RPS-BLAST 2.2.22 [Sep-27-2009] Database: scop70_1_75 13,730 sequences; 2,407,596 total letters Searching..................................................done Query= gi|254780138|ref|YP_003064551.1| ABC transporter [Candidatus Liberibacter asiaticus str. psy62] (373 letters) >d1edga_ c.1.8.3 (A:) Endoglucanase CelA {Clostridium cellulolyticum [TaxId: 1521]} Length = 380 Score = 28.0 bits (61), Expect = 1.5 Identities = 10/30 (33%), Positives = 16/30 (53%), Gaps = 1/30 (3%) Query: 233 GSMKINEE-IDAIRTMGLDFVRILISPRIW 261 +K ++ IDAI+ G + VRI +S Sbjct: 58 SGIKTTKQMIDAIKQKGFNTVRIPVSWHPH 87 >d1vjza_ c.1.8.3 (A:) Endoglucanase homologue TM1752 {Thermotoga maritima [TaxId: 2336]} Length = 325 Score = 27.8 bits (60), Expect = 1.7 Identities = 6/23 (26%), Positives = 11/23 (47%) Query: 239 EEIDAIRTMGLDFVRILISPRIW 261 E+ + +FVRI + +W Sbjct: 24 EDFLWMAQWDFNFVRIPMCHLLW 46 >d1kwga2 c.1.8.1 (A:1-393) A4 beta-galactosidase {Thermus thermophilus [TaxId: 274]} Length = 393 Score = 27.7 bits (60), Expect = 1.7 Identities = 10/26 (38%), Positives = 13/26 (50%), Gaps = 2/26 (7%) Query: 239 EEIDAIRTMGLDFVRILISPRIWALI 264 E+ +R GL VRI WAL+ Sbjct: 18 EDARRMREAGLSHVRIGEFA--WALL 41 >d2ooja1 b.159.2.1 (A:2-134) Hypothetical protein SO1590 {Shewanella oneidensis [TaxId: 70863]} Length = 133 Score = 27.1 bits (60), Expect = 2.6 Identities = 11/36 (30%), Positives = 15/36 (41%) Query: 159 QMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFG 194 V G + I V G + +QG+F L FG Sbjct: 50 LSAMTAVKGSAGYVAIEQVVGKLCGRQGSFVLQHFG 85 >d1ceoa_ c.1.8.3 (A:) Endoglucanase CelC {Clostridium thermocellum [TaxId: 1515]} Length = 340 Score = 26.9 bits (58), Expect = 2.7 Identities = 9/26 (34%), Positives = 12/26 (46%), Gaps = 1/26 (3%) Query: 237 INEE-IDAIRTMGLDFVRILISPRIW 261 I E+ I+ I G D VR+ I Sbjct: 29 ITEKDIETIAEAGFDHVRLPFDYPII 54 >d1i5ga_ c.47.1.10 (A:) Tryparedoxin II {Crithidia fasciculata [TaxId: 5656]} Length = 144 Score = 26.3 bits (57), Expect = 4.2 Identities = 7/36 (19%), Positives = 16/36 (44%), Gaps = 1/36 (2%) Query: 164 GVSGVPVVILISFVTGAVIAQQGAFQLSQ-FGAEIF 198 V +P ++ + +G +I Q + + A+ F Sbjct: 105 DVKSIPTLVGVEADSGNIITTQARTMVVKDPEAKDF 140 >d1o8xa_ c.47.1.10 (A:) Tryparedoxin I {Crithidia fasciculata [TaxId: 5656]} Length = 144 Score = 25.8 bits (55), Expect = 5.5 Identities = 8/36 (22%), Positives = 15/36 (41%), Gaps = 1/36 (2%) Query: 164 GVSGVPVVILISFVTGAVIAQQGAFQLSQ-FGAEIF 198 V +P +I + +G V+ + L + E F Sbjct: 103 NVESIPTLIGVDADSGDVVTTRARATLVKDPEGEQF 138 Database: scop70_1_75 Posted date: Mar 27, 2010 6:21 PM Number of letters in database: 2,407,596 Number of sequences in database: 13,730 Lambda K H 0.327 0.140 0.401 Gapped Lambda K H 0.267 0.0525 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 13730 Number of Hits to DB: 1,373,642 Number of extensions: 63845 Number of successful extensions: 229 Number of sequences better than 10.0: 1 Number of HSP's gapped: 229 Number of HSP's successfully gapped: 13 Length of query: 373 Length of database: 2,407,596 Length adjustment: 87 Effective length of query: 286 Effective length of database: 1,213,086 Effective search space: 346942596 Effective search space used: 346942596 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 54 (25.1 bits)