Query         gi|254780133|ref|YP_003064546.1| hypothetical protein CLIBASIA_00060 [Candidatus Liberibacter asiaticus str. psy62]
Match_columns 63
No_of_seqs    1 out of 3
Neff          1.0 
Searched_HMMs 33803
Date          Sun May 22 06:03:07 2011
Command       /home/congqian_1/programs/hhpred/hhsearch -i 254780133.hhm -d /home/congqian_1/database/mmdb/mmdb70.hhm 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 >2joz_A Hypothetical protein Y  23.6      55  0.0016   15.5   2.3   39   19-57     63-102 (135)
  2 >2gh0_A GFR-alpha-3, GDNF fami  13.0      31 0.00093   16.8  -1.0   15   41-55      1-15  (90)
  3 >1n9p_A GIRK1, G protein-activ  11.7      99  0.0029   14.2   1.2   11   33-43     73-83  (207)
  4 >1e8c_A UDP-N-acetylmuramoylal  10.9 1.2E+02  0.0034   13.8   1.4   20   41-60      4-24  (161)
  5 >1knx_A Probable HPR(Ser) kina  10.6      81  0.0024   14.6   0.5   25   37-61     71-95  (119)
  6 >3hn7_A UDP-N-acetylmuramate-L  10.1 1.1E+02  0.0034   13.8   1.1   20   41-60      3-23  (150)
  7 >2e4f_A G protein-activated in  10.0 1.5E+02  0.0043   13.3   1.7   23   36-58     27-49  (60)
  8 >1b34_B Protein (small nuclear   8.7 1.6E+02  0.0048   13.0   1.5   17   43-59     98-114 (118)
  9 >1yq9_H Periplasmic [NIFE] hyd   8.4 1.7E+02   0.005   12.9   1.9   26   26-51     28-54  (99)
 10 >2dvk_A UPF0130 protein APE081   8.0 1.7E+02  0.0051   12.8   1.3   11   36-46     82-92  (188)

No 1  
>>2joz_A Hypothetical protein YXEF; structure, GFT, NESG, lipoprotein, structural genomics, PSI-2, protein structure initiative; NMR {Bacillus subtilis} (A:)
Probab=23.63  E-value=55  Score=15.53  Aligned_cols=39  Identities=33%  Similarity=0.542  Sum_probs=31.0

Q ss_pred             EEEEEEECCCCEEEEEECCEEEEEEC-CCCCCCEEEEEEC
Q ss_conf             46888606774799997430687501-1037972599727
Q gi|254780133|r   19 DIAVIASETNTRIEIELEGAIYRFEP-MIRGDNPCLIVDN   57 (63)
Q Consensus        19 diaviasetntrieielegaiyrfep-mirgdnpclivdn   57 (63)
                      -..||...|.-.|||+.-|.-|-... .-||.|-.||-..
T Consensus        63 ~ykvisq~tdgsiei~ylg~~~p~kstlkrg~n~tliw~~  102 (135)
T 2joz_A           63 AYKVISQSTDGSIEIQYLGPYYPLKSTLKRGENGTLIWEQ  102 (135)
T ss_dssp             EEEEEECCSSSEEEEEEESTTCSCEEEEEECSTTCEEEEE
T ss_pred             HHHHHHCCCCCEEEEEECCCCCCHHHHHHCCCCCCEEEEE
T ss_conf             5664102788718989737985335687378888179986


No 2  
>>2gh0_A GFR-alpha-3, GDNF family receptor alpha-3; cystine-knot, helix bundle, hormone/growth factor complex; HET: NAG BMA MAN; 1.92A {Homo sapiens} (A:1-90)
Probab=13.02  E-value=31  Score=16.84  Aligned_cols=15  Identities=13%  Similarity=0.379  Sum_probs=11.8

Q ss_pred             EEECCCCCCCEEEEE
Q ss_conf             750110379725997
Q gi|254780133|r   41 RFEPMIRGDNPCLIV   55 (63)
Q Consensus        41 rfepmirgdnpcliv   55 (63)
                      |+||.+.+.|+||-+
T Consensus         1 ~~~~~~~~~~~Cl~a   15 (90)
T 2gh0_A            1 KLNMLKPDSDLCLKF   15 (90)
T ss_dssp             -------CCCHHHHH
T ss_pred             CCCCCCCCCHHHHCC
T ss_conf             966458885177662


