RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780132|ref|YP_003064545.1| guanylate kinase [Candidatus Liberibacter asiaticus str. psy62] (186 letters) >gnl|CDD|132307 TIGR03263, guanyl_kin, guanylate kinase. Members of this family are the enzyme guanylate kinase, also called GMP kinase. This enzyme transfers a phosphate from ATP to GMP, yielding ADP and GDP. Length = 180 Score = 113 bits (285), Expect = 3e-26 Identities = 57/173 (32%), Positives = 86/173 (49%), Gaps = 7/173 (4%) Query: 4 IFVLIGASGVGKTTIAKQVVLNSEYLVMPVGVTTRRPRVDEKQYIDYRFISQSQFKGWKH 63 + V+ G SGVGK+T+ K ++ L + TTR+PR E +DY F+S+ +F+ Sbjct: 3 LIVISGPSGVGKSTLVKALLEEDPNLKFSISATTRKPRPGEVDGVDYFFVSKEEFEEMIA 62 Query: 64 TGLFIETTKVRDEYYGYLKEDINNPMEHGYDILLILTHQGLAPLKKLYEDQVTSIFIAPP 123 G F+E +V YYG K + + G D+LL + QG +KK + D SIFI PP Sbjct: 63 AGEFLEWAEVHGNYYGTPKSPVEEALAAGKDVLLEIDVQGARQVKKKFPD-AVSIFILPP 121 Query: 124 SEAELIQRRIKRREDIPFNLDPDL------FGKNHSYSFTIVNNHLPTACRQV 170 S EL +R KR D ++ L + + IVN+ L A ++ Sbjct: 122 SLEELERRLRKRGTDSEEVIERRLAKAKKEIAHADEFDYVIVNDDLEKAVEEL 174 >gnl|CDD|178968 PRK00300, gmk, guanylate kinase; Provisional. Length = 205 Score = 109 bits (274), Expect = 7e-25 Identities = 60/182 (32%), Positives = 86/182 (47%), Gaps = 25/182 (13%) Query: 4 IFVLIGASGVGKTTIAKQVVLNSEYLVMPVGVTTRRPRVDEKQYIDYRFISQSQFKGWKH 63 + VL G SG GK+T+ K ++ L + V TTR PR E +DY F+S+ +F+ Sbjct: 7 LIVLSGPSGAGKSTLVKALLERDPNLQLSVSATTRAPRPGEVDGVDYFFVSKEEFEEMIE 66 Query: 64 TGLFIETTKVRDEYYGYLKEDINNPMEHGYDILLILTHQGLAPLKKLYEDQVTSIFIAPP 123 G F+E +V YYG + + + G D+LL + QG +KK D SIFI PP Sbjct: 67 NGEFLEWAEVFGNYYGTPRSPVEEALAAGKDVLLEIDWQGARQVKKKMPD-AVSIFILPP 125 Query: 124 SEAEL--------------IQRRIKR-REDIPFNLDPDLFGKNHSYSFTIVNNHLPTACR 168 S EL I RR+ + RE+I Y + IVN+ L TA Sbjct: 126 SLEELERRLRGRGTDSEEVIARRLAKAREEIAH---------ASEYDYVIVNDDLDTALE 176 Query: 169 QV 170 ++ Sbjct: 177 EL 178 >gnl|CDD|128386 smart00072, GuKc, Guanylate kinase homologues. Active enzymes catalyze ATP-dependent phosphorylation of GMP to GDP. Structure resembles that of adenylate kinase. So-called membrane-associated guanylate kinase homologues (MAGUKs) do not possess guanylate kinase activities; instead at least some possess protein-binding functions. Length = 184 Score = 94.7 bits (236), Expect = 1e-20 Identities = 57/174 (32%), Positives = 83/174 (47%), Gaps = 8/174 (4%) Query: 4 IFVLIGASGVGKTTIAKQVVL-NSEYLVMPVGVTTRRPRVDEKQYIDYRFISQSQFKGWK 62 VL G SGVGK T+ +++ + V TTR PR E +DY F+S+ +F+ Sbjct: 4 PIVLSGPSGVGKGTLLAELIQEIPDAFERVVSHTTRPPRPGEVNGVDYHFVSREEFEDDI 63 Query: 63 HTGLFIETTKVRDEYYGYLKEDINNPMEHGYDILLILTHQGLAPLKKLYEDQVTSIFIAP 122 +GLF+E + YYG KE I E G LL + QG+ L+K + IFIAP Sbjct: 64 KSGLFLEWGEYSGNYYGTSKETIRQVAEQGKHCLLDIDPQGVKQLRKAQLYPI-VIFIAP 122 Query: 123 PSEAELIQRRIKRREDIPFNLDPDL------FGKNHSYSFTIVNNHLPTACRQV 170 PS EL +R R + + L + H + + IVN+ L A ++ Sbjct: 123 PSSEELERRLRGRGTETAERIQKRLAAAQKEAQEYHLFDYVIVNDDLEDAYEEL 176 >gnl|CDD|184809 PRK14738, gmk, guanylate kinase; Provisional. Length = 206 Score = 80.5 bits (199), Expect = 3e-16 Identities = 44/139 (31%), Positives = 68/139 (48%), Gaps = 1/139 (0%) Query: 6 VLIGASGVGKTTIAKQVVLNSEYLVMPVGVTTRRPRVDEKQYIDYRFISQSQFKGWKHTG 65 V+ G SGVGK + ++ V TTR R E +DY F++ +F+ Sbjct: 17 VISGPSGVGKDAVLARMRERKLPFHFVVTATTRPKRPGEIDGVDYHFVTPEEFREMISQN 76 Query: 66 LFIETTKVRDEYYGYLKEDINNPMEHGYDILLILTHQGLAPLKKLYEDQVTSIFIAPPSE 125 +E +V YYG K + + G D+++ + QG A +K+L + V IF+APPS Sbjct: 77 ELLEWAEVYGNYYGVPKAPVRQALASGRDVIVKVDVQGAASIKRLVPEAVF-IFLAPPSM 135 Query: 126 AELIQRRIKRREDIPFNLD 144 EL +R RR + P L+ Sbjct: 136 DELTRRLELRRTESPEELE 154 >gnl|CDD|173199 PRK14737, gmk, guanylate kinase; Provisional. Length = 186 Score = 78.9 bits (194), Expect = 8e-16 Identities = 46/176 (26%), Positives = 88/176 (50%), Gaps = 6/176 (3%) Query: 4 IFVLIGASGVGKTTIAKQVVLNSEYLVMPVGVTTRRPRVDEKQYIDYRFISQSQFKGWKH 63 +F++ +G GK+TI + ++ + + TTR PR +++ Y F++ +FK Sbjct: 6 LFIISSVAGGGKSTIIQALLEEHPDFLFSISCTTRAPRPGDEEGKTYFFLTIEEFKKGIA 65 Query: 64 TGLFIETTKVRDEYYGYLKEDINNPMEHGYDILLILTHQGLAPLKKLYEDQVTSIFIAPP 123 G F+E +V D YYG K I + + G ++ + QG +K+ + +++ +IFI PP Sbjct: 66 DGEFLEWAEVHDNYYGTPKAFIEDAFKEGRSAIMDIDVQGAKIIKEKFPERIVTIFIEPP 125 Query: 124 SEAELIQRRIKRREDIPFNLDPDL------FGKNHSYSFTIVNNHLPTACRQVGLI 173 SE E +R I R D +++ + + + + + I+N+ L A + I Sbjct: 126 SEEEWEERLIHRGTDSEESIEKRIENGIIELDEANEFDYKIINDDLEDAIADLEAI 181 >gnl|CDD|178371 PLN02772, PLN02772, guanylate kinase. Length = 398 Score = 49.8 bits (119), Expect = 4e-07 Identities = 44/135 (32%), Positives = 63/135 (46%), Gaps = 9/135 (6%) Query: 6 VLIGASGVGK-TTIAKQVVLNSEYLVM---PVGVTTRRPRVDEKQYIDYRFISQSQFKGW 61 V+ G SGVGK T I+ L E+ M V TTR PR EK + Y F +S + Sbjct: 139 VISGPSGVGKGTLISM---LMKEFPSMFGFSVSHTTRAPREMEKDGVHYHFTERSVMEKE 195 Query: 62 KHTGLFIETTKVRDEYYGYLKEDINNPMEHGYDILLILTHQGLAPLKKLYEDQVTSIFIA 121 G F+E V YG E + + G +L + QG ++ + + IFI Sbjct: 196 IKDGKFLEFASVHGNLYGTSIEAVEVVTDSGKRCILDIDVQGARSVRASSLEAIF-IFIC 254 Query: 122 PPSEAELIQRRIKRR 136 PPS EL ++R++ R Sbjct: 255 PPSMEEL-EKRLRAR 268 >gnl|CDD|180790 PRK07003, PRK07003, DNA polymerase III subunits gamma and tau; Validated. Length = 830 Score = 34.1 bits (78), Expect = 0.024 Identities = 21/54 (38%), Positives = 28/54 (51%), Gaps = 8/54 (14%) Query: 3 HIFVLIGASGVGKTTI----AKQVVLNSEYLV--MPVGVTTRRPRVDEKQYIDY 50 H ++ G GVGKTT+ AK LN E V P GV +DE +++DY Sbjct: 39 HAYLFTGTRGVGKTTLSRIFAK--ALNCETGVTSQPCGVCRACREIDEGRFVDY 90 >gnl|CDD|169554 PRK08691, PRK08691, DNA polymerase III subunits gamma and tau; Validated. Length = 709 Score = 33.9 bits (77), Expect = 0.028 Identities = 20/51 (39%), Positives = 28/51 (54%), Gaps = 4/51 (7%) Query: 3 HIFVLIGASGVGKTTIAKQVV--LNSEYLVM--PVGVTTRRPRVDEKQYID 49 H ++L G GVGKTTIA+ + LN E P GV ++D +Y+D Sbjct: 39 HAYLLTGTRGVGKTTIARILAKSLNCENAQHGEPCGVCQSCTQIDAGRYVD 89 >gnl|CDD|184929 PRK14965, PRK14965, DNA polymerase