BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780133|ref|YP_003064546.1| hypothetical protein CLIBASIA_00060 [Candidatus Liberibacter asiaticus str. psy62] (63 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780133|ref|YP_003064546.1| hypothetical protein CLIBASIA_00060 [Candidatus Liberibacter asiaticus str. psy62] Length = 63 Score = 127 bits (318), Expect = 4e-32, Method: Compositional matrix adjust. Identities = 63/63 (100%), Positives = 63/63 (100%) Query: 1 MTEKANKRYSLIRRVDIRDIAVIASETNTRIEIELEGAIYRFEPMIRGDNPCLIVDNDNP 60 MTEKANKRYSLIRRVDIRDIAVIASETNTRIEIELEGAIYRFEPMIRGDNPCLIVDNDNP Sbjct: 1 MTEKANKRYSLIRRVDIRDIAVIASETNTRIEIELEGAIYRFEPMIRGDNPCLIVDNDNP 60 Query: 61 LDL 63 LDL Sbjct: 61 LDL 63 >gi|255764478|ref|YP_003065205.2| aminopeptidase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 418 Score = 22.7 bits (47), Expect = 1.3, Method: Composition-based stats. Identities = 8/14 (57%), Positives = 11/14 (78%) Query: 46 IRGDNPCLIVDNDN 59 I GDNP L+V+ D+ Sbjct: 109 ISGDNPLLLVNEDS 122 >gi|254781102|ref|YP_003065515.1| UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase [Candidatus Liberibacter asiaticus str. psy62] Length = 497 Score = 22.3 bits (46), Expect = 1.7, Method: Composition-based stats. Identities = 8/16 (50%), Positives = 10/16 (62%) Query: 42 FEPMIRGDNPCLIVDN 57 F IR + P L+VDN Sbjct: 82 FSATIRSNTPILVVDN 97 >gi|254780606|ref|YP_003065019.1| cell division protein [Candidatus Liberibacter asiaticus str. psy62] Length = 744 Score = 21.6 bits (44), Expect = 2.5, Method: Composition-based stats. Identities = 11/27 (40%), Positives = 13/27 (48%) Query: 34 ELEGAIYRFEPMIRGDNPCLIVDNDNP 60 E+EGAI R M R LI+ P Sbjct: 548 EIEGAIQRLAQMARAAGIHLIMATQRP 574 >gi|254780342|ref|YP_003064755.1| substrate-binding region of ABC-type glycine betaine transport system [Candidatus Liberibacter asiaticus str. psy62] Length = 309 Score = 20.0 bits (40), Expect = 8.2, Method: Compositional matrix adjust. Identities = 11/30 (36%), Positives = 14/30 (46%) Query: 34 ELEGAIYRFEPMIRGDNPCLIVDNDNPLDL 63 EL IY EP G+ L + N+N L Sbjct: 137 ELGAKIYGIEPGNEGNQRILDMINNNKFSL 166 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.321 0.140 0.395 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 37,582 Number of Sequences: 1233 Number of extensions: 1120 Number of successful extensions: 5 Number of sequences better than 100.0: 5 Number of HSP's better than 100.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of query: 63 length of database: 328,796 effective HSP length: 34 effective length of query: 29 effective length of database: 286,874 effective search space: 8319346 effective search space used: 8319346 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.3 bits) S2: 31 (16.5 bits)