RPS-BLAST 2.2.22 [Sep-27-2009]

Database: mmdb70 
           33,805 sequences; 4,956,049 total letters

Searching..................................................done

Query= gi|254780135|ref|YP_003064548.1| hypothetical protein
CLIBASIA_00070 [Candidatus Liberibacter asiaticus str. psy62]
         (408 letters)



>2ww8_A RRGA, cell WALL surface anchor family protein; IGG, pilus,
           CNA_B, adhesin, integrin, cell adhesion; HET: EPE; 1.90A
           {Streptococcus pneumoniae}
           (A:221-279,A:318-447,A:506-585)
          Length = 269

 Score = 36.4 bits (83), Expect = 0.006
 Identities = 13/99 (13%), Positives = 28/99 (28%), Gaps = 15/99 (15%)

Query: 302 HSKYMLMFAIGNQLSRSSVGKETIDRILQDCYYMHKHHRTGRGAITIFSVGFSPDQDT-- 359
             ++ ++   G   S ++      D                     +F+VG   + D   
Sbjct: 177 SGEHTIVRGDGQSNSNTAKITNHGDPTRWYYN-----GNIAPDGYDVFTVGIGINGDPGT 231

Query: 360 -----RYTLRQCASDPSKYYEINSDENVMPIAKSLARNV 393
                   ++  +S P  Y  +    +   I + L R  
Sbjct: 232 DEATATSFMQSISSKPENYTNV---TDTTKILEQLNRYF 267


>3gt5_A N-acylglucosamine 2-epimerase; structural genomics,
           isomerase, PSI-2, protein structure initiative; 1.70A
           {Xylella fastidiosa M23} (A:25-245)
          Length = 221

 Score = 34.5 bits (78), Expect = 0.026
 Identities = 17/177 (9%), Positives = 44/177 (24%), Gaps = 7/177 (3%)

Query: 229 YHYKSIFYWAFENFQYHQDNNMLIFYSHRDFYRITWDHFPYSFIKNVFDMTSNQFGD--- 285
           +HY       +     H  ++    +++   Y           + +      +   +   
Sbjct: 10  FHYFRDDGSIYNATHRHLVSSTRFVFNYAMAYLQFGTAEYLDAVHHGLSYVRDVHRNPAT 69

Query: 286 GQVLTNTNHCFPHGASHSKYMLMFAIGNQLSRSSVGKETIDRILQDCYYMHKHH----RT 341
           G              ++  Y L F +        VG +     + + + + + H      
Sbjct: 70  GGYAWTLCDDRVEDDTNHCYGLAFVMLAYSCGLKVGIKQAREWMDETWCLLERHFWDAEY 129

Query: 342 GRGAITIFSVGFSPDQDTRYTLRQCASDPSKYYEINSDENVMPIAKSLARNVITNWF 398
           G       +         +             YE + ++  +  A  LA  +     
Sbjct: 130 GLYKDEADAQWNFTRYRGQNANMHMCEAMLAAYEASGEQRYLERALVLADRITRRQA 186


>1q1q_A SULT2B1A, sulfotransferase family, cytosolic, 2B, member 1
           isoform A; pregnenolone, PAP; HET: A3P NHE; 2.91A {Homo
           sapiens} (A:43-350)
          Length = 308

 Score = 31.0 bits (68), Expect = 0.28
 Identities = 16/193 (8%), Positives = 35/193 (18%), Gaps = 8/193 (4%)

Query: 170 MPFAWDGYWLASRGKVADSQVHRPKYLEYSHYYQQYLNRNTLVKNFLSQIPYKNFCMAPY 229
           +P         S           P+ +  S  Y        L          ++F     
Sbjct: 69  LPIQIFTKAFFSSKAKVIYMGRNPRDVVVS-LYHYSKIAGQLKDPGTPDQFLRDFLKGEV 127

Query: 230 HYKSIFYWAFENFQYHQDNNMLIFYSHRDFYRITWDHFPYSFIKNVFDMTSNQFGDGQVL 289
            + S F       +    +N L                    ++ +        G   + 
Sbjct: 128 QFGSWFDHIKGWLRMKGKDNFLFITYEE------LQQDLQGSVERICGFLGRPLGKEALG 181