III subunits gamma and tau; Provisional. Length = 576 Score = 32.0 bits (73), Expect = 0.099 Identities = 14/29 (48%), Positives = 19/29 (65%), Gaps = 2/29 (6%) Query: 1 MAHIFVLIGASGVGKTTIAKQV--VLNSE 27 +AH F+ GA GVGKT+ A+ + LN E Sbjct: 37 VAHAFLFTGARGVGKTSTARILAKALNCE 65 >gnl|CDD|163294 TIGR03499, FlhF, flagellar biosynthetic protein FlhF. Length = 282 Score = 31.9 bits (73), Expect = 0.11 Identities = 10/18 (55%), Positives = 14/18 (77%), Gaps = 1/18 (5%) Query: 4 IFVLIGASGVGKTT-IAK 20 + L+G +GVGKTT +AK Sbjct: 196 VIALVGPTGVGKTTTLAK 213 >gnl|CDD|178887 PRK00131, aroK, shikimate kinase; Reviewed. Length = 175 Score = 31.7 bits (73), Expect = 0.11 Identities = 9/17 (52%), Positives = 12/17 (70%) Query: 6 VLIGASGVGKTTIAKQV 22 VLIG G GK+TI + + Sbjct: 8 VLIGFMGAGKSTIGRLL 24 >gnl|CDD|181656 PRK09111, PRK09111, DNA polymerase III subunits gamma and tau; Validated. Length = 598 Score = 31.0 bits (71), Expect = 0.20 Identities = 11/18 (61%), Positives = 12/18 (66%) Query: 2 AHIFVLIGASGVGKTTIA 19 A F+L G GVGKTT A Sbjct: 46 AQAFMLTGVRGVGKTTTA 63 >gnl|CDD|180787 PRK06995, flhF, flagellar biosynthesis regulator FlhF; Validated. Length = 484 Score = 30.7 bits (70), Expect = 0.22 Identities = 11/18 (61%), Positives = 14/18 (77%), Gaps = 1/18 (5%) Query: 4 IFVLIGASGVGK-TTIAK 20 +F L+G +GVGK TT AK Sbjct: 258 VFALMGPTGVGKTTTTAK 275 >gnl|CDD|184924 PRK14960, PRK14960, DNA polymerase III subunits gamma and tau; Provisional. Length = 702 Score = 30.8 bits (69), Expect = 0.23 Identities = 20/51 (39%), Positives = 27/51 (52%), Gaps = 4/51 (7%) Query: 3 HIFVLIGASGVGKTTIAKQVV--LNSEYLV--MPVGVTTRRPRVDEKQYID 49 H ++ G GVGKTTIA+ + LN E V P V V+E ++ID Sbjct: 38 HAYLFTGTRGVGKTTIARILAKCLNCETGVTSTPCEVCATCKAVNEGRFID 88 >gnl|CDD|162298 TIGR01313, therm_gnt_kin, carbohydrate kinase, thermoresistant glucokinase family. This model represents a subfamily of proteins that includes thermoresistant and thermosensitve isozymes of gluconate kinase (gluconokinase) in E. coli and other related proteins; members of this family are often named by similarity to the thermostable isozyme. These proteins show homology to shikimate kinases and adenylate kinases but not to gluconate kinases from the FGGY family of carbohydrate kinases. Length = 163 Score = 30.4 bits (69), Expect = 0.26 Identities = 10/18 (55%), Positives = 14/18 (77%) Query: 5 FVLIGASGVGKTTIAKQV 22 FVL+G +G GK+TIA + Sbjct: 1 FVLMGVAGSGKSTIASAL 18 >gnl|CDD|162839 TIGR02397, dnaX_nterm, DNA polymerase III, subunit gamma and tau. This model represents the well-conserved first ~ 365 amino acids of the translation of the dnaX gene. The full-length product of the dnaX gene in the model bacterium E. coli is the DNA polymerase III tau subunit. A translational frameshift leads to early termination and a truncated protein subunit gamma, about 1/3 shorter than tau and present in roughly equal amounts. This frameshift mechanism is not necessarily universal for species with DNA polymerase III but appears conserved in the exterme thermophile Thermus thermophilis. Length = 355 Score = 30.6 bits (70), Expect = 0.27 Identities = 9/19 (47%), Positives = 13/19 (68%) Query: 2 AHIFVLIGASGVGKTTIAK 20 AH ++ G G GKT+IA+ Sbjct: 36 AHAYLFSGPRGTGKTSIAR 54 >gnl|CDD|162028 TIGR00763, lon, ATP-dependent protease La. This protein is induced by heat shock and other stresses in E. coli, B. subtilis, and other species. The yeast member, designated PIM1, is located in the mitochondrial matrix, required for mitochondrial function, and also induced by heat shock. Length = 775 Score = 30.0 bits (68), Expect = 0.37 Identities = 12/33 (36%), Positives = 20/33 (60%), Gaps = 2/33 (6%) Query: 4 IFVLIGASGVGKTTIAKQV--VLNSEYLVMPVG 34 I L+G GVGKT++ K + LN +++ +G Sbjct: 349 ILCLVGPPGVGKTSLGKSIAKALNRKFVRFSLG 381 >gnl|CDD|128665 smart00382, AAA, ATPases associated with a variety of cellular activities. AAA - ATPases associated with a variety of cellular activities. This profile/alignment only detects a fraction of this vast family. The poorly conserved N-terminal helix is missing from the alignment. Length = 148 Score = 30.0 bits (67), Expect = 0.37 Identities = 8/31 (25%), Positives = 15/31 (48%) Query: 3 HIFVLIGASGVGKTTIAKQVVLNSEYLVMPV 33 + +++G G GKTT+A+ + V Sbjct: 3 EVILIVGPPGSGKTTLARALARELGPPGGGV 33 >gnl|CDD|163592 TIGR03880, KaiC_arch_3, KaiC domain protein, AF_0351 family. This model represents a rather narrowly distributed archaeal protein family in which members have a single copy of the KaiC domain. This stands in contrast to the circadian clock protein KaiC itself, with two copies of the domain. Members are expected to have weak ATPase activity, by homology to the autokinase/autophosphorylase KaiC itself. Length = 224 Score = 30.1 bits (68), Expect = 0.39 Identities = 10/19 (52%), Positives = 13/19 (68%) Query: 3 HIFVLIGASGVGKTTIAKQ 21 H+ V+IG G GKTT + Q Sbjct: 17 HVIVVIGEYGTGKTTFSLQ 35 >gnl|CDD|184933 PRK14969, PRK14969, DNA polymerase III subunits gamma and tau; Provisional. Length = 527 Score = 29.7 bits (67), Expect = 0.45 Identities = 18/52 (34%), Positives = 28/52 (53%), Gaps = 4/52 (7%) Query: 3 HIFVLIGASGVGKTTIAKQVV--LNSEYLVM--PVGVTTRRPRVDEKQYIDY 50 H ++ G GVGKTT+A+ + LN E V P GV + +D +++D Sbjct: 39 HAYLFTGTRGVGKTTLARILAKSLNCETGVTATPCGVCSACLEIDSGRFVDL 90 >gnl|CDD|184928 PRK14964, PRK14964, DNA polymerase III subunits gamma and tau; Provisional. Length = 491 Score = 29.7 bits (67), Expect = 0.48 Identities = 12/18 (66%), Positives = 15/18 (83%) Query: 7 LIGASGVGKTTIAKQVVL 24 L+GASGVGKTT A+ + L Sbjct: 40 LVGASGVGKTTCARIISL 57 >gnl|CDD|180683 PRK06762, PRK06762, hypothetical protein; Provisional. Length = 166 Score = 29.6 bits (67), Expect = 0.51 Identities = 12/22 (54%), Positives = 16/22 (72%) Query: 1 MAHIFVLIGASGVGKTTIAKQV 22 M + ++ G SG GKTTIAKQ+ Sbjct: 1 