RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780134|ref|YP_003064547.1| phage-related integrase/recombinase [Candidatus Liberibacter asiaticus str. psy62] (348 letters) >gnl|CDD|144254 pfam00589, Phage_integrase, Phage integrase family. Members of this family cleave DNA substrates by a series of staggered cuts, during which the protein becomes covalently linked to the DNA through a catalytic tyrosine residue at the carboxy end of the alignment. The catalytic site residues in CRE recombinase are Arg-173, His-289, Arg-292 and Tyr-324. Length = 170 Score = 63.5 bits (155), Expect = 8e-11 Identities = 33/142 (23%), Positives = 53/142 (37%), Gaps = 10/142 (7%) Query: 193 RLAFEFLLYSGLRCSDSCRAGVQH--LQNNIFSIKTQKTGTIITVELPDGFMKLL----- 245 R E LL +GLR S+ L N I KT TV L D ++ L Sbjct: 24 RALVELLLLTGLRISELLSLRWSDIDLDNGTIRIPQTKTRKSRTVPLSDAALEALKEWLG 83 Query: 246 -AMTPIGKETFFINNDKQKMNATQFSIWFKAKATKAGVNK--SAHGVRKFSATISADAGA 302 E F++ + ++ + + F+ +AG+ K + H +R AT A+ G Sbjct: 84 DRKEAEESEFLFVSRRGKPLSRSTVNRAFRRAGKRAGIEKDLTPHDLRHTFATHLAENGV 143 Query: 303 TAHELMATYGWKTVDQAETYTK 324 + G ++ YT Sbjct: 144 PLRVIQKLLGHSSISMTMRYTH 165 >gnl|CDD|29502 cd00801, INT_P4, Bacteriophage P4 integrase. P4-like integrases are found in temperate bacteriophages, integrative plasmids, pathogenicity and symbiosis islands, and other mobile genetic elements. They share the same fold in their catalytic domain and the overall reaction mechanism with the superfamily of DNA breaking-rejoining enzymes. The P4 integrase mediates integrative and excisive site-specific recombination between two sites, called attachment sites, located on the phage genome and the bacterial chromosome. The phage attachment site is often found adjacent to the integrase gene, while the host attachment sites are typically situated near tRNA genes.. Length = 357 Score = 59.9 bits (145), Expect = 1e-09 Identities = 39/267 (14%), Positives = 93/267 (34%), Gaps = 22/267 (8%) Query: 57 KREYINSPRKKPTTLKWLISEYRKSAHWGSLAVNSRISFESYFDQIIRKSGDFDYRKITT 116 ++E + T + E+ + ++R + ++ G +IT Sbjct: 59 RKEEKAAKLSAANTFAEVAEEWLAAKKPRWSEKHARQWRRTLEKHVLPVLGKKPITEITA 118 Query: 117 KHIRSGVES--RKHTPSSAIQFLTSMRVLFKWAVRQEYVAINPCLSVERPKRKTEGIR-P 173 + + + + +A + ++ +F++A+ + + NP + + Sbjct: 119 RDLLDVLRRIEARGALETARRVRQRLKQVFRYAIARGLIEANPAADLRGADGAPKKQHDR 178 Query: 174 WTKEDMQQFKSFW------SEGSQPRLAFEFLLYSGLRCSDSCRAGVQH--LQNNIFSI- 224 D + F S RLA + LL +G+R + A L+N +++I Sbjct: 179 ALSPD--ELPEFLQALDAASGSPVTRLALKLLLLTGVRPGELRGARWSEIDLENALWTIP 236 Query: 225 -KTQKTGTIITVELPDGFMKLL-AMTPIGKETFFI----NNDKQKMNATQFSIWFKAKAT 278 + KT V L D + LL + + + ++ + + ++ + K Sbjct: 237 AERMKTRRPHRVPLSDQALALLEELRELSGHSEYVFPSRRDRGKPLSENTLNKALKRMGY 296 Query: 279 KAGVNKSAHGVRKFSATISADAGATAH 305 + HG+R+ + T + G Sbjct: 297 LGEW--TPHGLRRTARTWLNELGFPPD 321 >gnl|CDD|29503 cd01182, INT_REC_C, DNA breaking-rejoining enzymes, intergrase/recombinases, C-terminal catalytic