Query: 290 TNTNHC-FPHGASHSKYMLMFAIGNQLSRSSVGKETIDRILQDCYYMHKHHRTGRGAITI 348
           +   H  F    +++         + L                  +              
Sbjct: 182 SVVAHSTFSAMKANTMSNYTLLPPSLLDHRRGAFLRKGVCGDWKNHFTVAQSEAFDRAYR 241

Query: 349 FSVGFSPDQDTRY 361
             +   P      
Sbjct: 242 KQMRGMPTFPWDE 254


>1u0j_A DNA replication protein; AAA+ protein, P-loop atpases,
           helicase; HET: DNA ADP; 2.10A {Adeno-associated virus -
           2} (A:64-267)
          Length = 204

 Score = 29.7 bits (66), Expect = 0.64
 Identities = 10/110 (9%), Positives = 23/110 (20%), Gaps = 15/110 (13%)

Query: 140 LLQMFSQSKGKVDISRRKKVMYKQNIGLMIMPFAWDGYWLASRGKVADSQVHRPKYLEYS 199
              +   SK +VD   +          ++            +       Q          
Sbjct: 104 AKAILGGSKVRVDQKCKSSAQIDPTPVIVTSNTNMCAVIDGNSTTFEHQQ---------- 153

Query: 200 HYYQQYLNRNTLVKNFLSQIPYKNFCMAPYHYKSIFYWAFENFQYHQDNN 249
                 L           ++ +    +     K  F WA ++    +   
Sbjct: 154 -----PLQDRMFKFELTRRLDHDFGKVTKQEVKDFFRWAKDHVVEVEHEF 198


>3hrz_D Complement factor B; serine protease, glycosilated,
           multi-domain, complement system, convertase, complement
           alternate pathway, complement pathway; HET: NAG P6G;
           2.20A {Homo sapiens} PDB: 3hs0_D* 2ok5_A* (D:199-457)
          Length = 259

 Score = 29.5 bits (65), Expect = 0.71
 Identities = 14/168 (8%), Positives = 38/168 (22%), Gaps = 10/168 (5%)

Query: 231 YKSIFYWAFENFQYHQDNNMLIFYSHRDFYRITWDHFPYSFIKNVFDMTSNQFGDGQVLT 290
           Y +      +  +    N   +     +           +  K       +         
Sbjct: 91  YATYPKIWVKVSEADSSNADWVTKQLNEINYEDHKLKSGTNTKKALQAVYSMMSWPD--- 147

Query: 291 NTNHCFPHGASHSKYMLMFAIGNQLSRSSVGKETIDRILQDCYYMHKHHRTGRGAITIFS 350
           +      +   H   ++        +        ID I    Y            + ++ 
Sbjct: 148 DVPPEGWNRTRHVIILMT---DGLHNMGGDPITVIDEIRDLLYIGKDRKNPREDYLDVYV 204

Query: 351 VGFSPDQDTRYTLRQCASDP---SKYYEINSDENVMPIAKSLARNVIT 395
            G  P  +    +   AS        +++   EN+  +   +     +
Sbjct: 205 FGVGPLVNQV-NINALASKKDNEQHVFKVKDMENLEDVFYQMIDESQS 251


>3c8u_A Fructokinase; YP_612366.1, putative fructose transport
           system kinase, structural genomics, joint center for
           structural genomics, JCSG; 1.95A {Silicibacter SP}
           (A:1-61,A:124-208)
          Length = 146

 Score = 28.6 bits (64), Expect = 1.5
 Identities = 13/67 (19%), Positives = 22/67 (32%), Gaps = 1/67 (1%)

Query: 50  TALLQEVLDHVIYRTSPKNLYDLREAGRDNFIRHQIEKALNTYNSRDLSNIGSIESIVKD 109
              L  + D  I    P    + R   R        + A+      DL+N  +IE+    
Sbjct: 79  WRDLTAIWDVSIRLEVPXADLEARLVQRWLDHGLNHDAAVARAQGNDLANARAIEAARLP 138

Query: 110 A-VILTK 115
           A +   +
Sbjct: 139 ADLTWPQ 145


>2cr4_A 3BP-2, SH3 domain-binding protein 2; structural genomics,
           NPPSFA, national project on protein structural and
           functional analyses; NMR {Homo sapiens} (A:)
          Length = 126