MTTLIIIRGNSGSGKTTIAKQL 22 >gnl|CDD|181681 PRK09183, PRK09183, transposase/IS protein; Provisional. Length = 259 Score = 29.7 bits (67), Expect = 0.53 Identities = 25/104 (24%), Positives = 39/104 (37%), Gaps = 29/104 (27%) Query: 6 VLIGASGVGKTTIAKQVVLNSEYLVMPVGVTTRRPRVDEKQYIDYRFISQSQFKGWKHTG 65 VL+G SGVGKT +A + L Y + G+ RF + + Sbjct: 106 VLLGPSGVGKTHLA--IALG--YEAVRAGIKV-------------RFTTAADLL------ 142 Query: 66 LFIETTKVRDEYYGYLKEDINNPMEHGYDILLILTHQGLAPLKK 109 L + T + + Y L+ + P LLI+ G P + Sbjct: 143 LQLSTAQRQGRYKTTLQRGVMAPR------LLIIDEIGYLPFSQ 180 >gnl|CDD|132313 TIGR03269, met_CoM_red_A2, methyl coenzyme M reductase system, component A2. The enzyme that catalyzes the final step in methanogenesis, methyl coenzyme M reductase, contains alpha, beta, and gamma chains. In older literature, the complex of alpha, beta, and gamma chains was termed component C, while this single chain protein was termed methyl coenzyme M reductase system component A2. Length = 520 Score = 29.4 bits (66), Expect = 0.55 Identities = 10/19 (52%), Positives = 14/19 (73%) Query: 2 AHIFVLIGASGVGKTTIAK 20 IF ++G SG GKTT++K Sbjct: 310 GEIFGIVGTSGAGKTTLSK 328 >gnl|CDD|181925 PRK09518, PRK09518, bifunctional cytidylate kinase/GTPase Der; Reviewed. Length = 712 Score = 29.4 bits (66), Expect = 0.60 Identities = 25/84 (29%), Positives = 37/84 (44%), Gaps = 21/84 (25%) Query: 7 LIGASGVGKTTIAKQVVLNSEYLVMPVGVTTRRPRVDEKQYIDYRFISQSQFKGWKHTGL 66 L+G VGK+++ Q+ +V + TTR P VDE ID + W L Sbjct: 455 LVGRPNVGKSSLLNQLTHEERAVVNDLAGTTRDP-VDEIVEIDG--------EDW----L 501 Query: 67 FIETTKVRD--------EYYGYLK 82 FI+T ++ EYY L+ Sbjct: 502 FIDTAGIKRRQHKLTGAEYYSSLR 525 >gnl|CDD|184920 PRK14956, PRK14956, DNA polymerase III subunits gamma and tau; Provisional. Length = 484 Score = 29.1 bits (65), Expect = 0.64 Identities = 10/20 (50%), Positives = 14/20 (70%) Query: 1 MAHIFVLIGASGVGKTTIAK 20 + H ++ G GVGKTTIA+ Sbjct: 39 IGHAYIFFGPRGVGKTTIAR 58 >gnl|CDD|179346 PRK01889, PRK01889, GTPase RsgA; Reviewed. Length = 356 Score = 29.1 bits (66), Expect = 0.64 Identities = 8/14 (57%), Positives = 12/14 (85%) Query: 6 VLIGASGVGKTTIA 19 L+G+SGVGK+T+ Sbjct: 199 ALLGSSGVGKSTLV 212 >gnl|CDD|162266 TIGR01241, FtsH_fam, ATP-dependent metalloprotease FtsH. HflB(FtsH) is a pleiotropic protein required for correct cell division in bacteria. It has ATP-dependent zinc metalloprotease activity. It was formerly designated cell division protein FtsH. Length = 495 Score = 29.2 bits (66), Expect = 0.66 Identities = 16/45 (35%), Positives = 22/45 (48%), Gaps = 10/45 (22%) Query: 7 LIGASGVGKTTIAKQV----------VLNSEYLVMPVGVTTRRPR 41 L+G G GKT +AK V + S+++ M VGV R R Sbjct: 93 LVGPPGTGKTLLAKAVAGEAGVPFFSISGSDFVEMFVGVGASRVR 137 >gnl|CDD|183453 PRK12338, PRK12338, hypothetical protein; Provisional. Length = 319 Score = 29.0 bits (65), Expect = 0.69 Identities = 14/28 (50%), Positives = 22/28 (78%), Gaps = 3/28 (10%) Query: 6 VLIG-ASGVGKTTIAKQVV--LNSEYLV 30 +LIG ASG+GK+TIA ++ LN ++L+ Sbjct: 7 ILIGSASGIGKSTIASELARTLNIKHLI 34 >gnl|CDD|163508 TIGR03796, NHPM_micro_ABC1, NHPM bacteriocin system ABC transporter, peptidase/ATP-binding protein. This protein describes an multidomain ABC transporter subunit that is one of three protein families associated with some regularity with a distinctive family of putative bacteriocins. It includes a bacteriocin-processing peptidase domain at the N-terminus. Model TIGR03793 describes a conserved propeptide region for this bacteriocin family, unusual because it shows obvious homology a region of the enzyme nitrile hydratase up to the classic Gly-Gly cleavage motif. This family is therefore predicted to be a subunit of a bacteriocin processing and export system characteristic to this system that we designate NHPM, Nitrile Hydratase Propeptide Microcin. Length = 710 Score = 29.1 bits (66), Expect = 0.75 Identities = 11/16 (68%), Positives = 13/16 (81%) Query: 7 LIGASGVGKTTIAKQV 22 L+G SG GK+TIAK V Sbjct: 510 LVGGSGSGKSTIAKLV 525 >gnl|CDD|149019 pfam07728, AAA_5, AAA domain (dynein-related subfamily). This Pfam entry includes some of the AAA proteins not detected by the pfam00004 model. Length = 139 Score = 28.8 bits (65), Expect = 0.82 Identities = 7/31 (22%), Positives = 16/31 (51%), Gaps = 3/31 (9%) Query: 5 FVLIGASGVGKTTIAKQV---VLNSEYLVMP 32 +L+G G GK+ +A+++ + N + Sbjct: 2 VLLVGPPGTGKSELAERLAAALSNRPVFYVQ 32 >gnl|CDD|182791 PRK10865, PRK10865, protein disaggregation chaperone; Provisional. Length = 857 Score = 28.7 bits (64), Expect = 0.84 Identities = 17/37 (45%), Positives = 22/37 (59%), Gaps = 6/37 (16%) Query: 6 VLIGASGVGKTTIAK---QVVLNSEYLVMPVGVTTRR 39 VLIG GVGKT I + Q ++N E +P G+ RR Sbjct: 203 VLIGEPGVGKTAIVEGLAQRIINGE---VPEGLKGRR 236 >gnl|CDD|184923 PRK14959, PRK14959, DNA polymerase III subunits gamma and tau; Provisional. Length = 624 Score = 28.9 bits (64), Expect = 0.88 Identities = 37/135 (27%), Positives = 54/135 (40%), Gaps = 23/135 (17%) Query: 1 MAHIFVLIGASGVGKTTIAKQV--VLNSEYLVM--PVGVTTRRPRVDEKQYIDYRFISQS 56 +A ++ G GVGKTTIA+ LN E P + +V + ++D I + Sbjct: 37 VAPAYLFSGTRGVGKTTIARIFAKALNCETAPTGEPCNTCEQCRKVTQGMHVDVVEIDGA 96 Query: 57 QFKGWKHTGLFIETTKVRDEYYGYLKEDINNPMEHGYDILLI-----LTHQGL-APLKKL 110 +G I+ K E GY PME Y + +I LT + A LK L Sbjct: 97 SNRG-------IDDAKRLKEAIGYA------PMEGRYKVFIIDEAHMLTREAFNALLKTL 143 Query: 111 YEDQVTSIFIAPPSE 125 E F+ +E Sbjct: 144 EEPPARVTFVLATTE 158 >gnl|CDD|177379 PHA02544, 44, clamp loader, small subunit; Provisional. Length = 316 Score = 28.8 bits (65), Expect = 0.96 Identities = 9/31 (29%), Positives = 18/31 (58%), Gaps = 2/31 (6%) Query: 3 HIFVLIGASGVGKTTIAKQVV--LNSEYLVM 31 ++ + + G GKTT+AK + + +E L + Sbjct: 44 NMLLHSPSPGTGKTTVAKALCNEVGAEVLFV 74 >gnl|CDD|179638 PRK03731, aroL, shikimate kinase II; Reviewed. Length = 171 Score = 28.8 bits (65), Expect = 0.99 Identities = 