RPSBLAST alignment of GI: 254780131 and MMDB domain: 2owo_A_1-60_117-236

>2owo_A (A:1-60,A:117-236) DNA ligase; protein/DNA complex, ligase/DNA complex; HET: DNA OMC AMP; 2.30A {Escherichia coli K12}Length = 180
 Score = 65.7 bits (160), Expect = 2e-12
 Identities = 17/56 (30%), Positives = 25/56 (44%)

Query: 58  EAMIEVEYLVKIALHHQKWYYRLDDPLFTDGLYDRVSERLDALQEQFPELFDEDHP 113
               ++  L     HH+  Y+ +D P   D  YDR+   L  L+ + PEL   D P
Sbjct: 3   SIEQQLTELRTTLRHHEYLYHVMDAPEIPDAEYDRLMRELRELETKHPELITPDSP 58