No 3  
>>1n9p_A GIRK1, G protein-activated inward rectifier potassium channel 1; beta barrel, cytoplasmic domain, metal transport; 1.80A {Mus musculus} (A:)
Probab=11.72  E-value=99  Score=14.15  Aligned_cols=11  Identities=18%  Similarity=0.326  Sum_probs=4.4

Q ss_pred             EEECCEEEEEE
Q ss_conf             99743068750
Q gi|254780133|r   33 IELEGAIYRFE   43 (63)
Q Consensus        33 ielegaiyrfe   43 (63)
                      ...||...++.
T Consensus        73 ~t~eG~~~~~~   83 (207)
T 1n9p_A           73 QTPEGEFLPLD   83 (207)
T ss_dssp             ECTTSCEEEEE
T ss_pred             ECCCCCEEEEE
T ss_conf             73887278757


No 4  
>>1e8c_A UDP-N-acetylmuramoylalanyl-D-glutamate--2,6- diaminopimelate ligase; peptidoglycan biosynthesis; HET: KCX UAG API; 2.0A {Escherichia coli} (A:338-498)
Probab=10.92  E-value=1.2e+02  Score=13.79  Aligned_cols=20  Identities=30%  Similarity=0.575  Sum_probs=12.4

Q ss_pred             EEECCCCCCCEEEEEE-CCCC
Q ss_conf             7501103797259972-7886
Q gi|254780133|r   41 RFEPMIRGDNPCLIVD-NDNP   60 (63)
Q Consensus        41 rfepmirgdnpclivd-ndnp   60 (63)
                      |||-+-.+++|.+|+| +.||
T Consensus         4 R~e~i~~~~~~~ii~D~AHNp   24 (161)
T 1e8c_A            4 RXEVFTAPGKPTVVVDYAHTP   24 (161)
T ss_dssp             SSEEECCTTSCEEEEECCCSH
T ss_pred             CCEEEEECCCEEEEEECCCCH
T ss_conf             848999579819999868999


No 5  
>>1knx_A Probable HPR(Ser) kinase/phosphatase; HPR kinase, HPR kinase/phosphatase, HPRK/P, P-loop, walker A BOX, catabolite repression; 2.50A {Mycoplasma pneumoniae} (A:1-119)
Probab=10.63  E-value=81  Score=14.62  Aligned_cols=25  Identities=8%  Similarity=0.145  Sum_probs=19.4

Q ss_pred             CEEEEEECCCCCCCEEEEEECCCCC
Q ss_conf             3068750110379725997278865
Q gi|254780133|r   37 GAIYRFEPMIRGDNPCLIVDNDNPL   61 (63)
Q Consensus        37 gaiyrfepmirgdnpclivdndnpl   61 (63)
                      ....+|+-+...+-||+|+-.+.+.
T Consensus        71 ~r~~~l~~l~~~~~P~iIvt~~~~~   95 (119)
T 1knx_A           71 EQQQILHNLLKLNPPAIILTKSFTD   95 (119)
T ss_dssp             HHTTTHHHHHTTCCSCEEEETTTCC
T ss_pred             HHHHHHHHHHCCCCCEEEEECCCCC
T ss_conf             9999999983889988999895999


No 6  
>>3hn7_A UDP-N-acetylmuramate-L-alanine ligase; YP_263340.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.65A {Psychrobacter arcticus 273-4} (A:375-524)
Probab=10.09  E-value=1.1e+02  Score=13.81  Aligned_cols=20  Identities=20%  Similarity=0.238  Sum_probs=9.7

Q ss_pred             EEECCCCCCCEEEEEE-CCCC
Q ss_conf             7501103797259972-7886
Q gi|254780133|r   41 RFEPMIRGDNPCLIVD-NDNP   60 (63)
Q Consensus        41 rfepmirgdnpclivd-ndnp   60 (63)
                      |||..-.+++|.+|.| +.||
T Consensus         3 R~e~~~~~~~~~ii~D~ahNp   23 (150)
T 3hn7_A            3 RXELIGDVNDILVFDDFAHHP   23 (150)
T ss_dssp             SSEEEEEETTEEEEEECCCSH
T ss_pred             HHEEEECCCCCEEEEECCCCH
T ss_conf             403674057815884037998


