RPSBLAST alignment of GI: 254780131 and SCOP domain: d1b04a_

Alignment
>d1b04a_ d.142.2.2 (A:) Adenylation domain of NAD+-dependent DNA ligase {Bacillus stearothermophilus [TaxId: 1422]} Length = 312
 Score = 49.6 bits (117), Expect = 8e-08
 Identities = 21/64 (32%), Positives = 32/64 (50%)

Query: 56  KGEAMIEVEYLVKIALHHQKWYYRLDDPLFTDGLYDRVSERLDALQEQFPELFDEDHPWN 115
           + +A      L ++   +   YY LD P   D  YDR+ + L A++EQ+PEL   D P  
Sbjct: 2   RQQAERRAAELRELLNRYGYEYYVLDRPSVPDAEYDRLMQELIAIEEQYPELKTSDSPTQ 61

Query: 116 TVGY 119
            +G 
Sbjct: 62  RIGG 65

SCOP domain information

class: Alpha and beta proteins (a+b)
fold: ATP-grasp
superfamily: DNA ligase/mRNA capping enzyme, catalytic domain
family: Adenylation domain of NAD+-dependent DNA ligase
domain: Adenylation domain of NAD+-dependent DNA ligase
species: Bacillus stearothermophilus [TaxId: 1422]