BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780140|ref|YP_003064553.1| putative ABC transporter,
substrate-binding protein [Candidatus Liberibacter asiaticus str.
psy62]
         (452 letters)

Database: nr 
           13,984,884 sequences; 4,792,584,752 total letters

Searching..................................................done


Results from round 1


>gi|254780140|ref|YP_003064553.1| putative ABC transporter, substrate-binding protein [Candidatus
           Liberibacter asiaticus str. psy62]
 gi|254039817|gb|ACT56613.1| putative ABC transporter, substrate-binding protein [Candidatus
           Liberibacter asiaticus str. psy62]
          Length = 452

 Score =  922 bits (2382), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 452/452 (100%), Positives = 452/452 (100%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF
Sbjct: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE
Sbjct: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
           KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI
Sbjct: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
           ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN
Sbjct: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240

Query: 241 QILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAF 300
           QILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAF
Sbjct: 241 QILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAF 300

Query: 301 LENIADSTSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNIS 360
           LENIADSTSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNIS
Sbjct: 301 LENIADSTSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNIS 360

Query: 361 ALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVN 420
           ALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVN
Sbjct: 361 ALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVN 420

Query: 421 HFDDCLNNFERNPQDIVWGREKGSVKIYKPKH 452
           HFDDCLNNFERNPQDIVWGREKGSVKIYKPKH
Sbjct: 421 HFDDCLNNFERNPQDIVWGREKGSVKIYKPKH 452


>gi|315122742|ref|YP_004063231.1| putative ABC transporter, substrate-binding protein [Candidatus
           Liberibacter solanacearum CLso-ZC1]
 gi|313496144|gb|ADR52743.1| putative ABC transporter, substrate-binding protein [Candidatus
           Liberibacter solanacearum CLso-ZC1]
          Length = 448

 Score =  556 bits (1432), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 273/452 (60%), Positives = 351/452 (77%), Gaps = 4/452 (0%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME KNYYT+VG F +SIL  SF+SIYWLSR++QY+GP  E+IIRIPGSV+GL+ +SSVRF
Sbjct: 1   MEVKNYYTAVGFFAISILLLSFYSIYWLSRNDQYNGPTTELIIRIPGSVEGLAVNSSVRF 60

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NGIP+G + GLF+D++ P++S+A+ L+R D PLYPST A I+ QG+ G+TYIELST R E
Sbjct: 61  NGIPIGHVTGLFVDKDNPHYSMAQTLVRVDVPLYPSTKAMIKAQGITGMTYIELSTERTE 120

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
             T+FQ AT+  + AMITA PSGIN+ +S AE+T  KI+ SS  IQKII N + PL   I
Sbjct: 121 NYTLFQTATKEKKIAMITAIPSGINHLLSTAEDTLNKINVSSDQIQKIINNADNPLNRII 180

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
            N ETIST+L +N+S +DKM+H       + D   T +  +D ITSL+K IKA+D+QK+N
Sbjct: 181 KNFETISTILVDNVSDLDKMIHRKNNV--AVDFTKTLSNTSDFITSLNKTIKAVDIQKIN 238

Query: 241 QILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAF 300
           QI+ENIQV SNNF+KSSDQV NT++D++ETT TFQ VG+K DHLLSD SS++ SKE   F
Sbjct: 239 QIIENIQVVSNNFIKSSDQVTNTINDLQETTHTFQGVGKKADHLLSDVSSQIHSKEAFDF 298

Query: 301 LENIADSTSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNIS 360
            ENI++S+SN+R+S SAIREITD  QKII TI+TIE +T NLN+SS K  ELM+ IN+ +
Sbjct: 299 WENISESSSNIRNSTSAIREITDHSQKIILTIDTIEKMTENLNNSSIKLKELMTTINSFT 358

Query: 361 ALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVN 420
             +   SL +DAQ+A+ +F++T+EKIN YIP I  NLQNFS SGL D+QNL+R LQETV 
Sbjct: 359 DSEGKKSLIEDAQKAIRSFQNTTEKINEYIPPIAKNLQNFSNSGLYDLQNLIRNLQETVG 418

