Query         gi|254780135|ref|YP_003064548.1| hypothetical protein CLIBASIA_00070 [Candidatus Liberibacter asiaticus str. psy62]
Match_columns 408
No_of_seqs    1 out of 3
Neff          1.0 
Searched_HMMs 13730
Date          Sun May 22 08:16:53 2011
Command       /home/congqian_1/programs/hhpred/hhsearch -i 254780135.hhm -d /home/congqian_1/database/scop/scop70_1_75.hhm 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 d1pt6a_ c.62.1.1 (A:) Integrin  65.8       3 0.00022   18.6   3.6   78  302-393   103-190 (192)
  2 d1mf7a_ c.62.1.1 (A:) Integrin  48.7     6.8 0.00049   16.1   5.1   79  302-393   106-189 (194)
  3 d1n3ya_ c.62.1.1 (A:) Integrin  37.8     9.8 0.00071   14.9   4.8   79  302-393   103-186 (189)
  4 d1q0pa_ c.62.1.1 (A:) Compleme  24.5      16  0.0012   13.4   6.6   81  303-386   114-198 (209)
  5 d1rq2a1 c.32.1.1 (A:8-205) Cel  22.6      16  0.0012   13.3   1.5   24  153-176   107-130 (198)
  6 d1shux_ c.62.1.1 (X:) Capillar  20.1      19  0.0014   12.8   9.9   78  300-391   100-178 (181)
  7 d1v7pc_ c.62.1.1 (C:) Integrin  19.7      20  0.0014   12.8   4.3   49  345-393   132-190 (193)
  8 d1v9va1 a.29.10.1 (A:8-108) Mi  18.1      21  0.0016   12.5   2.0   38   50-88      4-42  (101)
  9 d1ozja_ d.164.1.1 (A:) SMAD MH  17.0      21  0.0015   12.6   1.0   14  221-234   111-124 (126)
 10 d1q32a1 d.136.1.3 (A:79-293) T  16.3      24  0.0017   12.2   1.2   19  291-309    89-111 (215)

No 1  
>d1pt6a_ c.62.1.1 (A:) Integrin alpha1-beta1 {Human (Homo sapiens) [TaxId: 9606]}
Probab=65.79  E-value=3  Score=18.59  Aligned_cols=78  Identities=19%  Similarity=0.447  Sum_probs=46.7

Q ss_pred             CCEEEEEEEECCCCCHHHCCHHHHHHHHHHHHHHHHHCCCCCCEEEEEEEECCCCCCHH--------HHHHHHCCCCHH-
Q ss_conf             53068867634410011115788999999889887631357741899984148874302--------678762059032-
Q gi|254780135|r  302 HSKYMLMFAIGNQLSRSSVGKETIDRILQDCYYMHKHHRTGRGAITIFSVGFSPDQDTR--------YTLRQCASDPSK-  372 (408)
Q Consensus       302 hskymlmfaignqlsrssvgketidrilqdcyymhkhhrtgrgaitifsvgfspdqdtr--------ytlrqcasdpsk-  372 (408)
                      ..|.++++.=|..    .-+ ..+....+..-         .-.|++|.+|..+.-+..        -.|+..||+|+. 
T Consensus       103 ~~kviillTDG~~----~d~-~~~~~~a~~lk---------~~gi~v~~igvg~~~~~~~~~~~~~~~~L~~IAs~p~~~  168 (192)
T d1pt6a_         103 VKKVMVIVTDGES----HDN-HRLKKVIQDCE---------DENIQRFSIAILGSYNRGNLSTEKFVEEIKSIASEPTEK  168 (192)
T ss_dssp             CEEEEEEEESSCC----SCS-HHHHHHHHHHH---------HTTEEEEEEEECHHHHHTTCCCHHHHHHHHHHSCSSHHH
T ss_pred             CCEEEEEEECCCC----CCC-HHHHHHHHHHH---------HCCCEEEEEEEECCCCCCCCCCCCCHHHHHHHHCCCCCC
T ss_conf             6158999966887----763-02699999999---------779969999970555545434313699999986699855