 Score = 28.6 bits (63), Expect = 1.5
 Identities = 12/79 (15%), Positives = 22/79 (27%)

Query: 190 VHRPKYLEYSHYYQQYLNRNTLVKNFLSQIPYKNFCMAPYHYKSIFYWAFENFQYHQDNN 249
           V  P  +  +      + R     +   +     +C+     KS       +   ++  N
Sbjct: 13  VPLPNSVFVNTTESCEVERLFKATSPRGEPQDGLYCIRNSSTKSGKVLVVWDETSNKVRN 72

Query: 250 MLIFYSHRDFYRITWDHFP 268
             IF     FY      F 
Sbjct: 73  YRIFEKDSKFYLEGEVLFV 91


>2c5u_A RNA ligase, T4 RNA ligase 1; nucleotidyl transferase,
           ATP-binding; HET: APC; 2.21A {Bacteriophage T4}
           (A:102-199)
          Length = 98

 Score = 28.5 bits (64), Expect = 1.6
 Identities = 5/44 (11%), Positives = 15/44 (34%), Gaps = 1/44 (2%)

Query: 166 GLMIMPFAWDGYW-LASRGKVADSQVHRPKYLEYSHYYQQYLNR 208
           G ++  +         S+G +   Q      +  +  + +  +R
Sbjct: 2   GSLVSTYLDGDEILFKSKGSIKSEQALXANGILXNINHHRLRDR 45


>3bo7_A Peptidyl-prolyl CIS-trans isomerase, cyclophilin- type;
           large cyclophilin, structural genomics, isomerase,
           structural genomics consortium, SGC; HET: BMT; 2.35A
           {Toxoplasma gondii} (A:)
          Length = 201

 Score = 28.0 bits (61), Expect = 2.2
 Identities = 11/122 (9%), Positives = 27/122 (22%), Gaps = 8/122 (6%)

Query: 212 VKNFLSQIPYKNFCMAPYHYKSIFYWAFENFQYHQDNNMLIFYSHRDFYRITWDHFPYSF 271
             +FL     K F    +H     +         +  +              +       
Sbjct: 31  CDSFLRLCAVKYFDDTIFHRCIRNFMIQGGRAELRQPSKKKEVQQSPRSISGFPGGAPFE 90

Query: 272 IKNVFDMTSNQFG-----DGQVLTNTNHCFPHGASHSKYMLMFAIGNQLSRSSVGKETID 326
            +    +     G     +    +N +  F    S         I  ++     G + + 
Sbjct: 91  DEFDNRLVHQGIGVLSMANDGKHSNLSEFFITFKSCEHLNNKHTIFGRVVG---GLDVLR 147

Query: 327 RI 328
           + 
Sbjct: 148 QW 149


>3kp1_E D-ornithine aminomutase S component; 5 aminomutase (OAM);
          HET: PLP B12 5AD; 2.01A {Clostridium sticklandii} PDB:
          3kow_E* 3koy_E* 3koz_E* 3kp0_E* 3kox_E* (E:46-121)
          Length = 76

 Score = 27.5 bits (61), Expect = 3.0
 Identities = 12/43 (27%), Positives = 22/43 (51%), Gaps = 7/43 (16%)

Query: 35 AIVDVVVDQVTVMQKTALLQEVLDHVIYRTSPKNLYDLREAGR 77
          AIVD  +D+        L+ +   H++Y+ + +    +REAG 
Sbjct: 21 AIVDKTMDR-------GLMGKGAGHIVYKIAKEKNISVREAGL 56


>3k44_A Purine-rich binding protein-alpha, isoform B; PUR-alpha, PUR
           repeat, PUR domain, whirly fold, DNA binding protein,
           RNA binding protein; 2.10A {Drosophila melanogaster}
           (A:)
          Length = 146

 Score = 27.5 bits (61), Expect = 3.4
 Identities = 17/99 (17%), Positives = 33/99 (33%), Gaps = 22/99 (22%)

Query: 3   QNKNFLLGVLRLKKCTRGVFLVIT-----------AILLSSFVAIVDVVVDQVTVMQKTA 51
           Q+K F L    +K+  RG F+ +             + LS+     D +           
Sbjct: 13  QSKRFYL---DVKQNRRGRFIKVAEIGADGRRSQIYLALSTAAEFRDHLSSFSDYYASLG 69

