BLAST/PSIBLAST alignment of GI: 254780140 and GI: 315122742 at iteration 1
>gi|315122742|ref|YP_004063231.1| putative ABC transporter, substrate-binding protein [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 448
>gi|313496144|gb|ADR52743.1| putative ABC transporter, substrate-binding protein [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 448
 Score =  556 bits (1432), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 273/452 (60%), Positives = 351/452 (77%), Gaps = 4/452 (0%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME KNYYT+VG F +SIL  SF+SIYWLSR++QY+GP  E+IIRIPGSV+GL+ +SSVRF
Sbjct: 1   MEVKNYYTAVGFFAISILLLSFYSIYWLSRNDQYNGPTTELIIRIPGSVEGLAVNSSVRF 60

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NGIP+G + GLF+D++ P++S+A+ L+R D PLYPST A I+ QG+ G+TYIELST R E
Sbjct: 61  NGIPIGHVTGLFVDKDNPHYSMAQTLVRVDVPLYPSTKAMIKAQGITGMTYIELSTERTE 120

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
             T+FQ AT+  + AMITA PSGIN+ +S AE+T  KI+ SS  IQKII N + PL   I
Sbjct: 121 NYTLFQTATKEKKIAMITAIPSGINHLLSTAEDTLNKINVSSDQIQKIINNADNPLNRII 180

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
            N ETIST+L +N+S +DKM+H       + D   T +  +D ITSL+K IKA+D+QK+N
Sbjct: 181 KNFETISTILVDNVSDLDKMIHRKNNV--AVDFTKTLSNTSDFITSLNKTIKAVDIQKIN 238

Query: 241 QILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAF 300
           QI+ENIQV SNNF+KSSDQV NT++D++ETT TFQ VG+K DHLLSD SS++ SKE   F
Sbjct: 239 QIIENIQVVSNNFIKSSDQVTNTINDLQETTHTFQGVGKKADHLLSDVSSQIHSKEAFDF 298

Query: 301 LENIADSTSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNIS 360
            ENI++S+SN+R+S SAIREITD  QKII TI+TIE +T NLN+SS K  ELM+ IN+ +
Sbjct: 299 WENISESSSNIRNSTSAIREITDHSQKIILTIDTIEKMTENLNNSSIKLKELMTTINSFT 358

Query: 361 ALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVN 420
             +   SL +DAQ+A+ +F++T+EKIN YIP I  NLQNFS SGL D+QNL+R LQETV 
Sbjct: 359 DSEGKKSLIEDAQKAIRSFQNTTEKINEYIPPIAKNLQNFSNSGLYDLQNLIRNLQETVG 418

Query: 421 HFDDCLNNFERNPQDIVWGREKGSVKIYKPKH 452
           HFDD L+NFERNPQ+I+WG+E  +VK YKPKH
Sbjct: 419 HFDDSLSNFERNPQNIIWGKE--TVKQYKPKH 448