Q ss_pred             -EEEECCCCCHHHHHHHHHHHH
Q ss_conf             -044258765344789877777
Q gi|254780135|r  373 -YYEINSDENVMPIAKSLARNV  393 (408)
Q Consensus       373 -yyeinsdenvmpiakslarnv  393 (408)
                       .|.+.+-+..-.+.+.+.+.+
T Consensus       169 ~~f~v~d~~~L~~i~~~i~~~I  190 (192)
T d1pt6a_         169 HFFNVSDELALVTIVKTLGERI  190 (192)
T ss_dssp             HEEEESSGGGGGGGHHHHHHHH
T ss_pred             CEEECCCHHHHHHHHHHHHHHH
T ss_conf             0898389999999999998885


No 2  
>d1mf7a_ c.62.1.1 (A:) Integrin alpha M (CR3, CD11b/CD18, Mac-1 alpha subunit) {Human (Homo sapiens) [TaxId: 9606]}
Probab=48.66  E-value=6.8  Score=16.07  Aligned_cols=79  Identities=16%  Similarity=0.361  Sum_probs=44.4

Q ss_pred             CCEEEEEEEECCCCCHHHCCHHHHHHHHHHHHHHHHHCCCCCCEEEEEEEECCCCC---CHHHHHHHHCCCCHH--EEEE
Q ss_conf             53068867634410011115788999999889887631357741899984148874---302678762059032--0442
Q gi|254780135|r  302 HSKYMLMFAIGNQLSRSSVGKETIDRILQDCYYMHKHHRTGRGAITIFSVGFSPDQ---DTRYTLRQCASDPSK--YYEI  376 (408)
Q Consensus       302 hskymlmfaignqlsrssvgketidrilqdcyymhkhhrtgrgaitifsvgfspdq---dtrytlrqcasdpsk--yyei  376 (408)
                      ..|.++++.=|....    +.+.+....+..      .+   -.|+||.||+...-   -....|+..||+|..  +|.+
T Consensus       106 ~~kvvvliTDG~~~~----~~~~~~~~~~~~------~~---~gv~i~~VGi~~~~~~~~~~~~L~~ias~~~~~~~~~~  172 (194)
T d1mf7a_         106 AFKILVVITDGEKFG----DPLGYEDVIPEA------DR---EGVIRYVIGVGDAFRSEKSRQELNTIASKPPRDHVFQV  172 (194)
T ss_dssp             SEEEEEEEESSCCBS----CSSCGGGTHHHH------HH---TTEEEEEEEESGGGCSHHHHHHHHHHSCSSHHHHEEEE
T ss_pred             CCEEEEEEECCCCCC----CCHHHHHHHHHH------HH---CCCEEEEEECCCCCCCCCCHHHHHHHHCCCCCCEEEEE
T ss_conf             735999982689899----805599999999------98---59905998057766652569999999659987719995


Q ss_pred             CCCCCHHHHHHHHHHHH
Q ss_conf             58765344789877777
Q gi|254780135|r  377 NSDENVMPIAKSLARNV  393 (408)
Q Consensus       377 nsdenvmpiakslarnv  393 (408)
                      ++-+..-++++.|...+
T Consensus       173 ~~~~~L~~~~~~l~~~i  189 (194)
T d1mf7a_         173 NNFEALKTIQNQLREKI  189 (194)
T ss_dssp             SSGGGGGGGHHHHHHHH
T ss_pred             CCHHHHHHHHHHHHHHH
T ss_conf             99999999999998876


No 3  
>d1n3ya_ c.62.1.1 (A:) Integrin alpha-x beta2 {Human (Homo sapiens) [TaxId: 9606]}
Probab=37.75  E-value=9.8  Score=14.94  Aligned_cols=79  Identities=16%  Similarity=0.316  Sum_probs=45.0

