQKWYYRLDD--- 82 FL + ++WL+ + L++ E +++ ++ + +Q+ Y R+ Sbjct: 1062 FLRDLDDFQAWLESTQTQVASEEGPVDLAEAEQLLKQHAALREEIDGYQEDYQRMRALGE 1121 Query: 83 ---PLFTDGLYDRVSERLDALQEQFPEL 107 TD Y + ERL AL + EL Sbjct: 1122 TVADGQTDPQYLFLRERLQALGTGWEEL 1149 >gnl|CDD|63853 cd04384, RhoGAP_CdGAP, RhoGAP_CdGAP: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of CdGAP-like proteins; CdGAP contains an N-terminal RhoGAP domain and a C-terminal proline-rich region, and it is active on both Cdc42 and Rac1 but not RhoA. CdGAP is recruited to focal adhesions via the interaction with the scaffold protein actopaxin (alpha-parvin). Small GTPases cluster into distinct families, and all act as molecular switches, active in their GTP-bound form but inactive when GDP-bound. The Rho family of GTPases activates effectors involved in a wide variety of developmental processes, including regulation of cytoskeleton formation, cell proliferation and the JNK signaling pathway. GTPases generally have a low intrinsic GTPase hydrolytic activity but there are family-specific groups of GAPs that enhance the rate of GTP hydrolysis by several orders of magnitude.. Length = 195 Score = 24.1 bits (52), Expect = 9.2 Identities = 12/26 (46%), Positives = 17/26 (65%), Gaps = 1/26 (3%) Query: 75 KWYYR-LDDPLFTDGLYDRVSERLDA 99 K Y+R L +PL T LY++ SE + A Sbjct: 80 KLYFRELPNPLLTYQLYEKFSEAVSA 105 >gnl|CDD|176897 cd08888, SRPBCC_PITPNA-B_like, Lipid-binding SRPBCC domain of mammalian PITPNA, -B, and related proteins (Class I PITPs). This subgroup includes the SRPBCC (START/RHO_alpha_C/PITP/Bet_v1/CoxG/CalC) domain of mammalian Class 1 phosphatidylinositol transfer proteins (PITPs), PITPNA/PITPalpha and PITPNB/PITPbeta, Drosophila vibrator, and related proteins. These are single domain proteins belonging to the PITP family of lipid transfer proteins, and to the SRPBCC domain superfamily of proteins that bind hydrophobic ligands. SRPBCC domains have a deep hydrophobic ligand-binding pocket. In vitro, PITPs bind phosphatidylinositol (PtdIns), as well as phosphatidylcholine (PtdCho) but with a lower affinity. They transfer these lipids from one membrane compartment to another. The cellular roles of PITPs include inositol lipid signaling, PtdIns metabolism, and membrane trafficking. In addition, PITPNB transfers sphingomyelin in vitro, with a low affinity. PITPNA is found chiefly in the nucleus and cytoplasm; it is enriched in the brain and predominantly localized in the axons. A reduced expression of PITPNA contributes to the neurodegenerative phenotype of the mouse vibrator mutation. The role of PITPNA in vivo may be to provide PtdIns for localized PI3K-dependent signaling, thereby controlling the polarized extension of axonal processes. PITPNA homozygous null mice die soon after birth from complicated organ failure, including intestinal and hepatic steatosis, hypoglycemia, and spinocerebellar disease. PITPNB is associated with the Golgi and ER, and is highly expressed in the liver. Deletion of the PITPNB gene results in embryonic lethality. The PtdIns and PtdCho exchange activity of PITPNB is required for COPI-mediated retrograde transport from the Golgi to the ER. Drosophila vibrator localizes to the ER, and has an essential role in cytokinesis during mitosis and meiosis. Length = 258 Score = 24.3 bits (53), Expect = 9.3 Identities = 7/15 (46%), Positives = 10/15 (66%) Query: 12 KFENEHNITPAQWKK 26 EN HN+ P +WK+ Sbjct: 120 TQENVHNLDPEEWKE 134 >gnl|CDD|144275 pfam00620, RhoGAP, RhoGAP domain. GTPase activator proteins towards Rho/Rac/Cdc42-like small GTPases. Length = 152 Score = 24.1 bits (53), Expect = 9.3 Identities = 13/38 (34%), Positives = 19/38 (50%), Gaps = 10/38 (26%) Query: 75 KWYYR-LDDPLFTDGLYDRV---------SERLDALQE 102 K + R L +PL T LY+ ER++AL+E Sbjct: 61 KLFLRELPEPLLTFELYEEFLEAAKSEDEEERIEALRE 98 >gnl|CDD|37255 KOG2044, KOG2044, KOG2044, 5'-3' exonuclease HKE1/RAT1 [Replication, recombination and repair, RNA processing and modification]. Length = 931 Score = 24.2 bits (52), Expect = 9.3 Identities = 12/39 (30%), Positives = 19/39 (48%) Query: 6 RVFRSSKFENEHNITPAQWKKLLTLEAKFLPNKRALESW 44 R FR++K E + ++ E KFLP K E++ Sbjct: 117 RRFRAAKEAAEKEAEIERLREEFEAEGKFLPPKVKKETF 155 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.319 0.136 0.420 Gapped Lambda K H 0.267 0.0811 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 1,547,230 Number of extensions: 72336 Number of successful extensions: 266 Number of sequences better than 10.0: 1 Number of HSP's gapped: 266 Number of HSP's successfully gapped: 36 Length of query: 119 Length of database: 6,263,737 Length adjustment: 81 Effective length of query: 38 Effective length of database: 4,513,408 Effective search space: 171509504 Effective search space used: 171509504 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (23.3 bits)