BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780131|ref|YP_003064544.1| DNA ligase, NAD-dependent [Candidatus Liberibacter asiaticus str. psy62] (119 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780131|ref|YP_003064544.1| DNA ligase, NAD-dependent [Candidatus Liberibacter asiaticus str. psy62] Length = 119 Score = 247 bits (630), Expect = 5e-68, Method: Compositional matrix adjust. Identities = 119/119 (100%), Positives = 119/119 (100%) Query: 1 MYNFDRVFRSSKFENEHNITPAQWKKLLTLEAKFLPNKRALESWLDKAKKVTSLSKGEAM 60 MYNFDRVFRSSKFENEHNITPAQWKKLLTLEAKFLPNKRALESWLDKAKKVTSLSKGEAM Sbjct: 1 MYNFDRVFRSSKFENEHNITPAQWKKLLTLEAKFLPNKRALESWLDKAKKVTSLSKGEAM 60 Query: 61 IEVEYLVKIALHHQKWYYRLDDPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVGY 119 IEVEYLVKIALHHQKWYYRLDDPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVGY Sbjct: 61 IEVEYLVKIALHHQKWYYRLDDPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVGY 119 >gi|254781196|ref|YP_003065609.1| DNA ligase, NAD-dependent [Candidatus Liberibacter asiaticus str. psy62] Length = 119 Score = 245 bits (626), Expect = 1e-67, Method: Compositional matrix adjust. Identities = 118/119 (99%), Positives = 119/119 (100%) Query: 1 MYNFDRVFRSSKFENEHNITPAQWKKLLTLEAKFLPNKRALESWLDKAKKVTSLSKGEAM 60 MYNFDRVFRSSKFENEHNITPAQWKKLLTLEAKFLPNKRALESWLDKAKKVTSLSKGEAM Sbjct: 1 MYNFDRVFRSSKFENEHNITPAQWKKLLTLEAKFLPNKRALESWLDKAKKVTSLSKGEAM 60 Query: 61 IEVEYLVKIALHHQKWYYRLDDPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVGY 119 IEVEYLVKIALHHQKWYYRLD+PLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVGY Sbjct: 61 IEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVGY 119 >gi|254781172|ref|YP_003065585.1| NAD-dependent DNA ligase LigA [Candidatus Liberibacter asiaticus str. psy62] Length = 731 Score = 40.4 bits (93), Expect = 1e-05, Method: Composition-based stats. Identities = 22/71 (30%), Positives = 35/71 (49%), Gaps = 3/71 (4%) Query: 51 VTSLSKGEAMIEVEYLVKIALHHQKWYYRLDDPLFTDGLYDRVSERLDALQEQFPELF-- 108 + +LS +A E+ L + +H YY+ P+ D YD + R DA+ FP+L Sbjct: 9 IEALSIEQARKELSSLEQEISYHDDCYYQYSKPIILDSEYDALKRRCDAIAHAFPDLARS 68 Query: 109 -DEDHPWNTVG 118 D + P N +G Sbjct: 69 EDPNGPLNKIG 79 >gi|254780767|ref|YP_003065180.1| lipid-A-disaccharide synthase [Candidatus Liberibacter asiaticus str. psy62] Length = 383 Score = 27.3 bits (59), Expect = 0.087, Method: Composition-based stats. Identities = 13/28 (46%), Positives = 16/28 (57%), Gaps = 5/28 (17%) Query: 15 NEHNITPAQWKKLLTLEAKFLPNKRALE 42 N+ TP+QWKK+L LP RA E Sbjct: 183 NKQRNTPSQWKKIL-----LLPGSRAQE 205 >537021.9.peg.937_1 Length = 48 Score = 25.0 bits (53), Expect = 0.43, Method: Compositional matrix adjust. Identities = 9/22 (40%), Positives = 13/22 (59%) Query: 66 LVKIALHHQKWYYRLDDPLFTD 87 L+K+ L H Y +D+PLF Sbjct: 24 LIKVILFHSMTGYYIDNPLFCS 45 >gi|254780508|ref|YP_003064921.1| hypothetical protein CLIBASIA_01975 [Candidatus Liberibacter asiaticus str. psy62] Length = 123 Score = 24.3 bits (51), Expect = 0.77, Method: Compositional matrix adjust. Identities = 13/34 (38%), Positives = 19/34 (55%) Query: 25 KKLLTLEAKFLPNKRALESWLDKAKKVTSLSKGE 58 +++ TL K N LES+LD A+ V L K + Sbjct: 65 EQIRTLHEKLALNSSLLESYLDAARVVADLFKKQ 98 >gi|254780921|ref|YP_003065334.1| dTDP-4-dehydrorhamnose reductase [Candidatus Liberibacter asiaticus str. psy62] Length = 290 Score = 21.6 bits (44), Expect = 4.1, Method: Compositional matrix adjust. Identities = 8/17 (47%), Positives = 10/17 (58%) Query: 10 SSKFENEHNITPAQWKK 26 SK N HNI + WK+ Sbjct: 265 CSKLANTHNIRISTWKE 281 >gi|254781099|ref|YP_003065512.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Candidatus Liberibacter asiaticus str. psy62] Length = 468 Score = 21.6 bits (44), Expect = 4.2, Method: Composition-based stats. Identities = 9/30 (30%), Positives = 17/30 (56%) Query: 27 LLTLEAKFLPNKRALESWLDKAKKVTSLSK 56 LL + L LE++++ KK+ ++SK Sbjct: 186 LLNISPDHLDRHHTLENYVNIKKKIVTMSK 215 >gi|254780602|ref|YP_003065015.1| aspartate aminotransferase [Candidatus Liberibacter asiaticus str. psy62] Length = 400 Score = 21.6 bits (44), Expect = 4.3, Method: Composition-based stats. Identities = 7/24 (29%), Positives = 16/24 (66%) Query: 7 VFRSSKFENEHNITPAQWKKLLTL 30 V+R+ +F N N+ P+ +++ L + Sbjct: 211 VYRNCQFSNIVNVEPSLYERTLVV 234 >gi|254780558|ref|YP_003064971.1| hypothetical protein CLIBASIA_02225 [Candidatus Liberibacter asiaticus str. psy62] Length = 396 Score = 20.8 bits (42), Expect = 6.7, Method: Composition-based stats. Identities = 16/47 (34%), Positives = 26/47 (55%), Gaps = 12/47 (25%) Query: 18 NITPAQWKKLLTLEAKFLPNKRALESWLDKAKKVTSLSKG-EAMIEV 63 N+ PA +TL F N +L+ W+ +AKK KG EA++++ Sbjct: 192 NLLPAN----ITL--AFASNGNSLDRWMKEAKK-----KGQEAILQI 227 >gi|254780680|ref|YP_003065093.1| seryl-tRNA synthetase [Candidatus Liberibacter asiaticus str. psy62] Length = 430 Score = 20.8 bits (42), Expect = 7.2, Method: Composition-based stats. Identities = 9/24 (37%), Positives = 12/24 (50%) Query: 89 LYDRVSERLDALQEQFPELFDEDH 112 L D + L+EQ P L E+H Sbjct: 69 LVDALKNETSTLKEQLPILEKEEH 92 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.319 0.136 0.420 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 77,639 Number of Sequences: 1233 Number of extensions: 2707 Number of successful extensions: 12 Number of sequences better than 100.0: 12 Number of HSP's better than 100.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of query: 119 length of database: 328,796 effective HSP length: 64 effective length of query: 55 effective length of database: 249,884 effective search space: 13743620 effective search space used: 13743620 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 33 (17.3 bits)