domain. The tyrosine recombinase/integrase family share the same catalytic domain containing six conserved active site residues. The best-studied members of this diverse family include the bacteriophage lambda integrase, the bacteriophage P1 Cre recombinase, the yeast Flp recombinase and the bacterial XerD/C recombinases. Their overall reaction mechanism is essentially identical and involves cleavage of a single strand of a DNA duplex by nucleophilic attack of a conserved tyrosine to give a 3' phosphotyrosyl protein-DNA adduct. In the second rejoining step, a terminal 5' hydroxyl attacks the covalent adduct to release the enzyme and generate duplex DNA. Many intergrase/recombinases also have N-terminal domains, which show little sequence or structure similarity.. Length = 162 Score = 57.6 bits (138), Expect = 5e-09 Identities = 32/145 (22%), Positives = 50/145 (34%), Gaps = 13/145 (8%) Query: 193 RLAFEFLLYSGLRCSDSCRAGVQH--LQNNIFSIKTQKTGTIITVELPDGFMKLL----- 245 R LLY+GLR S+ L +++ KTG TV L +LL Sbjct: 18 RALILLLLYTGLRVSELLALRWSDIDLDKGTITVRRTKTGKERTVPLSPELAELLREYLE 77 Query: 246 --AMTPIGKETFFINNDKQKMNATQ--FSIWFKAKATKAGVNK--SAHGVRKFSATISAD 299 P + F + T+ K +AG+ + + H +R AT + Sbjct: 78 LRRPAPKPDDYLFPSRRGGPKRLTRRAVRRLLKKAGKRAGIPERLTPHDLRHTFATRLLE 137 Query: 300 AGATAHELMATYGWKTVDQAETYTK 324 AG + G ++ E Y Sbjct: 138 AGVPLEVIQELLGHSSISTTERYLH 162 >gnl|CDD|29495 cd00397, DNA_BRE_C, DNA breaking-rejoining enzymes, C-terminal catalytic domain. The DNA breaking-rejoining enzyme superfamily includes type IB topoisomerases and tyrosine recombinases that share the same fold in their catalytic domain containing six conserved active site residues. The best-studied members of this diverse superfamily include human topoisomerase I, the bacteriophage lambda integrase, the bacteriophage P1 Cre recombinase, the yeast Flp recombinase and the bacterial XerD/C recombinases. Their overall reaction mechanism is essentially identical and involves cleavage of a single strand of a DNA duplex by nucleophilic attack of a conserved tyrosine to give a 3' phosphotyrosyl protein-DNA adduct. In the second rejoining step, a terminal 5' hydroxyl attacks the covalent adduct to release the enzyme and generate duplex DNA. The enzymes differ in that topoisomerases cleave and then rejoin the same 5' and 3' termini, whereas a site-specific recombinase transfers a 5' hydroxyl generated by recombinase cleavage to a new 3' phosphate partner located in a different duplex region. Many DNA breaking-rejoining enzymes also have N-terminal domains, which show little sequence or structure similarity.. Length = 164 Score = 51.6 bits (123), Expect = 4e-07 Identities = 34/153 (22%), Positives = 55/153 (35%), Gaps = 15/153 (9%) Query: 187 SEGSQPRLAFEFLLYSGLRCSDSCRAGVQHLQ--NNIFSIKTQKTGTIITVELPDGFMKL 244 S + LA LL +GLR S+ C + + I KT TV L + +KL Sbjct: 12 STPERLYLALLLLLATGLRISELCALRWSDIDLDKRVIHITGTKTKKERTVPLSEEALKL 