Query: 421 HFDDCLNNFERNPQDIVWGREKGSVKIYKPKH 452
           HFDD L+NFERNPQ+I+WG+E  +VK YKPKH
Sbjct: 419 HFDDSLSNFERNPQNIIWGKE--TVKQYKPKH 448


>gi|116252405|ref|YP_768243.1| solute-binding component of ABC transporter [Rhizobium
           leguminosarum bv. viciae 3841]
 gi|115257053|emb|CAK08147.1| putative solute-binding component of ABC transporter [Rhizobium
           leguminosarum bv. viciae 3841]
          Length = 456

 Score =  274 bits (701), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 149/458 (32%), Positives = 258/458 (56%), Gaps = 12/458 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K  YT VG F V ++  +F  +YW++   +  GPM E+I+RIPGS +GLS  S VRF
Sbjct: 1   METKANYTIVGFFTVLVIAAAFGFVYWMAEYGR-GGPMTELIVRIPGSANGLSVGSPVRF 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NGI +G +  L +D + P +SLA   +R D P+YPST A +  QGL G  YIELS  RK 
Sbjct: 60  NGIQIGSVQTLSIDADDPQYSLAFTQVRTDAPIYPSTKAALEIQGLTGAAYIELSGGRKG 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
           +++I Q A +  +RA+I A  S +   ++ A+    + +D+   +Q  IE+   PLT T 
Sbjct: 120 EESILQHAIDNGKRAVIVADQSSVTNLLATADKILDRANDAVGELQGFIEDSRGPLTETF 179

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
            N ET S  LA N  +ID  + +  V   S+  K     +   + +++ ++KA+D QK++
Sbjct: 180 KNAETFSDALAKNSGNIDAFLQS--VGELSNTVKAVSGRVDSTLQAVESLVKAVDAQKID 237

Query: 241 QILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLL---SDFSSKMKSKET 297
            I+ N +  + N   +S  +   +    +T  TF + G++    L       +++   + 
Sbjct: 238 NIVSNAEKITANVADASGDLKGAIQKFDQTATTFNDFGKQAQATLDRVDTLVAQIDPAKV 297

Query: 298 SAFLENIADSTSNMRSSISAIREITD---QRQKIIS-TINTIENITSNLNDSSQKFAELM 353
              +++IA +T + R+++++IR++ +    RQK I  TI  +  +++ LN +S +   ++
Sbjct: 298 KGSVDDIAQATKDARAAVASIRDVANTVSARQKDIDQTIQDVSQLSNKLNSASTRIDGIL 357

Query: 354 SKINNISALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVR 413
            K++ +       SLF +A+  + +F+  ++ +N  I  I +NLQ FS  GL D+Q LV 
Sbjct: 358 IKVDALLGTDNTQSLFTEARNTLESFKKVADNLNSRIGPIADNLQKFSSGGLRDVQTLVN 417

Query: 414 KLQETVNHFDDCLNNFERNPQDIVWGREKGSVKIYKPK 451
            ++ TV++ +D + NF+RNPQ +++G +  +VK Y  +
Sbjct: 418 DMRGTVSNLNDTITNFDRNPQRLIFGGD--TVKQYDGR 453


>gi|190892033|ref|YP_001978575.1| putative ABC transporter, substrate-binding protein [Rhizobium etli
           CIAT 652]
 gi|190697312|gb|ACE91397.1| putative ABC transporter, substrate-binding protein [Rhizobium etli
           CIAT 652]
          Length = 456