9/20 (45%), Positives = 11/20 (55%) Query: 1 MAHIFVLIGASGVGKTTIAK 20 M L+GA G GKTT+ Sbjct: 1 MTQPLFLVGARGCGKTTVGM 20 >gnl|CDD|181235 PRK08118, PRK08118, topology modulation protein; Reviewed. Length = 167 Score = 28.4 bits (64), Expect = 1.0 Identities = 13/28 (46%), Positives = 20/28 (71%), Gaps = 3/28 (10%) Query: 6 VLIGASGVGKTTIAKQVVLNSEYLVMPV 33 +LIG+ G GK+T+A+Q+ E L +PV Sbjct: 5 ILIGSGGSGKSTLARQL---GEKLNIPV 29 >gnl|CDD|180213 PRK05703, flhF, flagellar biosynthesis regulator FlhF; Validated. Length = 424 Score = 28.3 bits (64), Expect = 1.2 Identities = 10/18 (55%), Positives = 14/18 (77%), Gaps = 1/18 (5%) Query: 4 IFVLIGASGVGKTT-IAK 20 + L+G +GVGKTT +AK Sbjct: 223 VVALVGPTGVGKTTTLAK 240 >gnl|CDD|181191 PRK07994, PRK07994, DNA polymerase III subunits gamma and tau; Validated. Length = 647 Score = 28.3 bits (64), Expect = 1.2 Identities = 10/17 (58%), Positives = 12/17 (70%) Query: 3 HIFVLIGASGVGKTTIA 19 H ++ G GVGKTTIA Sbjct: 39 HAYLFSGTRGVGKTTIA 55 >gnl|CDD|162958 TIGR02639, ClpA, ATP-dependent Clp protease ATP-binding subunit clpA. Length = 731 Score = 28.5 bits (64), Expect = 1.2 Identities = 10/17 (58%), Positives = 13/17 (76%) Query: 5 FVLIGASGVGKTTIAKQ 21 F+ G +GVGKT +AKQ Sbjct: 487 FLFTGPTGVGKTELAKQ 503 >gnl|CDD|163223 TIGR03346, chaperone_ClpB, ATP-dependent chaperone ClpB. Members of this protein family are the bacterial ATP-dependent chaperone ClpB. This protein belongs to the AAA family, ATPases associated with various cellular activities (pfam00004). This molecular chaperone does not act as a protease, but rather serves to disaggregate misfolded and aggregated proteins. Length = 852 Score = 28.4 bits (64), Expect = 1.2 Identities = 10/14 (71%), Positives = 10/14 (71%) Query: 6 VLIGASGVGKTTIA 19 VLIG GVGKT I Sbjct: 198 VLIGEPGVGKTAIV 211 >gnl|CDD|179793 PRK04220, PRK04220, 2-phosphoglycerate kinase; Provisional. Length = 301 Score = 28.4 bits (64), Expect = 1.2 Identities = 12/17 (70%), Positives = 14/17 (82%), Gaps = 1/17 (5%) Query: 4 IFVLIG-ASGVGKTTIA 19 I +LIG ASGVG +TIA Sbjct: 93 IIILIGGASGVGTSTIA 109 >gnl|CDD|147939 pfam06048, DUF927, Domain of unknown function (DUF927). Family of bacterial proteins of unknown function. Length = 284 Score = 28.4 bits (64), Expect = 1.2 Identities = 8/17 (47%), Positives = 9/17 (52%) Query: 4 IFVLIGASGVGKTTIAK 20 F +G S GKTT K Sbjct: 193 GFHFVGDSSTGKTTALK 209 >gnl|CDD|163051 TIGR02868, CydC, thiol reductant ABC exporter, CydC subunit. The gene pair cydCD encodes an ABC-family transporter in which each gene contains an N-terminal membrane-spanning domain (pfam00664) and a C-terminal ATP-binding domain (pfam00005). In E. coli these genes were discovered as mutants which caused the terminal heme-copper oxidase complex cytochrome bd to fail to assemble. Recent work has shown that the transporter is involved in export of redox-active thiol compounds such as cysteine and glutathione. The linkage to assembly of the cytochrome bd complex is further supported by the conserved operon structure found outside the gammaproteobacteria (cydABCD) containing both the transporter and oxidase genes components. The genes used as the seed members for this model are all either found in the gammproteobacterial context or the CydABCD context. All members of this family scoring above trusted at the time of its creation were from genomes which encode a cytochrome bd complex. Length = 529 Score = 28.1 bits (63), Expect = 1.3 Identities = 11/47 (23%), Positives = 18/47 (38%), Gaps = 11/47 (23%) Query: 7 LIGASGVGKTTIAK-----------QVVLNSEYLVMPVGVTTRRPRV 42 ++G SG GK+T+ +V L+ + RR V Sbjct: 366 ILGPSGSGKSTLLMLLTGLLDPLQGEVTLDGVSVSSLQDELRRRISV 412 >gnl|CDD|163222 TIGR03345, VI_ClpV1, type VI secretion ATPase, ClpV1 family. Members of this protein family are homologs of ClpB, an ATPase associated with chaperone-related functions. These ClpB homologs, designated ClpV1, are a key component of the bacterial pathogenicity-associated type VI secretion system. Length = 852 Score = 28.0 bits (63), Expect = 1.4 Identities = 10/16 (62%), Positives = 13/16 (81%) Query: 4 IFVLIGASGVGKTTIA 19 +F+L+G SGVGKT A Sbjct: 598 VFLLVGPSGVGKTETA 613 >gnl|CDD|179218 PRK01077, PRK01077, cobyrinic acid a,c-diamide synthase; Validated. Length = 451 Score = 27.8 bits (63), Expect = 1.5 Identities = 8/16 (50%), Positives = 11/16 (68%), Gaps = 2/16 (12%) Query: 6 VLIGA--SGVGKTTIA 19 ++I A SG GKTT+ Sbjct: 6 LVIAAPASGSGKTTVT 21 >gnl|CDD|183702 PRK12723, PRK12723, flagellar biosynthesis regulator FlhF; Provisional. Length = 388 Score = 27.9 bits (62), Expect = 1.6 Identities = 12/24 (50%), Positives = 17/24 (70%), Gaps = 1/24 (4%) Query: 4 IFVLIGASGVGK-TTIAKQVVLNS 26 +F+L+G +GVGK TTIAK + Sbjct: 176 VFILVGPTGVGKTTTIAKLAAIYG 199 >gnl|CDD|178657 PLN03110, PLN03110, Rab GTPase; Provisional. Length = 216 Score = 28.0 bits (62), Expect = 1.7 Identities = 26/81 (32%), Positives = 36/81 (44%), Gaps = 14/81 (17%) Query: 6 VLIGASGVGKTTIAKQVVLNSEYL----VMPVGVTTRRPRVDEK----QYID------YR 51 VLIG SGVGK+ I + N L + V TR +V+ K Q D YR Sbjct: 16 VLIGDSGVGKSNILSRFTRNEFCLESKSTIGVEFATRTLQVEGKTVKAQIWDTAGQERYR 75 Query: 52 FISQSQFKGWKHTGLFIETTK 72 I+ + ++G L + TK Sbjct: 76 AITSAYYRGAVGALLVYDITK 96 >gnl|CDD|162313 TIGR01351, adk, adenylate kinases. Adenylate kinase (EC 2.7.4.3) converts ATP + AMP to ADP + ADP, that is, uses ATP as a phosphate donor for AMP. Most members of this family are known or believed to be adenylate kinase. However, some members accept other nucleotide triphosphates as donors, may be unable to use ATP, and may fail to complement adenylate kinase mutants. An example of a nucleoside-triphosphate--adenylate kinase (EC 2.7.4.10) is a GTP:AMP phosphotransferase. This family is designated subfamily rather than equivalog for this reason. Length = 210 Score = 27.6 bits (62), Expect = 2.0 Identities = 9/19 (47%), Positives = 12/19 (63%) Query: 5 FVLIGASGVGKTTIAKQVV 23 VL+G G GK T AK++ Sbjct: 2 LVLLGPPGSGKGTQAKRIA 20 >gnl|CDD|173186 PRK14723, flhF, flagellar biosynthesis regulator FlhF; Provisional. Length = 767 Score = 27.5 bits (61), Expect = 2.0 Identities = 10/18 (55%), Positives = 13/18 (72%), Gaps = 1/18 (5%) Query: 4 IFVLIGASGVGK-TTIAK 20 + L+G +GVGK TT AK Sbjct: 187 VLALVGPTGVGKTTTTAK 204 >gnl|CDD|163225 TIGR03348, VI_IcmF, type VI secretion protein IcmF. Members of this protein family are IcmF homologs and tend to be associated with type VI secretion systems. Length = 1169 Score = 27.7 bits (62), Expect = 2.1 Identities = 7/17 (41%), Positives = 12/17 (70%) Query: 5 FVLIGASGVGKTTIAKQ 21 +++IG G GKTT+ + Sbjct: 114 YLVIGPPGSGKTTLLQN 130 >gnl|CDD|184935 PRK14971, PRK14971, DNA polymerase III subunits gamma and tau; Provisional. Length = 614 Score = 27.4 bits (61), Expect = 2.2 Identities = 10/20 (50%), Positives = 14/20 (70%) Query: 1 MAHIFVLIGASGVGKTTIAK 20 +AH ++ G GVGKTT A+ Sbjct: 38 LAHAYLFCGPRGVGKTTCAR 57 >gnl|CDD|178861 PRK00098, PRK00098, GTPase RsgA; Reviewed. Length = 298 Score = 27.5 bits (62), Expect = 2.2 Identities = 9/16 (56%), Positives = 12/16 (75%) Query: 3 HIFVLIGASGVGKTTI 18 + VL G SGVGK+T+ Sbjct: 165 KVTVLAGQSGVGKSTL 180 >gnl|CDD|180615 PRK06547, PRK06547, hypothetical protein; Provisional. Length = 172 Score = 27.4 bits (61), Expect = 2.4 Identities = 12/21 (57%), Positives = 14/21 (66%), Gaps = 1/21 (4%) Query: 4 IFVLI-GASGVGKTTIAKQVV 23 I VLI G SG GKTT+A + Sbjct: 16 ITVLIDGRSGSGKTTLAGALA 36 >gnl|CDD|181939 PRK09544, znuC, high-affinity zinc transporter ATPase; Reviewed. Length = 251 Score = 27.4 bits (61), Expect = 2.5 Identities = 18/53 (33%), Positives = 26/53 (49%), Gaps = 10/53 (18%) Query: 3 HIFVLIGASGVGKTTIAKQVVLNSEYLVMPVGVTTRRPR------VDEKQYID 49 I L+G +G GK+T+ + VVL LV P +R V +K Y+D Sbjct: 31 KILTLLGPNGAGKSTLVR-VVLG---LVAPDEGVIKRNGKLRIGYVPQKLYLD 79 >gnl|CDD|163042 TIGR02857, CydD, thiol reductant ABC exporter, CydD subunit. Unfortunately, the gene symbol nomenclature adopted based on this operon in B. subtilis assigns cydC to the third gene in the operon where this gene is actually homologous to the E. coli cydD gene. We have chosen to name all homologs in this family in accordance with the precedence of publication of the E. coli name, CydD. Length = 529 Score = 27.3 bits (61), Expect = 2.7 Identities = 7/13 (53%), Positives = 10/13 (76%) Query: 6 VLIGASGVGKTTI 18 L+G SG GK+T+ Sbjct: 352 ALVGPSGAGKSTL 364 >gnl|CDD|183226 PRK11607, potG, putrescine transporter ATP-binding subunit; Provisional. Length = 377 Score = 27.1 bits (60), Expect = 2.8 Identities = 10/15 (66%), Positives = 13/15 (86%) Query: 4 IFVLIGASGVGKTTI 18 IF L+GASG GK+T+ Sbjct: 47 IFALLGASGCGKSTL 61 >gnl|CDD|182441 PRK10416, PRK10416, signal recognition particle-docking protein FtsY; Provisional. Length = 318 Score = 27.0 bits (61), Expect = 2.9 Identities = 9/19 (47%), Positives = 14/19 (73%), Gaps = 1/19 (5%) Query: 3 HIFVLIGASGVGKTT-IAK 20 + +++G +GVGKTT I K Sbjct: 115 FVILVVGVNGVGKTTTIGK 133 >gnl|CDD|179681 PRK03946, pdxA, 4-hydroxythreonine-4-phosphate dehydrogenase; Provisional. Length = 307 Score = 26.9 bits (60), Expect = 3.0 Identities = 12/17 (70%), Positives = 13/17 (76%), Gaps = 2/17 (11%) Query: 102 QGLAPLKKLYEDQVTSI 118 QGLAPLK LY D+ SI Sbjct: 246 QGLAPLKALYFDE--SI 260 >gnl|CDD|162555 TIGR01842, type_I_sec_PrtD, type I secretion system ABC transporter, PrtD family. Type I protein secretion is a system in some Gram-negative bacteria to export proteins (often proteases) across both inner and outer membranes to the extracellular medium. This is one of three proteins of the type I secretion apparatus. Targeted proteins are not cleaved at the N-terminus, but rather carry signals located toward the extreme C-terminus to direct type I secretion. Length = 544 Score = 26.9 bits (60), Expect = 3.0 Identities = 9/20 (45%), Positives = 14/20 (70%) Query: 4 IFVLIGASGVGKTTIAKQVV 23 +IG SG GK+T+A+ +V Sbjct: 346 ALAIIGPSGSGKSTLARLIV 365 >gnl|CDD|116338 pfam07724, AAA_2, AAA domain (Cdc48 subfamily). This Pfam entry includes some of the AAA proteins not detected by the pfam00004 model. Length = 168 Score = 26.8 bits (60), Expect = 3.1 Identities = 9/18 (50%), Positives = 14/18 (77%) Query: 5 FVLIGASGVGKTTIAKQV 22 F+ +G +GVGKT +AK + Sbjct: 6 FLFLGPTGVGKTELAKAL 23 >gnl|CDD|184925 PRK14961, PRK14961, DNA polymerase III subunits gamma and tau; Provisional. Length = 363 Score = 27.1 bits (60), Expect = 3.1 Identities = 11/18 (61%), Positives = 14/18 (77%) Query: 3 HIFVLIGASGVGKTTIAK 20 H ++L G GVGKTTIA+ Sbjct: 39 HAWLLSGTRGVGKTTIAR 56 >gnl|CDD|161928 TIGR00557, pdxA, 4-hydroxythreonine-4-phosphate dehydrogenase. This model represents PdxA, an NAD+-dependent 4-hydroxythreonine 4-phosphate dehydrogenase (EC 1.1.1.262) active in pyridoxal phosphate biosynthesis. Length = 320 Score = 27.1 bits (61), Expect = 3.3 Identities = 12/24 (50%), Positives = 15/24 (62%), Gaps = 1/24 (4%) Query: 92 GYDILLILTH-QGLAPLKKLYEDQ 114 YD +L + H QGL PLK L D+ Sbjct: 252 KYDAVLAMYHDQGLIPLKYLGFDE 275 >gnl|CDD|180682 PRK06761, PRK06761, hypothetical protein; Provisional. Length = 282 Score = 27.0 bits (60), Expect = 3.3 Identities = 9/29 (31%), Positives = 16/29 (55%), Gaps = 3/29 (10%) Query: 1 MAHIFVLIGASGVGKTTIAKQVVLNSEYL 29 M + ++ G G GK+T AK + ++ L Sbjct: 2 MTKLIIIEGLPGFGKSTTAKML---NDIL 27 >gnl|CDD|150614 pfam09960, DUF2194, Uncharacterized protein conserved in bacteria (DUF2194). This domain, found in various hypothetical bacterial proteins, has no known function. Length = 573 Score = 27.0 bits (60), Expect = 3.4 Identities = 21/68 (30%), Positives = 28/68 (41%), Gaps = 22/68 (32%) Query: 62 KHTGLFIET-------------TKVRDEYYGYLKEDINNPME---HGYDILLILTHQGLA 