Q ss_pred             CCEEEEEEEECCCCCHHHCCHHHHHHHHHHHHHHHHHCCCCCCEEEEEEEECCCCCCHHH---HHHHHCCCCHH--EEEE
Q ss_conf             530688676344100111157889999998898876313577418999841488743026---78762059032--0442
Q gi|254780135|r  302 HSKYMLMFAIGNQLSRSSVGKETIDRILQDCYYMHKHHRTGRGAITIFSVGFSPDQDTRY---TLRQCASDPSK--YYEI  376 (408)
Q Consensus       302 hskymlmfaignqlsrssvgketidrilqdcyymhkhhrtgrgaitifsvgfspdqdtry---tlrqcasdpsk--yyei  376 (408)
                      ..|.++++.-|..-...    ..+..+.+.+      .   .-.+++|.||..++-+...   .|+..|+.|+.  .|..
T Consensus       103 ~~kvivllTDG~~~~~~----~~~~~~~~~~------~---~~gv~i~~Vgig~~~~~~~~~~~L~~ias~~~~~~~~~~  169 (189)
T d1n3ya_         103 AAKILIVITDGKKEGDS----LDYKDVIPMA------D---AAGIIRYAIGVGLAFQNRNSWKELNDIASKPSQEHIFKV  169 (189)
T ss_dssp             SEEEEEEEESSCCBSCS----SCHHHHHHHH------H---HTTCEEEEEEESGGGGSSTTHHHHHHHSCSSSGGGEEEE
T ss_pred             CCEEEEEEECCCCCCCC----CCHHHHHHHH------H---HCCCCEEEEECCCCCCCCCCHHHHHHHHCCCCCCEEEEE
T ss_conf             73279999568988883----2399999999------9---879943898336555663339999999669986608982


Q ss_pred             CCCCCHHHHHHHHHHHH
Q ss_conf             58765344789877777
Q gi|254780135|r  377 NSDENVMPIAKSLARNV  393 (408)
Q Consensus       377 nsdenvmpiakslarnv  393 (408)
                      ++-+..-.+...+...+
T Consensus       170 ~~~~~l~~i~~~i~~~i  186 (189)
T d1n3ya_         170 EDFDALKDIQNQLKEKI  186 (189)
T ss_dssp             SSGGGGGGGHHHHHHHH
T ss_pred             CCHHHHHHHHHHHHHHC
T ss_conf             89999999999999751


No 4  
>d1q0pa_ c.62.1.1 (A:) Complement factor B domain {Human (Homo sapiens) [TaxId: 9606]}
Probab=24.49  E-value=16  Score=13.43  Aligned_cols=81  Identities=16%  Similarity=0.272  Sum_probs=41.9

Q ss_pred             CEEEEEEEECCCCCHHHCCHHHHHHHHHHHHHHHHHC-CCCCCEEEEEEEECCCCCCHHHHHHHHCCCCH---HEEEECC
Q ss_conf             3068867634410011115788999999889887631-35774189998414887430267876205903---2044258
Q gi|254780135|r  303 SKYMLMFAIGNQLSRSSVGKETIDRILQDCYYMHKHH-RTGRGAITIFSVGFSPDQDTRYTLRQCASDPS---KYYEINS  378 (408)
Q Consensus       303 skymlmfaignqlsrssvgketidrilqdcyymhkhh-rtgrgaitifsvgfspdqdtrytlrqcasdps---kyyeins  378 (408)
                      .|.++.+.=|..-.- ....+..+.+. +-....+.- ......+.+|.+|+.++.|. -.|+..|+.|.   ++|.+++
T Consensus       114 ~kvvvl~TDG~~~~~-~~~~~~~~~~~-~~~~~~~~~~~~~~~gi~i~~vgvg~~~~~-~~L~~iAs~~~~~~~~f~~~~  190 (209)
T d1q0pa_         114 RHVIILMTDGLHNMG-GDPITVIDEIR-DLLYIGKDRKNPREDYLDVYVFGVGPLVNQ-VNINALASKKDNEQHVFKVKD  190 (209)
T ss_dssp             EEEEEEEECSCCCSS-SCTHHHHHHHH-HHTTCSCBTTBCCGGGEEEEEEECSSCCCH-HHHHHHSCCCTTCCCEEETTC
T ss_pred             CEEEEEECCCCCCCC-CCHHHHHHHHH-HHHHHHHHHHHHHHCCCCEEEECCCCCCCH-HHHHHHHCCCCCCEEEEEECC
T ss_conf             518999757876678-98589999999-854437899999866995598427766899-999999749899715999389


Q ss_pred             CCCHHHHH
Q ss_conf             76534478
Q gi|254780135|r  379 DENVMPIA  386 (408)
Q Consensus       379 denvmpia  386 (408)
                      -+....+.
T Consensus       191 ~~~L~~~~  198 (209)
T d1q0pa_         191 MENLEDVF  198 (209)
T ss_dssp             --------
T ss_pred             HHHHHHHH
T ss_conf             99999999


