RPSBLAST alignment of GI: 254780131 and protein with PDBid: 2owo

>2owo_A DNA ligase; protein/DNA complex, ligase/DNA complex; HET: DNA OMC AMP; 2.30A {Escherichia coli K12} Length = 671
 Score = 56.8 bits (136), Expect = 1e-09
 Identities = 19/58 (32%), Positives = 27/58 (46%)

Query: 62  EVEYLVKIALHHQKWYYRLDDPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVGY 119
           ++  L     HH+  Y+ +D P   D  YDR+   L  L+ + PEL   D P   VG 
Sbjct: 7   QLTELRTTLRHHEYLYHVMDAPEIPDAEYDRLMRELRELETKHPELITPDSPTQRVGA 64