BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Schaffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= gi|254780133|ref|YP_003064546.1| hypothetical protein CLIBASIA_00060 [Candidatus Liberibacter asiaticus str. psy62] (63 letters) Database: nr 13,984,884 sequences; 4,792,584,752 total letters Searching..................................................done >gi|254780133|ref|YP_003064546.1| hypothetical protein CLIBASIA_00060 [Candidatus Liberibacter asiaticus str. psy62] gi|254039810|gb|ACT56606.1| hypothetical protein CLIBASIA_00060 [Candidatus Liberibacter asiaticus str. psy62] gi|317120847|gb|ADV02668.1| hypothetical protein UF506_045 [Candidatus Liberibacter asiaticus] Length = 63 Score = 118 bits (295), Expect = 3e-25, Method: Composition-based stats. Identities = 63/63 (100%), Positives = 63/63 (100%) Query: 1 MTEKANKRYSLIRRVDIRDIAVIASETNTRIEIELEGAIYRFEPMIRGDNPCLIVDNDNP 60 MTEKANKRYSLIRRVDIRDIAVIASETNTRIEIELEGAIYRFEPMIRGDNPCLIVDNDNP Sbjct: 1 MTEKANKRYSLIRRVDIRDIAVIASETNTRIEIELEGAIYRFEPMIRGDNPCLIVDNDNP 60 Query: 61 LDL 63 LDL Sbjct: 61 LDL 63 >gi|315122000|ref|YP_004062489.1| hypothetical protein CKC_01250 [Candidatus Liberibacter solanacearum CLso-ZC1] gi|313495402|gb|ADR52001.1| hypothetical protein CKC_01250 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 67 Score = 54.2 bits (129), Expect = 6e-06, Method: Composition-based stats. Identities = 29/50 (58%), Positives = 33/50 (66%) Query: 14 RVDIRDIAVIASETNTRIEIELEGAIYRFEPMIRGDNPCLIVDNDNPLDL 63 R+ IRD A IA E N RIEIE +G IYRFEP+ + NP DN NPL L Sbjct: 13 RISIRDTARIAKENNIRIEIERDGTIYRFEPLSKRKNPPAEEDNSNPLGL 62 >gi|315122593|ref|YP_004063082.1| hypothetical protein CKC_04225 [Candidatus Liberibacter solanacearum CLso-ZC1] gi|313495995|gb|ADR52594.1| hypothetical protein CKC_04225 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 61 Score = 45.8 bits (107), Expect = 0.002, Method: Composition-based stats. Identities = 25/45 (55%), Positives = 29/45 (64%) Query: 1 MTEKANKRYSLIRRVDIRDIAVIASETNTRIEIELEGAIYRFEPM 45 MT K + R+ IRD A IA ETN RIEIE +G IYRFEP+ Sbjct: 1 MTNIEQKPHPHKGRISIRDTARIAQETNIRIEIERDGTIYRFEPL 45 >gi|315122594|ref|YP_004063083.1| hypothetical protein CKC_04230 [Candidatus Liberibacter solanacearum CLso-ZC1] gi|313495996|gb|ADR52595.1| hypothetical protein CKC_04230 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 56 Score = 37.3 bits (85), Expect = 0.67, Method: Composition-based stats. Identities = 16/30 (53%), Positives = 23/30 (76%) Query: 15 VDIRDIAVIASETNTRIEIELEGAIYRFEP 44 +DIR++A I+ +T RIEIE G +YRF+P Sbjct: 7 IDIRNVANISKDTKIRIEIERNGTLYRFDP 36 >gi|2754746|gb|AAC39433.1| sucrose-phosphate synthase [Actinidia deliciosa] Length = 769 Score = 34.2 bits (77), Expect = 6.4, Method: Composition-based stats. Identities = 18/48 (37%), Positives = 33/48 (68%), Gaps = 4/48 (8%) Query: 3 EKANKRYSLIRRVDIRDIAVIASE---TNTRIEIELEGAIYR-FEPMI 46 ++ NK Y ++RR++ ++++ ASE T+TR EIE + +Y F+P+I Sbjct: 74 DEINKTYKIMRRIEAEELSLDASEIVITSTRQEIEQQWRLYDGFDPVI 121 Database: nr Posted date: May 13, 2011 4:10 AM Number of letters in database: 999,999,932 Number of sequences in database: 2,987,209 Database: /data/usr2/db/fasta/nr.01 Posted date: May 13, 2011 4:17 AM Number of letters in database: 999,998,956 Number of sequences in database: 2,896,973 Database: /data/usr2/db/fasta/nr.02 Posted date: May 13, 2011 4:23 AM Number of letters in database: 999,999,979 Number of sequences in database: 2,907,862 Database: /data/usr2/db/fasta/nr.03 Posted date: May 13, 2011 4:29 AM Number of letters in database: 999,999,513 Number of sequences in database: 2,932,190 Database: /data/usr2/db/fasta/nr.04 Posted date: May 13, 2011 4:33 AM Number of letters in database: 792,586,372 Number of sequences in database: 2,260,650 Lambda K H 0.321 0.140 0.395 Lambda K H 0.267 0.0431 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 527,883,389 Number of Sequences: 13984884 Number of extensions: 15048748 Number of successful extensions: 27463 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 27459 Number of HSP's gapped (non-prelim): 5 length of query: 63 length of database: 4,792,584,752 effective HSP length: 35 effective length of query: 28 effective length of database: 4,303,113,812 effective search space: 120487186736 effective search space used: 120487186736 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 76 (33.8 bits)