RPSBLAST alignment of GI: 254780131 and protein with PDBid: 1b04

>1b04_A Protein (DNA ligase); DNA replication; 2.80A {Bacillus stearothermophilus} SCOP: d.142.2.2 Length = 318
 Score = 51.1 bits (121), Expect = 6e-08
 Identities = 20/60 (33%), Positives = 31/60 (51%)

Query: 54  LSKGEAMIEVEYLVKIALHHQKWYYRLDDPLFTDGLYDRVSERLDALQEQFPELFDEDHP 113
           + + +A      L ++   +   YY LD P   D  YDR+ + L A++EQ+PEL   D P
Sbjct: 1   MDRQQAERRAAELRELLNRYGYEYYVLDRPSVPDAEYDRLMQELIAIEEQYPELKTSDSP 60