Query: 52  LL--------QEVLDHVIYRTSPKNLYDLREAGRDNFIR 82
                      ++   ++ +   +   DL+E  R  F+R
Sbjct: 70  PPNTDNLPEDGKLKSEMMIKDYRRYYLDLKENARGRFLR 108


>1moe_A Anti-CEA MAB T84.66; anti carcinoembryonic antigen, diabody,
           dimer, SCFV, variable domain, immune system; 2.60A {Mus
           musculus} (A:1-115)
          Length = 115

 Score = 27.1 bits (59), Expect = 3.9
 Identities = 9/84 (10%), Positives = 22/84 (26%), Gaps = 7/84 (8%)

Query: 188 SQVHRPKYLEYSHYYQQYLNRNTLVKNFLSQIPYKNFCMAPYHYKSIFYWAFENFQYHQD 247
            +      + + H+YQQ   +          + Y+   +                     
Sbjct: 26  GESVDIFGVGFLHWYQQKPGQ------PPKLLIYRASNLESGIPVRFSGTGSRTDFTLII 79

Query: 248 NNMLIFYSHRDFYRITWDHFPYSF 271
           + +        +Y    +  PY+F
Sbjct: 80  DPVEADDV-ATYYCQQTNEDPYTF 102


>1ibj_A CBL, cystathionine beta-lyase; PLP-dependent enzyme,
           methionine biosynthesis, transsulfuration; HET: PLP;
           2.30A {Arabidopsis thaliana} (A:327-464)
          Length = 138

 Score = 27.3 bits (60), Expect = 4.0
 Identities = 14/129 (10%), Positives = 32/129 (24%), Gaps = 14/129 (10%)

Query: 207 NRNTL-VKNFLSQIPYKNFCMAPYHYKSIFYWAFENFQYHQDNNMLIFYSHRDFY---RI 262
             N   +  +LS  P               +         +    +  +          +
Sbjct: 10  QENARKIAMYLSSHPRVKKVYYAGLPDHPGHHLHF--SQAKGAGSVFSFITGSVALSKHL 67

Query: 263 TWDHFPYSFIKNVFDMTSNQFGDGQVLTNTNHCFPHGASHSKYMLMFAIGNQLSRSSVGK 322
                 +S   +   + S          +      H +  ++      +   L R S G 
Sbjct: 68  VETTKYFSIAVSFGSVKSL--------ISMPCFMSHASIPAEVREARGLTEDLVRISAGI 119

Query: 323 ETIDRILQD 331
           E +D ++ D
Sbjct: 120 EDVDDLISD 128


>3e6u_A LANC-like protein 1; alpha barrel, cytoplasm, signaling
           protein; 2.60A {Homo sapiens} PDB: 3e73_A* (A:221-379)
          Length = 159

 Score = 26.6 bits (58), Expect = 5.2
 Identities = 6/74 (8%), Positives = 18/74 (24%), Gaps = 5/74 (6%)

Query: 235 FYWAFENFQYHQDNNMLIFYSHRDFYRITWDHFPYSFIKNVFDMTSNQFGDGQVLTNTNH 294
                +   +       + Y     Y++  +           D+               +
Sbjct: 57  IGDNRDLLVHWCHGAPGVIYMLIQAYKVFREEKYLCDAYQCADVIWQYGLLK-----KGY 111

Query: 295 CFPHGASHSKYMLM 308
              HG++ + Y  +
Sbjct: 112 GLCHGSAGNAYAFL 125


>3cgb_A Pyridine nucleotide-disulfide oxidoreductase, class I;
           coenzyme A, flavin adenine dinucleotide,
           selenomethionine, FAD, flavoprotein; HET: COA FAD; 1.90A
           {Bacillus anthracis str} PDB: 3cgc_A* 3cgd_A* 3cge_A*
           (A:357-480)
          Length = 124

 Score = 26.9 bits (59), Expect = 5.3
 Identities = 9/97 (9%), Positives = 22/97 (22%), Gaps = 17/97 (17%)

