BLAST/PSIBLAST alignment of GI: 254780140 and GI: 86357962 at iteration 1
>gi|86357962|ref|YP_469854.1| putative ABC transporter protein [Rhizobium etli CFN 42] Length = 456
>gi|86282064|gb|ABC91127.1| putative ABC transporter protein [Rhizobium etli CFN 42] Length = 456
 Score =  271 bits (694), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 151/463 (32%), Positives = 262/463 (56%), Gaps = 22/463 (4%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K  YT VG F V ++  +F  +YW++   +  GPM E+I+RIPGS +GLS  S VRF
Sbjct: 1   METKANYTIVGFFTVLVIAAAFGFVYWMAEYGR-GGPMTELIVRIPGSANGLSVGSPVRF 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NGI VG +  L +D + P +SLA   +R D P+YPST A +  QGL G  YIELS  RK 
Sbjct: 60  NGIQVGSVQTLSIDADDPQYSLAFTQVRTDAPIYPSTKAALEIQGLTGAAYIELSGGRKG 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
           +++I + A E  +RA+I A  S +   ++ A+    + +D+   +Q  IE+   PLT T 
Sbjct: 120 EESILKHAIENGKRAVIVADQSSVTNLLATADKILDRANDAVGELQGFIEDSRAPLTQTF 179

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
            N ET S  LA N  +ID  + +  V   S+  K     +   + +++ +++A+D QK++
Sbjct: 180 KNAETFSDALAKNSDNIDAFLQS--VGELSNTVKAVSGRVDSTLQAVESLVRAVDAQKID 237

Query: 241 QILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQ-------KIDHLLSDFS-SKM 292
            I+ N +  + N   +S  +   +    ET  TF + G+       ++D L++    +K+
Sbjct: 238 NIVSNAEKITANVADASGDLKGAIQKFDETATTFNDFGKQAQATLDRVDTLVAQIDPAKI 297

Query: 293 KSKETSAFLENIADSTSNMRSSISAIREITDQ---RQKIIS-TINTIENITSNLNDSSQK 348
           K       +++I+ +T + R ++++IR++ +    RQK I  TI  +  + + LN +S +
Sbjct: 298 KGS-----VDDISQATKDARVAVASIRDVANTVSLRQKDIDQTIQDVSQLANKLNSASTR 352

Query: 349 FAELMSKINNISALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDI 408
              ++ K++ +       SLF +A+  + +F+  ++ +N  I  I +NLQ FS +GL D+
Sbjct: 353 VDGILIKVDALLGTDNTQSLFAEARETLESFKKVADNLNSRIGPIADNLQKFSSAGLRDV 412

Query: 409 QNLVRKLQETVNHFDDCLNNFERNPQDIVWGREKGSVKIYKPK 451
           Q L+  ++ TV++ +D ++NF+RNPQ +++G +  +VK Y  +
Sbjct: 413 QTLINDMRGTVSNLNDTISNFDRNPQRLIFGGD--TVKQYDGR 453