No 5  
>d1rq2a1 c.32.1.1 (A:8-205) Cell-division protein FtsZ {Mycobacterium tuberculosis [TaxId: 1773]}
Probab=22.57  E-value=16  Score=13.35  Aligned_cols=24  Identities=17%  Similarity=0.541  Sum_probs=18.2

Q ss_pred             HHHHHHHHHHCCCCEEEEEECCCC
Q ss_conf             355432232206664886300042
Q gi|254780135|r  153 ISRRKKVMYKQNIGLMIMPFAWDG  176 (408)
Q Consensus       153 isrrkkvmykqniglmimpfawdg  176 (408)
                      |++-.|-+..-.++...|||.|.|
T Consensus       107 iA~iake~g~l~v~ivt~PF~~EG  130 (198)
T d1rq2a1         107 VASIARKLGALTVGVVTRPFSFEG  130 (198)
T ss_dssp             HHHHHHHHTCEEEEEEEECCGGGC
T ss_pred             HHHHHHHCCCCEEEEEECCHHHHH
T ss_conf             999999859928999955817778


No 6  
>d1shux_ c.62.1.1 (X:) Capillary morphogenesis protein 2 domain {Human (Homo sapiens) [TaxId: 9606]}
Probab=20.08  E-value=19  Score=12.83  Aligned_cols=78  Identities=12%  Similarity=0.136  Sum_probs=42.9

Q ss_pred             CCCCEEEEEEEECCCCCHHHCCHHHHHHHHHHHHHHHHHCCCCCCEEEEEEEECCCCCCHHHHHHHHCCCCHHEEEECCC
Q ss_conf             66530688676344100111157889999998898876313577418999841488743026787620590320442587
Q gi|254780135|r  300 ASHSKYMLMFAIGNQLSRSSVGKETIDRILQDCYYMHKHHRTGRGAITIFSVGFSPDQDTRYTLRQCASDPSKYYEINSD  379 (408)
Q Consensus       300 ashskymlmfaignqlsrssvgketidrilqdcyymhkhhrtgrgaitifsvgfspdqdtrytlrqcasdpskyyeinsd  379 (408)
                      ....+.++++.-|..-+.   ..+.+.+..+.   ..     ..| +.+|.||+.+.  .+-.|++.|++|...|...++
T Consensus       100 ~~~~~~ivliTDG~~~~~---~~~~~~~~~~~---~k-----~~g-v~v~~vgig~~--~~~~L~~ia~~~~~~~~~~~~  165 (181)
T d1shux_         100 LKTSSIIIALTDGKLDGL---VPSYAEKEAKI---SR-----SLG-ASVYCVGVLDF--EQAQLERIADSKEQVFPVKGG  165 (181)
T ss_dssp             GGSCEEEEEEECCCCCTT---HHHHHHHHHHH---HH-----HTT-CEEEEEECSSC--CHHHHHHHSSSGGGEEESSST
T ss_pred             CCCCEEEEEECCCCCCCC---CCHHHHHHHHH---HH-----HCC-CEEEEEEECCC--CHHHHHHHHCCCCCEEEECCC
T ss_conf             787528999247877888---63899999999---99-----789-88999996854--899999984899965994599


Q ss_pred             CC-HHHHHHHHHH
Q ss_conf             65-3447898777
Q gi|254780135|r  380 EN-VMPIAKSLAR  391 (408)
Q Consensus       380 en-vmpiakslar  391 (408)
                      -+ +-.+.+.+++
T Consensus       166 ~~~L~~~~~~i~~  178 (181)
T d1shux_         166 FQALKGIINSILA  178 (181)
T ss_dssp             THHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHH
T ss_conf             9999999999986


No 7  
>d1v7pc_ c.62.1.1 (C:) Integrin alpha2-beta1 {Human (Homo sapiens) [TaxId: 9606]}
Probab=19.75  E-value=20  Score=12.78  Aligned_cols=49  Identities=16%  Similarity=0.341  Sum_probs=30.4