71 Query: 245 LAM-------TPIGKETFFINNDKQ---KMNATQFSIWFKAKATKAGVNK---SAHGVRK 291 L +E F + ++ FKA +AG++K + H +R Sbjct: 72 LKEYLKKRRPANGDEEYLFPSRRGGPAATLSRRNVKRIFKAAGRRAGIDKEGLTPHSLRH 131 Query: 292 FSATISADAGATAHELMATYGWKTVDQAETYTK 324 A+ +AG + G ++ Y Sbjct: 132 TFASALLNAGLDLEAVQDLLGHSSIAMTMRYAH 164 >gnl|CDD|34580 COG4974, XerD, Site-specific recombinase XerD [DNA replication, recombination, and repair]. Length = 300 Score = 50.6 bits (121), Expect = 6e-07 Identities = 50/263 (19%), Positives = 97/263 (36%), Gaps = 28/263 (10%) Query: 87 LAVNSRISFE---SYFDQIIRKSGDFDYRKITTKHIRSGVESRKH---TPSSAIQFLTSM 140 L+ N+ S+ F + + + G D T IR + + +S + L+++ Sbjct: 22 LSANTLSSYRRDLEDFREWLEERGITDLADATEADIREYLTELAEQGLSATSIARALSAL 81 Query: 141 RVLFKWAVRQEYVAINPCLSVERPKRKTEGIRPWTKEDMQQFKSFWSEGSQP-----RLA 195 R +++ +R+ +P ++ PK + ++E+++ + P R Sbjct: 82 RSFYQFLIREGLREDDPTRLLDSPKLPKRLPKFLSEEEVEALLEA-PDEDTPLGLRDRAM 140 Query: 196 FEFLLYSGLRCSDSCRAGVQ--HLQNNIFSI--KTQKTGTI---------ITVELPDGFM 242 E L +GLR S+ + L+ + + K K + + L + Sbjct: 141 LELLYATGLRVSELVGLTLSDVDLRQGVVRVRGKGNKERLVPFGEEAVEALEKYLEEARP 200 Query: 243 KLLAMTPIGKETFFINNDKQKMNATQFSIWFKAKATKAGVNK--SAHGVRKFSATISADA 300 KLL + F N + F K A +AG++K S H +R AT + Sbjct: 201 KLLKGKS-STDALFPNQRGGGLTRQGFWKRLKDYAERAGIDKKISPHTLRHSFATHLLEN 259 Query: 301 GATAHELMATYGWKTVDQAETYT 323 GA + G + + YT Sbjct: 260 GADLRVVQELLGHADISTTQIYT 282 >gnl|CDD|29499 cd00798, INT_XerDC, XerD and XerC integrases, DNA breaking-rejoining enzymes, N- and C-terminal domains. XerD-like integrases are involved in the site-specific integration and excision of lysogenic bacteriophage genomes, transposition of conjugative transposons, termination of chromosomal replication, and stable plasmid inheritance. They share the same fold in their catalytic domain containing six conserved active site residues and the overall reaction mechanism with the DNA breaking-rejoining enzyme superfamily. In Escherichia coli, the Xer site-specific recombination system acts to convert dimeric chromosomes, which are formed by homologous recombination to monomers. Two related recombinases, XerC and XerD, bind cooperatively to a recombination site present in the E. coli chromosome. Each recombinase catalyzes the exchange of one pair of DNA strand in a reaction that proceeds through a Holliday junction intermediate. These enzymes can bridge two different and well-separated DNA sequences called arm- and core-sites. The C-terminal domain binds, cleaves and re-ligates DNA strands at the core-sites, while the N-terminal domain is largely responsible for high-affinity binding to the arm-type sites.. Length = 284 Score = 47.9 bits (114), Expect = 4e-06 Identities = 53/275 (19%), Positives = 103/275 (37%), Gaps = 28/275 (10%) Query: 71 LKWLISEYRKSAHWGSLAVNSRISFESYFDQIIRKSGDFDYRKITTKHIRSGVES---RK 127 L +L E S + + + F + + + G +T IR + + Sbjct: 5 LDYLAVERGLSEN----TLAAYRRDLERFLEFLEERGILFPADVTPDDIRRFLAELKDQG 