HHsearch alignment for GI: 254780137 and conserved domain: PRK05086

>PRK05086 malate dehydrogenase; Provisional.
Probab=90.26  E-value=1.4  Score=23.10  Aligned_cols=103  Identities=24%  Similarity=0.291  Sum_probs=61.2

Q ss_pred             CEEEEECC-CHHHHHHHHHHHHCCCCCCCEEEEECCCEEECCCCCCCCHHHHHHHHC-C--CCCCHHHHCCCCCEEEECC
Q ss_conf             11787425-425678999999819885758999559603078733266788977450-8--8988888605883786257
Q gi|254780137|r  203 IKIVTLGA-GAAALACLNLLVTMGVRRENIWVYDLEGLVYEGREKKFDKWKSVYAQK-S--GPKPLSETMNNADVFLGLS  278 (779)
Q Consensus       203 ~~iv~~Ga-GaAg~~~a~ll~~~g~~~~~i~~~D~~Gli~~~r~~~~~~~~~~~a~~-~--~~~~l~ea~~~adv~iG~S  278 (779)
T Consensus         1 mKV~IiGA~G~VG~s~A~~l~~~~~~~~el~L~Di~~-~~~G~alDL~h--~~~~~~~~~~~~~~~~~~l~~adiVvitA   77 (312)
T PRK05086          1 MKVAVLGAAGGIGQALALLLKTQLPAGSELSLYDIAP-VTPGVAVDLSH--IPTAVKIKGFSGEDPTPALEGADVVLISA   77 (312)
T ss_pred             CEEEEECCCCHHHHHHHHHHHHCCCCCCEEEEECCCC-CCCCHHHHHHC--CCCCCCCCEEECCCHHHHHCCCCEEEECC
T ss_conf             9899998998699999999982898777499975888-86105656547--87546653461698678717999999878


Q ss_pred             C----CCCCC-H-----------HHHHHC---CCCCEEEEECCCCCCCCH
Q ss_conf             8----87789-8-----------899721---899779991787200998
Q gi|254780137|r  279 V----AGALD-P-----------AILKFM---AEKPLIMVLANPNPEAMP  309 (779)
Q Consensus       279 ~----~g~~t-~-----------e~v~~M---~~~PiIfaLsNP~pEi~p  309 (779)
T Consensus        78 G~~rkpG~-tR~dLl~~Na~I~~~i~~~I~~~~p~aiiivvsNPvD~mt~  126 (312)
T PRK05086         78 GVARKPGM-DRSDLFNVNAGIVKNLVEKVAKTCPKACIGIITNPVNTTVA  126 (312)
T ss_pred             CCCCCCCC-CHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCCHHHHHH
T ss_conf             98998589-88999998789999999988720897189995483277899