105 K+TG+ IE K DE+ + KE +N+ E HGY+ HQ L Sbjct: 290 KYTGVVIENYNNKTTPPFSFFEQKNTDEFIYFGKELLNSGGEIGIHGYN------HQPLL 343 Query: 106 PLKKLYED 113 P Y D Sbjct: 344 PENVDYGD 351 >gnl|CDD|133910 PHA00540, PHA00540, hypothetical protein. Length = 715 Score = 26.5 bits (58), Expect = 3.7 Identities = 14/48 (29%), Positives = 23/48 (47%), Gaps = 1/48 (2%) Query: 24 LNSEYLVMPVGVTTRRPRVDEKQYIDYRFISQSQFKGWKHTGLFIETT 71 LN E + +T + ++E +I+ F+ S F+ W T FI T Sbjct: 31 LNEEQYTLKQESSTGKG-INETDFINTMFLRSSFFENWSETNYFINPT 77 >gnl|CDD|183986 PRK13342, PRK13342, recombination factor protein RarA; Reviewed. Length = 413 Score = 26.6 bits (60), Expect = 3.9 Identities = 8/16 (50%), Positives = 11/16 (68%) Query: 5 FVLIGASGVGKTTIAK 20 +L G G GKTT+A+ Sbjct: 39 MILWGPPGTGKTTLAR 54 >gnl|CDD|183438 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional. Length = 700 Score = 26.4 bits (58), Expect = 4.3 Identities = 8/18 (44%), Positives = 13/18 (72%) Query: 3 HIFVLIGASGVGKTTIAK 20 H ++ G GVGKTT+++ Sbjct: 39 HAYLFTGTRGVGKTTLSR 56 >gnl|CDD|149505 pfam08477, Miro, Miro-like protein. Mitochondrial Rho proteins (Miro-1 and Miro-2), are atypical Rho GTPases. They have a unique domain organisation, with tandem GTP-binding domains and two EF hand domains (pfam00036), that may bind calcium. They are also larger than classical small GTPases. It has been proposed that they are involved in mitochondrial homeostasis and apoptosis. Length = 118 Score = 26.6 bits (59), Expect = 4.3 Identities = 14/62 (22%), Positives = 25/62 (40%), Gaps = 7/62 (11%) Query: 5 FVLIGASGVGKTTIAKQVV-------LNSEYLVMPVGVTTRRPRVDEKQYIDYRFISQSQ 57 V+IG G GK+++ Q+V + E + V T D + + F + + Sbjct: 2 VVVIGDKGSGKSSLLSQLVGGEFPPEIPEEIQGDTLAVDTLEVDGDTELLHIWDFGGREE 61 Query: 58 FK 59 K Sbjct: 62 LK 63 >gnl|CDD|162366 TIGR01448, recD_rel, helicase, putative, RecD/TraA family. This model describes a family similar to RecD, the exodeoxyribonuclease V alpha chain of TIGR01447. Members of this family, however, are not found in a context of RecB and RecC and are longer by about 200 amino acids at the amino end. Chlamydia muridarum has both a member of this family and a RecD. Length = 720 Score = 26.3 bits (58), Expect = 4.5 Identities = 8/20 (40%), Positives = 13/20 (65%) Query: 4 IFVLIGASGVGKTTIAKQVV 23 + +L G G GKTTI + ++ Sbjct: 340 VVILTGGPGTGKTTITRAII 359 >gnl|CDD|128472 smart00175, RAB, Rab subfamily of small GTPases. Rab GTPases are implicated in vesicle trafficking. Length = 164 Score = 26.3 bits (59), Expect = 4.9 Identities = 8/14 (57%), Positives = 12/14 (85%) Query: 5 FVLIGASGVGKTTI 18 +LIG SGVGK+++ Sbjct: 3 IILIGDSGVGKSSL 16 >gnl|CDD|180523 PRK06305, PRK06305, DNA polymerase III subunits gamma and tau; Validated. Length = 451 Score = 26.3 bits (58), Expect = 4.9 Identities = 9/20 (45%), Positives = 13/20 (65%) Query: 1 MAHIFVLIGASGVGKTTIAK 20 AH ++ G G GKTT+A+ Sbjct: 38 AAHAYLFSGIRGTGKTTLAR 57 >gnl|CDD|180730 PRK06851, PRK06851, hypothetical protein; Provisional. Length = 367 Score = 26.5 bits (59), Expect = 4.9 Identities = 9/20 (45%), Positives = 14/20 (70%) Query: 3 HIFVLIGASGVGKTTIAKQV 22 IF+L G G GK+T+ K++ Sbjct: 31 RIFILKGGPGTGKSTLMKKI 50 >gnl|CDD|130254 TIGR01186, proV, glycine betaine/L-proline transport ATP binding subunit. This model describes the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea. This transport system belong to the larger ATP-Binding Cassette (ABC) transporter superfamily. The characteristic feature of these transporter is the obligatory coupling of ATP hydrolysis to substrate translocation. The minimal configuration of bacterial ABC transport system: an ATPase or ATP binding subunit; An integral membrane protein; a hydrophilic polypetpide, which likely functions as substrate binding protein. Functionally, this transport system is involved in osmoregulation. Under conditions of stress, the organism recruits these transport system to accumulate glycine betaine and other solutes which offer osmo-protection. It has been demonstrated that glycine betaine uptake is accompanied by symport with sodium ions. The locus has been named variously as proU or opuA. A gene library from L.lactis functionally complements an E.coli proU mutant. The comlementing locus is similar to a opuA locus in B.sutlis. This clarifies the differences in nomenclature. Length = 363 Score = 26.4 bits (58), Expect = 5.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Query: 4 IFVLIGASGVGKTTIAK 20 IFV++G SG GK+T + Sbjct: 21 IFVIMGLSGSGKSTTVR 37 >gnl|CDD|178910 PRK00166, apaH, diadenosine tetraphosphatase; Reviewed. Length = 275 Score = 26.3 bits (59), Expect = 5.0 Identities = 11/36 (30%), Positives = 18/36 (50%), Gaps = 3/36 (8%) Query: 94 DILLILTHQGLAPLKKLYEDQVTSIFIAPPSEAELI 129 D+ L+ G+ KK +D + I AP + EL+ Sbjct: 67 DLHLLAVAAGIKRNKK--KDTLDPILEAPDRD-ELL 99 >gnl|CDD|184917 PRK14953, PRK14953, DNA polymerase III subunits gamma and tau; Provisional. Length = 486 Score = 26.3 bits (58), Expect = 5.0 Identities = 9/20 (45%), Positives = 14/20 (70%) Query: 1 MAHIFVLIGASGVGKTTIAK 20 ++H ++ G G GKTTIA+ Sbjct: 37 VSHAYIFAGPRGTGKTTIAR 56 >gnl|CDD|179962 PRK05201, hslU, ATP-dependent protease ATP-binding subunit HslU; Provisional. Length = 443 Score = 26.2 bits (59), Expect = 5.0 Identities = 9/12 (75%), Positives = 10/12 (83%) Query: 8 IGASGVGKTTIA 19 IG +GVGKT IA Sbjct: 56 IGPTGVGKTEIA 67 >gnl|CDD|184172 PRK13600, PRK13600, putative ribosomal protein L7Ae-like; Provisional. Length = 84 Score = 26.4 bits (58), Expect = 5.0 Identities = 13/25 (52%), Positives = 16/25 (64%) Query: 107 LKKLYEDQVTSIFIAPPSEAELIQR 131 LK L +DQVTS+ IA E L+ R Sbjct: 22 LKALKKDQVTSLIIAEDVEVYLMTR 46 >gnl|CDD|131817 TIGR02770, nickel_nikD, nickel import ATP-binding protein NikD. This family represents the NikD subunit of a multisubunit nickel import