>cd07041 STAS_RsbR_RsbS_like Sulphate Transporter and Anti-Sigma factor antagonist domain of the "stressosome" complex proteins RsbS and RsbR, regulators of the bacterial stress activated alternative sigma factor sigma-B by phosphorylation. The STAS (Sulphate Transporter and Anti-Sigma factor antagonist) domain of proteins related to RsbS and RsbR which are part of the "stressosome" complex that plays an important role in the regulation of the bacterial stress activated alternative sigma factor sigma-B. During stress conditions RsbS and RsbR are phosphorylated which leads to the release of RsbT, an activator of of the RsbU phosphatase, which in turn activates RsbV which leads to the release and activation of sigma factor B. RsbS is a single domain protein (STAS domain), while RsbR-like proteins have a well-conserved C-terminal STATS domain and a variable N-terminal domain. The STAS domain is also found in the C- terminal region of sulphate transporters and anti-anti-sigma factors.

Probab=96.69 E-value=0.011 Score=37.39 Aligned_cols=82 Identities=17% Similarity=0.384 Sum_probs=69.0 Q ss_pred CCEEEEEEECCCCHHHHHHHHHHHHHHHHHCCCCCEEEEEECCCHHHHHHHHHHHHHHHH---HCCCCCCCCCCCHHHHH Q ss_conf 882799984035635522007999986431167880899701051521299999999997---51876431589912699 Q gi|254780138|r 4 NGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFME---KYHGKIKLQGVSTHIEQ 80 (373) Q Consensus 4 dG~~vL~LsGdWTl~~l~~l~~~l~~~L~~~~~~~~i~iDls~i~~lDTAGA~lL~~l~~---~~~~~~~~~~l~~~~~~ 80 (373) T Consensus 9 ~~vlvlPliG~ld~~r~~~l~e~ll~~i~~~-~~~~viiDlsGv~~iD~~~~~~L~~l~~~~~LlG~~~il~Gi~P~vA~ 87 (109) T cd07041 9 DGVLVLPLIGDLDDERAEQLQERLLEAISRR-RARGVIIDLTGVPVIDSAVARHLLRLARALRLLGARTILTGIRPEVAQ 87 (109) T ss_pred CCEEEEEEEEEECHHHHHHHHHHHHHHHHHC-CCCEEEEECCCCCCCCHHHHHHHHHHHHHHHHCCCEEEEEECCHHHHH T ss_conf 9889998689885999999999999999972-988999974588637789999999999999963986999943999999 Q ss_pred HHHHHH Q ss_conf 999886 Q gi|254780138|r 81 LFSLIS 86 (373) Q Consensus 81 Ll~Ll~ 86 (373) T Consensus 88 ~lv~~g 93 (109) T cd07041 88 TLVELG 93 (109) T ss_pred HHHHHC T ss_conf 999929

HHsearch alignment for GI: 254780138 and conserved domain: cd07041