RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780133|ref|YP_003064546.1| hypothetical protein CLIBASIA_00060 [Candidatus Liberibacter asiaticus str. psy62] (63 letters) >gnl|CDD|179712 PRK04019, rplP0, acidic ribosomal protein P0; Validated. Length = 330 Score = 26.8 bits (60), Expect = 1.2 Identities = 19/56 (33%), Positives = 25/56 (44%), Gaps = 6/56 (10%) Query: 12 IRRVDIRDIAVIASETNTRIEIELEGA----IYRFEPMIRGDNPCLIVDNDNPLDL 63 IRR +R A + NT I+ LE A + + E + G LI N NP L Sbjct: 41 IRR-KLRGKAELKVSKNTLIKRALEEAGEEDLEKLEDYLEGQV-ALIFTNMNPFKL 94 >gnl|CDD|178028 PLN02406, PLN02406, ethanolamine-phosphate cytidylyltransferase. Length = 418 Score = 24.6 bits (53), Expect = 6.1 Identities = 8/17 (47%), Positives = 12/17 (70%) Query: 40 YRFEPMIRGDNPCLIVD 56 Y + +I GD+PCL+ D Sbjct: 140 YNIDYIIHGDDPCLLPD 156 >gnl|CDD|180457 PRK06193, PRK06193, hypothetical protein; Provisional. Length = 206 Score = 23.9 bits (52), Expect = 8.6 Identities = 8/16 (50%), Positives = 8/16 (50%) Query: 29 TRIEIELEGAIYRFEP 44 T I E EG FEP Sbjct: 171 TGIYPEPEGEAAVFEP 186 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.321 0.140 0.395 Gapped Lambda K H 0.267 0.0768 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 1,022,818 Number of extensions: 49403 Number of successful extensions: 114 Number of sequences better than 10.0: 1 Number of HSP's gapped: 114 Number of HSP's successfully gapped: 12 Length of query: 63 Length of database: 5,994,473 Length adjustment: 35 Effective length of query: 28 Effective length of database: 5,238,193 Effective search space: 146669404 Effective search space used: 146669404 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.0 bits)