Q ss_pred             EEEEEEEECCCCCCH--------HHHHHHHCCCCHH-E-EEECCCCCHHHHHHHHHHHH
Q ss_conf             189998414887430--------2678762059032-0-44258765344789877777
Q gi|254780135|r  345 AITIFSVGFSPDQDT--------RYTLRQCASDPSK-Y-YEINSDENVMPIAKSLARNV  393 (408)
Q Consensus       345 aitifsvgfspdqdt--------rytlrqcasdpsk-y-yeinsdenvmpiakslarnv  393 (408)
                      .|++|++|..+.-++        .-.|++.||+|.. | +.+.+-.....+...|...+
T Consensus       132 gv~v~~Igvg~~~~~~~~~~~~~~~~L~~Ias~p~~~~~f~v~d~~~L~~i~~~l~~~I  190 (193)
T d1v7pc_         132 NILRFGIAVLGYLNRNALDTKNLIKEIKAIASIPTERYFFNVSDEAALLEKAGTLGEQI  190 (193)
T ss_dssp             TEEEEEEEECHHHHHTTCCCHHHHHHHHHHSCSSHHHHEEEESSSGGGHHHHHHHHHHH
T ss_pred             CCEEEEEEECCCCCCCCCCCCCCHHHHHHHHCCCCCCEEEECCCHHHHHHHHHHHHHHC
T ss_conf             98999999677544444444125999999866987101898189999999999998651


No 8  
>d1v9va1 a.29.10.1 (A:8-108) Microtubule-associated serine/threonine-protein kinase 3, MAST3 (KIAA0561) {Human (Homo sapiens) [TaxId: 9606]}
Probab=18.07  E-value=21  Score=12.53  Aligned_cols=38  Identities=34%  Similarity=0.404  Sum_probs=25.9

Q ss_pred             HHHHHHHHHHHHHCCCCCHHHHHHHCCHHHHHHHHH-HHH
Q ss_conf             888999987764106843236677412235789999-987
Q gi|254780135|r   50 TALLQEVLDHVIYRTSPKNLYDLREAGRDNFIRHQI-EKA   88 (408)
Q Consensus        50 tallqevldhviyrtspknlydlreagrdnfirhqi-eka   88 (408)
                      |+-..|-|.+.|-.-+|.+...+. .|--+|+.||| |-|
T Consensus         4 t~QMEerL~~fi~~~~~~~~~~~a-Dgvl~FvhHQiiElA   42 (101)
T d1v9va1           4 TAQMEGRLQEFLTAYAPGARLALA-DGVLGFIHHQIVELA   42 (101)
T ss_dssp             THHHHHHHHHHHHHSCBTTTBCCS-CHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHCCCCCCCCHH-HHHHHHHHHHHHHHH
T ss_conf             789999999999876972444114-899999999999999


No 9  
>d1ozja_ d.164.1.1 (A:) SMAD MH1 domain {Human (Homo sapiens) [TaxId: 9606]}
Probab=16.99  E-value=21  Score=12.61  Aligned_cols=14  Identities=36%  Similarity=1.089  Sum_probs=10.6

Q ss_pred             CCCEECCCCCCCEE
Q ss_conf             43200273100003
Q gi|254780135|r  221 YKNFCMAPYHYKSI  234 (408)
Q Consensus       221 yknfcmapyhyksi  234 (408)
                      +...|.-||||.-|
T Consensus       111 ~~~VC~NPyHy~Rv  124 (126)
T d1ozja_         111 KDEVCVNPYHYQRV  124 (126)
T ss_dssp             CSEEECCGGGEEEC
T ss_pred             CCCEEECCCCHHHC
T ss_conf             98378587236440


No 10 
>d1q32a1 d.136.1.3 (A:79-293) Tyrosyl-DNA phosphodiesterase TDP1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
Probab=16.27  E-value=24  Score=12.24  Aligned_cols=19  Identities=16%  Similarity=0.251  Sum_probs=0.0

Q ss_pred             CCCCCCC----CCCCCCEEEEEE
Q ss_conf             3674354----676653068867
Q gi|254780135|r  291 NTNHCFP----HGASHSKYMLMF  309 (408)
Q Consensus       291 ntnhcfp----hgashskymlmf  309 (408)
                      |-..|+|    -|.-|||.|+.|
T Consensus        89 nv~~~~~~mp~fGtHHSKmmiL~  111 (215)
T d1q32a1          89 KVKLIEITMPPFASHHTKLIINF  111 (215)
T ss_dssp             TEEEEEECCCTTCCBCCCEEEEE
T ss_pred             CEEEEECCCCCCCCCCCEEEEEE
T ss_conf             61799436898665531368999


Done!