 Score =  274 bits (700), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 152/463 (32%), Positives = 260/463 (56%), Gaps = 22/463 (4%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K  YT VG F V ++  +F  +YW++   +  GPM E+I+RIPGS +GLS  S VRF
Sbjct: 1   METKANYTIVGFFTVLVIAAAFGFVYWMAEYGR-GGPMTELIVRIPGSANGLSVGSPVRF 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NGI +G +  L +D + P +SLA   +R D P+YPST A +  QGL G  YIELS  RK 
Sbjct: 60  NGIQIGSVQTLSIDADDPQYSLAFTQVRTDAPIYPSTKAALEIQGLTGAAYIELSGGRKG 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
           +++I Q A +  +RA+I A  S +   ++ A+    + +D+   +Q  I++   PLT T 
Sbjct: 120 EESILQHAIDNGKRAVIVADQSSVTNLLATADKILDRANDAVGELQGFIQDSRAPLTQTF 179

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
            N ET S  LA N  +ID  + +  V   S+  K     +   + +++ ++KA+D QK++
Sbjct: 180 KNAETFSDALAKNSDNIDAFLQS--VGELSNTVKAVSGRVDSTLEAVESLVKAVDAQKID 237

Query: 241 QILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQ-------KIDHLLSDFS-SKM 292
            I+ N +  + N   +S  +   +    ET  TF + G+       ++D L++    +K+
Sbjct: 238 HIVSNAERITANVADASGDLKGAIQKFDETATTFNDFGKQAQDTLDRVDTLVAQIDPAKL 297

Query: 293 KSKETSAFLENIADSTSNMRSSISAIREITD---QRQKIIS-TINTIENITSNLNDSSQK 348
           K       +++I+ +T + R++I++IR++ +    RQK I  TI  +  + + LN +S +
Sbjct: 298 KGS-----VDDISQATKDARAAIASIRDVANTVSGRQKDIDQTIQDVSQLANKLNSASTR 352

Query: 349 FAELMSKINNISALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDI 408
              ++ K++ +       S+F  A+  + +F+  ++ +N  I  I +NLQ FS  GL D+
Sbjct: 353 IDGILIKVDALLGTDNTQSMFAQARETLESFKKVADNLNSRIGPIADNLQKFSSGGLRDV 412

Query: 409 QNLVRKLQETVNHFDDCLNNFERNPQDIVWGREKGSVKIYKPK 451
           Q LV  ++ TVN+ +D + NF+RNPQ +++G +  +VK Y  +
Sbjct: 413 QTLVNDMRGTVNNLNDTITNFDRNPQRLIFGGD--TVKQYDGR 453


>gi|241204913|ref|YP_002976009.1| Mammalian cell entry related domain protein [Rhizobium
           leguminosarum bv. trifolii WSM1325]
 gi|240858803|gb|ACS56470.1| Mammalian cell entry related domain protein [Rhizobium
           leguminosarum bv. trifolii WSM1325]
          Length = 456

 Score =  273 bits (699), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 149/458 (32%), Positives = 259/458 (56%), Gaps = 12/458 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K  YT VG F V ++  +F  +YW++   +  GPM E+I+RIPGS +GLS  S VRF
Sbjct: 1   METKANYTIVGFFTVLVIAAAFGFVYWMAEYGR-GGPMTELIVRIPGSANGLSVGSPVRF 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NGI +G +  L +D + P +SLA   +R D P+YPST A +  QGL G  YIELS  RK 
Sbjct: 60  NGIQIGSVQTLSIDADDPQYSLAFTQVRTDAPIYPSTKAALEIQGLTGAAYIELSGGRKG 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
           +++I Q A +  +RA+I A  S +   ++ A+    + +D+   +Q  IE+   PLT T 
Sbjct: 120 EESILQHAIDNGKRAVIVADQSSVTNLLATADKILDRANDAVGELQGFIEDSRGPLTETF 179

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
            N ET S  LA N  +ID  + +  V   S+  K   + +   + +++ ++KA+D QK++
Sbjct: 180 KNAETFSDALAKNSGNIDAFLQS--VGELSNTVKAVSSRVDSTLQAVESLVKAVDAQKID 237

Query: 241 QILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLL---SDFSSKMKSKET 297
            I+ N +  + N   +S  +   +    +T  TF + G++    L       +++   + 
Sbjct: 238 NIVSNAEKITANVADASGDLKGAIQKFDQTATTFNDFGKQAQATLDRVDTLVAQIDPAKV 297

