RPS-BLAST 2.2.22 [Sep-27-2009] Database: pdb70 24,244 sequences; 5,693,230 total letters Searching..................................................done Query= gi|254780133|ref|YP_003064546.1| hypothetical protein CLIBASIA_00060 [Candidatus Liberibacter asiaticus str. psy62] (63 letters) >1lf6_A Glucoamylase; (alpha/alpha) barrel, 6 alpha-helical hairpin torroid, super beta sandwich, carbohydrase family GH15; 2.10A {Thermoanaerobacteriumthermosaccharolyticum} SCOP: a.102.1.5 b.30.5.5 PDB: 1lf9_A* Length = 684 Score = 26.5 bits (58), Expect = 1.4 Identities = 9/38 (23%), Positives = 18/38 (47%) Query: 8 RYSLIRRVDIRDIAVIASETNTRIEIELEGAIYRFEPM 45 Y I D+++I I ++ + + E + AI + E Sbjct: 63 YYPTIDTADVKEIKFIVTDGKSFVPDETKDAISKVEKF 100 >2b3y_A Iron-responsive element binding protein 1; IRP1 IRE-IRP1 aconitase activity, lyase; 1.85A {Homo sapiens} SCOP: c.8.2.1 c.83.1.1 PDB: 2b3x_A 2ipy_A Length = 888 Score = 24.7 bits (53), Expect = 5.4 Identities = 9/20 (45%), Positives = 10/20 (50%) Query: 19 DIAVIASETNTRIEIELEGA 38 IA I S TNT + GA Sbjct: 429 VIAAITSCTNTSNPSVMLGA 448 >2qks_A KIR3.1-prokaryotic KIR channel chimera; G-protein gated inward rectifier, potassium channel, selectivity filter, metal transport; HET: BNG; 2.20A {Burkholderia xenovorans} Length = 321 Score = 24.5 bits (53), Expect = 6.4 Identities = 6/20 (30%), Positives = 9/20 (45%) Query: 40 YRFEPMIRGDNPCLIVDNDN 59 +RF P+I + VD Sbjct: 272 HRFFPVISLEEGFFKVDYSQ 291 Database: pdb70 Posted date: Jan 26, 2011 11:21 AM Number of letters in database: 5,693,230 Number of sequences in database: 24,244 Lambda K H 0.321 0.140 0.395 Gapped Lambda K H 0.267 0.0598 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 24244 Number of Hits to DB: 535,025 Number of extensions: 19323 Number of successful extensions: 49 Number of sequences better than 10.0: 1 Number of HSP's gapped: 49 Number of HSP's successfully gapped: 10 Length of query: 63 Length of database: 5,693,230 Length adjustment: 34 Effective length of query: 29 Effective length of database: 4,868,934 Effective search space: 141199086 Effective search space used: 141199086 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.3 bits)