ABC transporter complex. Nickel, once imported, may be used in urease and in certain classes of hydrogenase and superoxide dismutase. NikD and NikE are homologous. Length = 230 Score = 26.2 bits (58), Expect = 5.4 Identities = 13/69 (18%), Positives = 28/69 (40%), Gaps = 10/69 (14%) Query: 1 MAHIFVLIGASGVGKTTIAKQVVLNSEYLVMPVGVTTRRPRVDEKQYIDYRFISQSQFKG 60 + L+G SG GK+ ++ ++P G+T + +D R + +G Sbjct: 11 RGEVLALVGESGSGKSLTCLAIL-----GLLPPGLTQTSGEI----LLDGRPLLPLSIRG 61 Query: 61 WKHTGLFIE 69 +H ++ Sbjct: 62 -RHIATIMQ 69 >gnl|CDD|128571 smart00275, G_alpha, G protein alpha subunit. Subunit of G proteins that contains the guanine nucleotide binding site. Length = 342 Score = 26.0 bits (58), Expect = 5.6 Identities = 9/16 (56%), Positives = 12/16 (75%) Query: 7 LIGASGVGKTTIAKQV 22 L+GA GK+TI KQ+ Sbjct: 26 LLGAGESGKSTILKQM 41 >gnl|CDD|181906 PRK09493, glnQ, glutamine ABC transporter ATP-binding protein; Reviewed. Length = 240 Score = 26.2 bits (58), Expect = 5.6 Identities = 17/47 (36%), Positives = 26/47 (55%), Gaps = 5/47 (10%) Query: 4 IFVLIGASGVGKTT----IAKQVVLNSEYLVMPVGVTTRRPRVDEKQ 46 + V+IG SG GK+T I K + S L++ G+ P+VDE+ Sbjct: 29 VVVIIGPSGSGKSTLLRCINKLEEITSGDLIVD-GLKVNDPKVDERL 74 >gnl|CDD|183001 PRK11153, metN, DL-methionine transporter ATP-binding subunit; Provisional. Length = 343 Score = 25.9 bits (58), Expect = 5.8 Identities = 10/14 (71%), Positives = 12/14 (85%) Query: 4 IFVLIGASGVGKTT 17 IF +IGASG GK+T Sbjct: 33 IFGVIGASGAGKST 46 >gnl|CDD|182917 PRK11034, clpA, ATP-dependent Clp protease ATP-binding subunit; Provisional. Length = 758 Score = 26.0 bits (57), Expect = 6.1 Identities = 10/15 (66%), Positives = 13/15 (86%) Query: 6 VLIGASGVGKTTIAK 20 +L+G SGVGKT IA+ Sbjct: 211 LLVGESGVGKTAIAE 225 >gnl|CDD|173184 PRK14721, flhF, flagellar biosynthesis regulator FlhF; Provisional. Length = 420 Score = 26.1 bits (57), Expect = 6.1 Identities = 9/14 (64%), Positives = 12/14 (85%) Query: 4 IFVLIGASGVGKTT 17 ++ LIG +GVGKTT Sbjct: 193 VYALIGPTGVGKTT 206 >gnl|CDD|180308 PRK05896, PRK05896, DNA polymerase III subunits gamma and tau; Validated. Length = 605 Score = 26.0 bits (57), Expect = 6.2 Identities = 9/20 (45%), Positives = 14/20 (70%) Query: 1 MAHIFVLIGASGVGKTTIAK 20 + H ++ G G+GKT+IAK Sbjct: 37 LTHAYIFSGPRGIGKTSIAK 56 >gnl|CDD|183231 PRK11614, livF, leucine/isoleucine/valine transporter ATP-binding subunit; Provisional. Length = 237 Score = 26.0 bits (57), Expect = 6.4 Identities = 10/15 (66%), Positives = 12/15 (80%) Query: 4 IFVLIGASGVGKTTI 18 I LIGA+G GKTT+ Sbjct: 33 IVTLIGANGAGKTTL 47 >gnl|CDD|131377 TIGR02324, CP_lyasePhnL, phosphonate C-P lyase system protein PhnL. Members of this family are the PhnL protein of C-P lyase systems for utilization of phosphonates. These systems resemble phosphonatase-based systems in having a three component ABC transporter, where TIGR01097 is the permease, TIGR01098 is the phosphonates binding protein, and TIGR02315 is the ATP-binding cassette (ABC) protein. They differ, however, in having, typically, ten or more additional genes, many of which are believed to form a membrane-associated C-P lysase complex. This protein (PhnL) and the adjacent-encoded PhnK (TIGR02323) resemble transporter ATP-binding proteins but are suggested, based on mutatgenesis studies, to be part of this C-P lyase complex rather than part of a transporter per se. Length = 224 Score = 25.8 bits (57), Expect = 6.6 Identities = 11/25 (44%), Positives = 14/25 (56%), Gaps = 2/25 (8%) Query: 6 VLIGASGVGKTTIAKQVVLNSEYLV 30 L G SG GK+T+ K + N YL Sbjct: 38 ALSGPSGAGKSTLLKSLYAN--YLP 60 >gnl|CDD|183080 PRK11300, livG, leucine/isoleucine/valine transporter ATP-binding subunit; Provisional. Length = 255 Score = 25.7 bits (57), Expect = 6.7 Identities = 9/15 (60%), Positives = 11/15 (73%) Query: 4 IFVLIGASGVGKTTI 18 I LIG +G GKTT+ Sbjct: 33 IVSLIGPNGAGKTTV 47 >gnl|CDD|163188 TIGR03223, Phn_opern_protn, putative phosphonate metabolism protein. This family of proteins is observed in the vicinity of other caharacterized genes involved in the catabolism of phosphonates via the3 C-P lyase system (GenProp0232), its function is unknown. These proteins are members of the somewhat broader pfam06299 model "Protein of unknown function (DUF1045)" which contains proteins found in a different genomic context as well. Length = 228 Score = 25.8 bits (57), Expect = 6.8 Identities = 13/41 (31%), Positives = 18/41 (43%), Gaps = 3/41 (7%) Query: 97 LILTHQGLAPLKKLYEDQVTSI--FIAPPSEAELIQRRIKR 135 L L+ L V + F AP +EAEL +RR + Sbjct: 107 LRPAA-PCPALQALAAACVRELDPFRAPLTEAELARRRPDQ 146 >gnl|CDD|140006 PRK13949, PRK13949, shikimate kinase; Provisional. Length = 169 Score = 25.8 bits (57), Expect = 6.9 Identities = 12/20 (60%), Positives = 14/20 (70%), Gaps = 1/20 (5%) Query: 1 MAHIFVLIGASGVGKTTIAK 20 MA IF L+G G GKTT+ K Sbjct: 1 MARIF-LVGYMGAGKTTLGK 19 >gnl|CDD|180114 PRK05480, PRK05480, uridine/cytidine kinase; Provisional. Length = 209 Score = 25.9 bits (58), Expect = 6.9 Identities = 8/15 (53%), Positives = 10/15 (66%) Query: 9 GASGVGKTTIAKQVV 23 G SG GKTT+A + Sbjct: 13 GGSGSGKTTVASTIY 27 >gnl|CDD|161852 TIGR00390, hslU, ATP-dependent protease HslVU, ATPase subunit. This model represents the ATPase subunit of HslVU, while the proteasome-related peptidase subunit is HslV. Residues 54-61 of the model contain a P-loop ATP-binding motif. Cys-287 of E. coli (position 308 in the seed alignment), studied in PubMed:98389714, is Ser in other members of the seed alignment. Length = 441 Score = 25.5 bits (56), Expect = 7.4 Identities = 9/17 (52%), Positives = 15/17 (88%) Query: 6 VLIGASGVGKTTIAKQV 22 ++IG +GVGKT IA+++ Sbjct: 51 LMIGPTGVGKTEIARRL 67 >gnl|CDD|184591 PRK14250, PRK14250, phosphate ABC transporter ATP-binding protein; Provisional. Length = 241 Score = 25.5 bits (56), Expect = 