Query: 245 HQDNNMLIFYSHRDFYRITWDHFPYSFIKNVFDMTSNQFGDGQVLTNTNHCFPHGASHSK 304
                              + +    ++K ++   + Q   GQ           G     
Sbjct: 29  GLHIPYKTVKVDSTNXAGYYPNAKPLYLKLLYRSDTKQLLGGQ------VIGEEGVDKRI 82

Query: 305 YMLMFAIGNQLSRSSVGKETIDRILQDCYYMHKHHRT 341
            ++  A+ N        K +I  +         +   
Sbjct: 83  DVIAXALFN--------KXSIHDLED---VDLSYAPP 108


>3fvv_A Uncharacterized protein; unknown function, structural
           genomics, PSI,MCSG, protein structure initiative; 2.10A
           {Bordetella pertussis} (A:16-70)
          Length = 55

 Score = 26.6 bits (59), Expect = 5.7
 Identities = 9/57 (15%), Positives = 18/57 (31%), Gaps = 10/57 (17%)

Query: 172 FAWDGYWLASRGKVADSQVHRPKYLEYSHYYQQYLNRNTLVKNFLSQIPYKNFCMAP 228
           + W   +LA  G+  D    R +  +     ++Y          L+      F +  
Sbjct: 7   YQW-ADFLARTGRAGDPAEARRRNDD---LMERYNRGE------LTAEQAAEFMLGL 53


>2qc0_A Uncharacterized protein; NP_719793.1, uncharacterized
           protein, structural genomics, joint center for
           structural genomics, JCSG; HET: MSE; 1.60A {Shewanella
           oneidensis} PDB: 3eqx_A* (A:)
          Length = 373

 Score = 26.2 bits (56), Expect = 7.0
 Identities = 15/140 (10%), Positives = 33/140 (23%), Gaps = 3/140 (2%)

Query: 211 LVKNFLSQIPYKNFCMAPYHYKSIFYWAFENFQYHQDNNMLIFYSHRDFYRITWDHFPYS 270
           L+   L   P          +K  +Y    N    Q+    I +      +         
Sbjct: 217 LIDQQLLSAPILYLSRYIVAHKQDYYRLLLNVTTQQEWQPWIIFILNAVEQTAKWTTHKI 276

Query: 271 FIKNVFDMTSNQFGDGQVLTNTNHCFPHGASHSKYMLMFAIGNQLSRSSVGKETIDRILQ 330
                    + ++   Q+    +H          Y  +  +          ++T    L+
Sbjct: 277 AAARELIAHTTEYVRQQLPKIYSHELVQVIFEQPYCRIQNLVESGLAK---RQTASVYLK 333

Query: 331 DCYYMHKHHRTGRGAITIFS 350
               +        G   +F 
Sbjct: 334 QLCDIGVLEEVQSGKEKLFV 353


>1gxs_A HNL, hydroxynitrIle lyase; inhibitor complex, cyanogenesis
           mechanism; HET: NAG FUL FUC DKA; 2.3A {Sorghum bicolor}
           (A:1-190)
          Length = 190

 Score = 26.3 bits (57), Expect = 7.6
 Identities = 6/62 (9%), Positives = 19/62 (30%), Gaps = 6/62 (9%)

Query: 228 PYHYKSIFYWAFENFQYHQDNNMLIFYSHRD------FYRITWDHFPYSFIKNVFDMTSN 281
             + ++++YW  E          L+ + +              +   +    N   +  N
Sbjct: 33  DNNGRALYYWFQEADTADPAAAPLVLWLNGGPGCSSIGLGAMQELGAFRVHTNGESLLLN 92

Query: 282 QF 283
           ++
Sbjct: 93  EY 94


  Database: mmdb70
    Posted date:  Jun 20, 2010  3:12 AM
  Number of letters in database: 4,956,049
  Number of sequences in database:  33,805
  
Lambda     K      H
   0.324    0.136    0.411 

Gapped
Lambda     K      H
   0.267   0.0382    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 33805
Number of Hits to DB: 3,104,989
Number of extensions: 140197
Number of successful extensions: 540
Number of sequences better than 10.0: 1
Number of HSP's gapped: 539
Number of HSP's successfully gapped: 54
Length of query: 408
Length of database: 4,956,049
Length adjustment: 91
Effective length of query: 317
Effective length of database: 1,879,794
Effective search space: 595894698
Effective search space used: 595894698
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 56 (26.3 bits)