60 Query: 128 HTPSSAIQFLTSMRVLFKWAVRQEYVAINPCLSVERPKRKTEGIRPWTKEDMQQFKSFWS 187 + S + L+++R FK+ +R+ + NP +E PK K + T E++++ + Sbjct: 61 LSARSIARKLSALRSFFKFLLREGLILANPAELIEPPKLKRSLPKVLTIEEVERLLAAPD 120 Query: 188 ----EGSQPRLAFEFLLYSGLRCSDSCRAGVQHLQNNIFSIKTQKTG------------- 230 G + R E L +GLR S+ + + + I+ + G Sbjct: 121 GDTPLGLRDRALLELLYSTGLRVSELVGLKLSDVDLSRGLIRVRGKGNKERIVPLGETAV 180 Query: 231 TIITVELPDGFMKLLAMTPIGKETFFINNDKQKMNATQFSIWFKAKATKAGVNK--SAHG 288 + L LL + + F+N ++++ K A +AG+ K S H Sbjct: 181 EALQRYLEVRRPLLLKVGDS--DALFLNQRGKRLSRRGVWKILKEYARRAGIEKKISPHT 238 Query: 289 VRKFSATISADAGATAHELMATYGWKTVDQAETYT 323 +R AT + GA + G ++ + YT Sbjct: 239 LRHSFATHLLENGADLRAVQELLGHASLATTQIYT 273 >gnl|CDD|29506 cd01185, INT_Tn4399, Tn4399 and related integrases, DNA breaking-rejoining enzymes, integrase/recombinases, N- and C-terminal domains. This CD includes various bacterial integrases, including cLV25, a Bacteroides fragilis chromosomal transfer factor integrase similar to the Bacteroides mobilizable transposon, Tn4399, integrase.. Length = 299 Score = 46.0 bits (109), Expect = 1e-05 Identities = 53/246 (21%), Positives = 96/246 (39%), Gaps = 22/246 (8%) Query: 99 FDQIIRKSGDFDYRKITTKHIRS----GVESRKHTPSSAIQFLTSMRVLFKWAVRQEYVA 154 F + K D ++T + I + +K + ++A+ +L+ ++ L K A R + + Sbjct: 51 FIECTYKEIDIALLELTREFILEFKLFLRKEKKLSRNTAVHYLSWLKKLLKIAYRDKGLR 110 Query: 155 INPCLSVERPKRKTEGIRPW-TKEDMQQFKS---FWSEGSQPRLAFEFLLYSGLRCSDSC 210 NP + K + E R + T +++Q+ R AF F ++GLR SD Sbjct: 111 DNPFAKFKCKK-EEETDREYLTPDELQKLAETPCKDPRLELVRRAFLFSCFTGLRYSDIK 169 Query: 211 RAGVQHLQNN-----IFSIKTQKTGTIITVELPDGFMKLLAMTPIGKE-TFFINNDKQKM 264 + + + + + QKT + + L D +++L P KE F M Sbjct: 170 KLTWEEIVEDSDGEKWIRKRRQKTKVEVYIPLLDEALQILGKYPDEKEGLVFPLLKNSNM 229 Query: 265 NATQFSIWFKAKATKAGVNK--SAHGVRKFSATISADAGATAHELMATYGWKTVDQAETY 322 N K A AG+ K + H R AT+ +G + G + + Y Sbjct: 230 NKP-----LKEWAKLAGIKKHITFHCARHTFATLQLLSGGPIETVSKMLGHTNIKTTQVY 284 Query: 323 TKGADR 328 + D Sbjct: 285 ARVTDE 290 >gnl|CDD|29500 cd00799, INT_Cre, Cre recombinase, C-terminal catalytic domain. Cre-like recombinases belong to the superfamily of DNA breaking-rejoining enzymes, which share the same fold in their catalytic domain and the overall reaction mechanism. The bacteriophage P1 Cre recombinase maintains the circular phage replicon in a monomeric state by catalyzing a site-specific recombination between two loxP sites. The catalytic core domain of Cre recombinase is linked to a more divergent helical N-terminal domain, which interacts primarily with the DNA major groove proximal to the crossover region.. Length = 287 Score = 41.5 bits (97), Expect = 3e-04 Identities = 49/235 (20%), Positives = 79/235 (33%), Gaps = 34/235 (14%) Query: 128 HTPSSAIQFLTSMRVLFKWAVRQEYVAINPCLSVERPKRKTEG-----IRPWTKEDMQQF 182 PS+ + L+++ L + + V R R+ E ED+ + Sbjct: 44 LAPSTISRRLSALSQLHRRSGLPSPADSPLVRLVLRGIRREEARPKRQALAILPEDLDKL 