7.5 Identities = 8/20 (40%), Positives = 13/20 (65%) Query: 1 MAHIFVLIGASGVGKTTIAK 20 I+ ++G SG GK+T+ K Sbjct: 28 GGAIYTIVGPSGAGKSTLIK 47 >gnl|CDD|168472 PRK06217, PRK06217, hypothetical protein; Validated. Length = 183 Score = 25.8 bits (57), Expect = 7.6 Identities = 9/19 (47%), Positives = 11/19 (57%), Gaps = 1/19 (5%) Query: 1 MAHIFVLIGASGVGKTTIA 19 M I + GASG G TT+ Sbjct: 1 MMRIHIT-GASGSGTTTLG 18 >gnl|CDD|180989 PRK07471, PRK07471, DNA polymerase III subunit delta'; Validated. Length = 365 Score = 25.8 bits (57), Expect = 7.6 Identities = 7/19 (36%), Positives = 13/19 (68%) Query: 1 MAHIFVLIGASGVGKTTIA 19 + H +++ G G+GK T+A Sbjct: 40 LHHAWLIGGPQGIGKATLA 58 >gnl|CDD|178749 PLN03210, PLN03210, Resistant to P. syringae 6; Provisional. Length = 1153 Score = 25.6 bits (56), Expect = 7.6 Identities = 15/48 (31%), Positives = 22/48 (45%), Gaps = 12/48 (25%) Query: 9 GASGVGKTTIAKQVVLNSEYLVMPVGVTTRRPRVDEKQYIDYRFISQS 56 G+SG+GKTTIA+ + + +ID FIS+S Sbjct: 214 GSSGIGKTTIARALFSRLSR------------QFQSSVFIDRAFISKS 249 >gnl|CDD|161686 TIGR00064, ftsY, signal recognition particle-docking protein FtsY. There is a weak division between FtsY and SRP54; both are GTPases. In E.coli, ftsY is an essential gene located in an operon with cell division genes ftsE and ftsX, but its apparent function is as the signal recognition particle docking protein. Length = 272 Score = 25.7 bits (57), Expect = 8.1 Identities = 10/18 (55%), Positives = 14/18 (77%), Gaps = 1/18 (5%) Query: 4 IFVLIGASGVGKTT-IAK 20 + + +G +GVGKTT IAK Sbjct: 74 VILFVGVNGVGKTTTIAK 91 >gnl|CDD|151168 pfam10662, PduV-EutP, Ethanolamine utilisation - propanediol utilisation. Members of this family function in ethanolamine and propanediol degradation pathways, however the exact roles of these proteins is poorly understood. Length = 143 Score = 25.7 bits (57), Expect = 8.3 Identities = 15/29 (51%), Positives = 17/29 (58%), Gaps = 3/29 (10%) Query: 1 MAHIFVLIGASGVGKTTIAKQVVLNSEYL 29 M I LIG SG GKTT+ + LN E L Sbjct: 1 MKKIM-LIGRSGCGKTTLTQ--ALNGEEL 26 >gnl|CDD|131367 TIGR02314, ABC_MetN, D-methionine ABC transporter, ATP-binding protein. Members of this family are the ATP-binding protein of the D-methionine ABC transporter complex. Known members belong to the Proteobacteria. Length = 343 Score = 25.6 bits (56), Expect = 8.6 Identities = 11/21 (52%), Positives = 16/21 (76%) Query: 4 IFVLIGASGVGKTTIAKQVVL 24 I+ +IGASG GK+T+ + V L Sbjct: 33 IYGVIGASGAGKSTLIRCVNL 53 >gnl|CDD|130261 TIGR01193, bacteriocin_ABC, ABC-type bacteriocin transporter. This model describes ABC-type bacteriocin transporter. The amino terminal domain (pfam03412) processes the N-terminal leader peptide from the bacteriocin while C-terminal domains resemble ABC transporter membrane protein and ATP-binding cassette domain. In general, bacteriocins are agents which are responsible for killing or inhibiting the closely related species or even different strains of the same species. Bacteriocins are usually encoded by bacterial plasmids. Bacteriocins are named after the species and hence in literature one encounters various names e.g., leucocin from Leuconostic geldium; pedicocin from Pedicoccus acidilactici; sakacin from Lactobacillus sake etc. Length = 708 Score = 25.5 bits (56), Expect = 8.9 Identities = 9/17 (52%), Positives = 14/17 (82%) Query: 7 LIGASGVGKTTIAKQVV 23 ++G SG GK+T+AK +V Sbjct: 505 IVGMSGSGKSTLAKLLV 521 >gnl|CDD|182388 PRK10337, PRK10337, sensor protein QseC; Provisional. Length = 449 Score = 25.4 bits (56), Expect = 9.0 Identities = 10/16 (62%), Positives = 13/16 (81%) Query: 95 ILLILTHQGLAPLKKL 110 IL++L + LAPLKKL Sbjct: 177 ILMVLLGRELAPLKKL 192 >gnl|CDD|131721 TIGR02673, FtsE, cell division ATP-binding protein FtsE. This model describes FtsE, a member of the ABC transporter ATP-binding protein family. This protein, and its permease partner FtsX, localize to the division site. In a number of species, the ftsEX gene pair is located next to FtsY, the signal recognition particle-docking protein. Length = 214 Score = 25.3 bits (56), Expect = 9.4 Identities = 9/14 (64%), Positives = 10/14 (71%) Query: 7 LIGASGVGKTTIAK 20 L G SG GKTT+ K Sbjct: 33 LTGPSGAGKTTLLK 46 >gnl|CDD|184037 PRK13409, PRK13409, putative ATPase RIL; Provisional. Length = 590 Score = 25.2 bits (56), Expect = 9.8 Identities = 7/14 (50%), Positives = 11/14 (78%) Query: 7 LIGASGVGKTTIAK 20 ++G +G+GKTT K Sbjct: 104 ILGPNGIGKTTAVK 117 >gnl|CDD|184411 PRK13946, PRK13946, shikimate kinase; Provisional. Length = 184 Score = 25.3 bits (56), Expect = 9.8 Identities = 7/17 (41%), Positives = 13/17 (76%) Query: 6 VLIGASGVGKTTIAKQV 22 VL+G G GK+T+ +++ Sbjct: 14 VLVGLMGAGKSTVGRRL 30 >gnl|CDD|184922 PRK14958, PRK14958, DNA polymerase III subunits gamma and tau; Provisional. Length = 509 Score = 25.1 bits (54), Expect = 10.0 Identities = 9/20 (45%), Positives = 14/20 (70%) Query: 1 MAHIFVLIGASGVGKTTIAK 20 + H ++ G GVGKTTI++ Sbjct: 37 LHHAYLFTGTRGVGKTTISR 56 >gnl|CDD|134001 PHA02150, PHA02150, hypothetical protein. Length = 77 Score = 25.4 bits (55), Expect = 10.0 Identities = 7/12 (58%), Positives = 9/12 (75%) Query: 50 YRFISQSQFKGW 61 YRF+S+ QF W Sbjct: 3 YRFVSEEQFNAW 14 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.322 0.140 0.414 Gapped Lambda K H 0.267 0.0686 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 3,180,612 Number of extensions: 202799 Number of successful extensions: 858 Number of sequences better than 10.0: 1 Number of HSP's gapped: 849 Number of HSP's successfully gapped: 151 Length of query: 186 Length of database: 5,994,473 Length adjustment: 88 Effective length of query: 98 Effective length of database: 4,092,969 Effective search space: 401110962 Effective search space used: 401110962 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 54 (24.7 bits)