HHsearch alignment for GI: 254780140 and conserved domain: COG1463

>COG1463 Ttg2C ABC-type transport system involved in resistance to organic solvents, periplasmic component [Secondary metabolites biosynthesis, transport, and catabolism].
Probab=99.96  E-value=8e-27  Score=205.67  Aligned_cols=126  Identities=30%  Similarity=0.427  Sum_probs=111.4

Q ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCC--CCCEEEEEEEECCCCCCCCCCCEEEEEEEEEEEEEEEEECCCCC
Q ss_conf             9632789999999999999999999986254446--77618999997187567668980789007433798888648886
Q gi|254780140|r    1 MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQY--DGPMAEVIIRIPGSVDGLSTDSSVRFNGIPVGRIVGLFLDQEYP   78 (452)
Q Consensus         1 m~~~~~~~~vG~fvi~~~~~~~~~~~~~~~~~~~--~~~~~~~~~~f~~~v~GL~~gspV~~~Gv~VG~V~~I~l~~~~~   78 (452)
T Consensus         1 m~~r~~~~~v~~f~~~~l~~~~~~~~~~~~~~~~~~~~~~~~v~a~f~-~~~GL~~gs~V~~~GV~VG~V~~I~~~~-~~   78 (359)
T COG1463           1 METRANRVLVGLFLLLGLLAVLLFVLWLATLPGLPGGTGTYTVTAYFD-DAGGLYVGSPVRYRGVKVGKVASISLDP-KP   78 (359)
T ss_pred             CCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCEEEEEEEC-CCCCCCCCCEEEECCEEEEEEEEEEECC-CC
T ss_conf             986412689999999999999999998610243347788628999841-4457789982699787864486887617-88


Q ss_pred             EEEEEEEEECCCCCCCCCCEEEEEECCCCHHHHHHCCCCCCCCCCCCCCC
Q ss_conf             07999999748972468846999742321023321014653221124678
Q gi|254780140|r   79 NHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKEKKTIFQIA  128 (452)
Q Consensus        79 ~~v~v~~~i~~~~~i~~~~~~~i~~~~l~g~~~i~~~~~~~~~~~l~~~~  128 (452)
T Consensus        79 ~~~~v~~~id~~~~Ip~~s~A~I~~~gL~G~~yIeL~~~~~~~~~l~~~~  128 (359)
T COG1463          79 NGARVTLEIDSDYPIPADSTASIRTTGLLGEKYIELTPGDAGGPKLRLGA  128 (359)
T ss_pred             CEEEEEEEECCCCCCCCCCEEEEECCCCHHHHEEEECCCCCCCCCCCCCC
T ss_conf             70699999658950578746887306530543366347988866567899