103 Query: 183 KSFWSEGSQPR---------LAFEFLL----YSGLRCSDSCRAGVQHLQNNIFSIKTQKT 229 +S E R L F LL LR D L + KT ++ Sbjct: 104 RSLLDESDTLRDLRDLALLLLGFAGLLRRSELVRLRWEDLTFTDGGGLLVTLRRSKTDQS 163 Query: 230 GTIITVELPDGFM-------KLLAMTPIGKETFFINNDKQK------MNATQFSIWFKAK 276 G + +P + L I K F D+ ++ + K Sbjct: 164 GLGVLKLIPPLTTCPVRALERWLEAARIPKGPLFRRIDRWGVLGPGALSDNSLNRILKRL 223 Query: 277 ATKAGVNK---SAHGVRKFSATISADAGATAHELMATYGWKTVDQAETYTKGADR 328 A AG+ S H +R+ AT +A AG + E+M W++ Y + ADR Sbjct: 224 AEAAGLRSGSWSGHSLRRGFATEAARAGYSLLEIMRQGRWRSPKMVSRYIRDADR 278 >gnl|CDD|34579 COG4973, XerC, Site-specific recombinase XerC [DNA replication, recombination, and repair]. Length = 299 Score = 35.7 bits (82), Expect = 0.017 Identities = 34/155 (21%), Positives = 69/155 (44%), Gaps = 14/155 (9%) Query: 71 LKWLISEYRKSAHWGSLAVNSRISFESYFDQIIRKSGDFDYRKITTKHIRSGV--ESRKH 128 L++L E + S H +LA N R E+ ++ + G ++++ +R+ V R+ Sbjct: 14 LRYLRVERQLSPH--TLA-NYRRQLEALI-ALLAQMGLGSWQQLDPADVRAFVARSHRRG 69 Query: 129 TPSSAIQF-LTSMRVLFKWAVRQEYVAINPCLSVERPKRKTEGIRPWTKEDMQQFKSFWS 187 + ++ L+++R + W V+Q + NP V PK+ + ++ + Sbjct: 70 LSARSLARRLSALRSFYDWLVKQGELKANPAKGVSAPKQPRHLPKNLDVDEANRLLDI-- 127 Query: 188 EGSQP-----RLAFEFLLYSGLRCSDSCRAGVQHL 217 +G P R E + SGLR S+ ++H+ Sbjct: 128 DGDDPLAVRDRALLELMYGSGLRLSELVGLDLKHV 162 >gnl|CDD|29507 cd01186, INT_SG3_C, INT_SG3, DNA breaking-rejoining enzymes, integrase/recombinases subgroup 3, catalytic domain. The CD contains various predicted bacterial and phage integrase/recombinase sequences for which not much experimental characterization is available.. Length = 180 Score = 34.8 bits (80), Expect = 0.032 Identities = 23/79 (29%), Positives = 35/79 (44%), Gaps = 4/79 (5%) Query: 169 EGIRPWTKEDMQQFKSFWSEGSQP-RLAFEFLLYSGLRCSDSCRAGVQHLQN-NIFSIKT 226 E IR KE ++ K + S+ L F + +GLR SD V+ ++ SIK Sbjct: 4 EPIR--DKEQIKAIKDYLKNHSERNYLLFLIGINTGLRISDILALKVKDVRGDERISIKE 61 Query: 227 QKTGTIITVELPDGFMKLL 245 +KTG + L + L Sbjct: 62 KKTGKRKRIYLNPILKEEL 80 >gnl|CDD|29510 cd01189, INT_phiLC3_C, phiLC3 phage and phage-related integrases, site-specific recombinases, DNA breaking-rejoining enzymes, C-terminal catalytic domain. This CD includes various bacterial (mainly gram positive) and phage integrases, including those similar to Lactococcus phage phiLC3, TPW22, Tuc2009, BK5-T, A2, bIL285, bIL286, bIL311, ul36 and phi g1e; Staphylococcus aureus phage phi13 and phi42; Oenococcus oeni phage fOg44; Streptococcus thermophilus phage O1205 and Sfi21; and Streptococcus pyogenes phage T12 and T270.. Length = 191 Score = 32.1 bits (73), Expect = 0.20 Identities = 35/182 (19%), Positives = 66/182 (36%), Gaps = 32/182 (17%) Query: 174 WTKEDMQQFKSFWSEGSQPR--LAFEFLLYSGLRCSDSCRAGVQH--LQNNIFSIK---T 226 TKE++++ + + L L Y+GLR ++ +NN +I Sbjct: 3 LTKEELKKLLEYLKKHENSFSKLLILLLAYTGLRIGEALALTWSDIDFENNTITINKTWD 62 Query: 227 QKTGTII-----------TVELPDGFMKLL----------AMTPIGKETFFI--NNDKQK 263 KTG I T+ L + +L + I + + N + Sbjct: 63 YKTGGYIFKPPKTKSSIRTIPLDKKTIAILKEYKKEQKKYLLGEINNDDELVFTNKGGKI 122 Query: 264 MNATQFSIWFKAKATKAGVNK-SAHGVRKFSATISADAGATAHELMATYGWKTVDQ-AET 321 + + K KAG+ K + HG+R A++ +AG + + G + +T Sbjct: 123 STPSTINKRLKRICKKAGIPKITFHGLRHTHASLLLEAGVSIKYVSERLGHADISTTLDT 182 Query: 322 YT 323 Y+ Sbjct: 183 YS 184 >gnl|CDD|38746 KOG3538, KOG3538, KOG3538, Disintegrin metalloproteinases with thrombospondin repeats [Posttranslational modification, protein turnover, chaperones]. Length = 845 Score = 29.4 bits (65), Expect = 1.4 Identities = 13/63 (20%), Positives = 25/63 (39%), Gaps = 5/63 (7%) Query: 159 LSVERPKRKTEGIRPWTKEDMQ-----QFKSFWSEGSQPRLAFEFLLYSGLRCSDSCRAG 213 L P +T ++ + D +++ + ++PR + + CS SC G Sbjct: 724 LEASGPLPETLTVQVLVQGDTVPNPGVRYEFTVPKDTEPRRQYTWAHGPWSECSASCGGG 783 Query: 214 VQH 216 VQ Sbjct: 784 VQS 786 >gnl|CDD|34695 COG5092, NMT1, N-myristoyl transferase [Lipid metabolism]. Length = 451 Score = 28.5 bits (63), Expect = 2.7 Identities = 10/29 (34%), Positives = 16/29 (55%) Query: 163 RPKRKTEGIRPWTKEDMQQFKSFWSEGSQ 191 K KTEG+R ++DM+ + E S+ Sbjct: 253 PAKTKTEGLRLAEEKDMEDVARLYLEYSR 281 >gnl|CDD|32836 COG3019, COG3019, Predicted metal-binding protein [General function prediction only]. Length = 149 Score = 26.8 bits (59), Expect = 8.3 Identities = 13/52 (25%), Positives = 21/52 (40%), Gaps = 1/52 (1%) Query: 184 SFWSEGSQPRLAFEFLLYSGLRCSDSCRAGVQHLQNNIFSIKTQKTGTIITV 235 S G A E ++Y C C QH++ N F +K +T + + Sbjct: 14 GLGSTGPAQAQATEMVVYKSPNCG-CCDEWAQHMKANGFEVKVVETDDFLAL 64 >gnl|CDD|30103 cd01381, MYSc_type_VII, Myosin motor domain, type VII myosins. Myosins in this group have been associated with functions in sensory systems such as vision and hearing. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the myosin head dissociates from an actin filament. ATP hydrolysis causes the head to pivot and associate with a new actin subunit. The release of Pi causes the head to pivot and move the filament (power stroke). Release of ADP completes the cycle.. Length = 671 Score = 26.8 bits (59), Expect = 9.6 Identities = 14/55 (25%), Positives = 29/55 (52%) Query: 91 SRISFESYFDQIIRKSGDFDYRKITTKHIRSGVESRKHTPSSAIQFLTSMRVLFK 145 +R +F Q+++ S + ++I + G E+RK P+ + QF S+ +L + Sbjct: 500 NRDTFSGDLSQLVQSSKNKFLKQIFQADVEMGAETRKKKPTLSSQFRRSLDLLMR 554 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.320 0.132 0.399 Gapped Lambda K H 0.267 0.0712 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 4,179,524 Number of extensions: 210832 Number of successful extensions: 457 Number of sequences better than 10.0: 1 Number of HSP's gapped: 451 Number of HSP's successfully gapped: 20 Length of query: 348 Length of database: 6,263,737 Length adjustment: 95 Effective length of query: 253 Effective length of database: 4,210,882 Effective search space: 1065353146 Effective search space used: 1065353146 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 58 (26.2 bits)