No 7  
>>2e4f_A G protein-activated inward rectifier potassium channel 2; cytoplasmic assembly, ION channel, beta-barrel, transport protein; 2.30A {Mus musculus} (A:1-29,A:162-192)
Probab=10.04  E-value=1.5e+02  Score=13.25  Aligned_cols=23  Identities=30%  Similarity=0.488  Sum_probs=16.7

Q ss_pred             CCEEEEEECCCCCCCEEEEEECC
Q ss_conf             43068750110379725997278
Q gi|254780133|r   36 EGAIYRFEPMIRGDNPCLIVDND   58 (63)
Q Consensus        36 egaiyrfepmirgdnpclivdnd   58 (63)
                      +-+=+||+|++--..-..-||-.
T Consensus        27 ~~~GHRFePVv~~ekg~Y~VDYs   49 (60)
T 2e4f_A           27 KRAGYRFTPVLTLEDGFYEVDYN   49 (60)
T ss_dssp             --CTEEECCCEEC--CCEEEEGG
T ss_pred             CCCCCEEEEEEEECCCEEEEEHH
T ss_conf             76379981669956986998879


No 8  
>>1b34_B Protein (small nuclear ribonucleoprotein SM D2); snRNP, splicing, spliceosome, core snRNP domain, systemic lupus erythematosus, SLE; 2.50A {Homo sapiens} (B:)
Probab=8.69  E-value=1.6e+02  Score=12.98  Aligned_cols=17  Identities=24%  Similarity=0.466  Sum_probs=14.0

Q ss_pred             ECCCCCCCEEEEEECCC
Q ss_conf             01103797259972788
Q gi|254780133|r   43 EPMIRGDNPCLIVDNDN   59 (63)
Q Consensus        43 epmirgdnpclivdndn   59 (63)
                      .-+|||||-.+|.-+|.
T Consensus        98 ~~~iRGdnVv~I~~~d~  114 (118)
T 1b34_B           98 KMFLRGDSVIVVLRNPL  114 (118)
T ss_dssp             EEEECGGGEEEEEECCC
T ss_pred             EEEEECCEEEEEECCHH
T ss_conf             49995998999986814


No 9  
>>1yq9_H Periplasmic [NIFE] hydrogenase large subunit; oxidoreductase; 2.35A {Desulfovibrio gigas} (H:1-55,H:493-536)
Probab=8.38  E-value=1.7e+02  Score=12.88  Aligned_cols=26  Identities=19%  Similarity=0.400  Sum_probs=14.9

Q ss_pred             CCCCEEEEEECCEEEE-EECCCCCCCE
Q ss_conf             6774799997430687-5011037972
Q gi|254780133|r   26 ETNTRIEIELEGAIYR-FEPMIRGDNP   51 (63)
Q Consensus        26 etntrieielegaiyr-fepmirgdnp   51 (63)
                      +.+.-.+..+.+..|| ||-+.+|-.|
T Consensus        28 e~g~V~da~~~~~~~RGFE~iL~GR~p   54 (99)
T 1yq9_H           28 EGGKIKNAWSMSTLFRGLEMILKGRDP   54 (99)
T ss_dssp             ETTEEEEEEEEECBCCCHHHHHTTSCG
T ss_pred             ECCEEEEEEECCCCCCHHHHHHCCCCH
T ss_conf             299899999824776349898679998


No 10 
>>2dvk_A UPF0130 protein APE0816; hypothetical protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.80A {Aeropyrum pernix} (A:)
Probab=7.99  E-value=1.7e+02  Score=12.83  Aligned_cols=11  Identities=9%  Similarity=0.002  Sum_probs=0.0

Q ss_pred             CCEEEEEECCC
Q ss_conf             43068750110
Q gi|254780133|r   36 EGAIYRFEPMI   46 (63)
Q Consensus        36 egaiyrfepmi   46 (63)
                      +...+.|||||
T Consensus        82 ~~i~fkfep~I   92 (188)
T 2dvk_A           82 TNLWLKVTGPI   92 (188)
T ss_dssp             SSEEEEEECCE
T ss_pred             CCEEEEECCCE
T ss_conf             73599821979


Done!