Query: 298 SAFLENIADSTSNMRSSISAIREITD---QRQKIIS-TINTIENITSNLNDSSQKFAELM 353
              +++I+ +T + R+++++IRE+ +    RQK I  TI  +  +++ LN +S +   ++
Sbjct: 298 KGSVDDISQATKDARAAVASIREVANTVSARQKDIDQTIQDVSQLSNKLNSASTRIDGIL 357

Query: 354 SKINNISALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVR 413
            K++ +       SLF +A+  + +F+  ++ +N  I  I +NLQ FS  GL D+Q LV 
Sbjct: 358 IKVDALLGTDNTQSLFTEARDTLESFKKVADNLNSRIGPIADNLQKFSSGGLRDVQTLVN 417

Query: 414 KLQETVNHFDDCLNNFERNPQDIVWGREKGSVKIYKPK 451
            ++ TV++ +D + NF+RNPQ +++G +  +VK Y  +
Sbjct: 418 DMRGTVSNLNDTITNFDRNPQRLIFGGD--TVKQYDGR 453


>gi|327190642|gb|EGE57730.1| putative ABC transporter, substrate-binding protein [Rhizobium etli
           CNPAF512]
          Length = 456

 Score =  273 bits (698), Expect = 4e-71,   Method: Compositional matrix adjust.
 Identities = 151/463 (32%), Positives = 260/463 (56%), Gaps = 22/463 (4%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K  YT VG F V ++  +F  +YW++   +  GPM E+I+RIPGS +GLS  S VRF
Sbjct: 1   METKANYTIVGFFTVLVIAAAFGFVYWMAEYGR-GGPMTELIVRIPGSANGLSVGSPVRF 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NGI +G +  L +D + P +SLA   +R D P+YPST A +  QGL G  YIELS  RK 
Sbjct: 60  NGIQIGSVQTLSIDADDPQYSLAFTQVRTDAPIYPSTKAALEIQGLTGAAYIELSGGRKG 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
           +++I Q A +  +RA+I A  S +   ++ A+    + +D+   +Q  I++   PLT T 
Sbjct: 120 EESILQHAIDNGKRAVIVADQSSVTNLLATADKILDRANDAVGELQGFIQDSRAPLTQTF 179

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
            N ET S  LA N  +ID  + +  V   S+  K     +   + +++ ++KA+D QK++
Sbjct: 180 KNAETFSDALAKNSDNIDAFLQS--VGELSNTVKAVSGRVDSTLEAVESLVKAVDAQKID 237

Query: 241 QILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQ-------KIDHLLSDFS-SKM 292
            I+ N +  + N   +S  +   +    ET  TF + G+       ++D L++    +K+
Sbjct: 238 HIVSNAERITANVADASGDLKGAIQKFDETATTFNDFGKQAQDTLDRVDTLVAQIDPAKL 297

Query: 293 KSKETSAFLENIADSTSNMRSSISAIREITD---QRQKIIS-TINTIENITSNLNDSSQK 348
           K       +++I+ +T + R+++++IR++ +    RQK I  TI  +  + + LN +S +
Sbjct: 298 KGS-----VDDISQATKDARAAVASIRDVANTVSGRQKDIDQTIQDVSQLANKLNSASTR 352

Query: 349 FAELMSKINNISALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDI 408
              ++ K++ +       S+F  A+  + +F+  ++ +N  I  I +NLQ FS  GL D+
Sbjct: 353 IDGILIKVDALLGTDNTQSMFAQARETLESFKKVADNLNSRIGPIADNLQKFSSGGLRDV 412

Query: 409 QNLVRKLQETVNHFDDCLNNFERNPQDIVWGREKGSVKIYKPK 451
           Q LV  ++ TVN+ +D + NF+RNPQ +++G +  +VK Y  +
Sbjct: 413 QTLVNDMRGTVNNLNDTITNFDRNPQRLIFGGD--TVKQYDGR 453


>gi|209549576|ref|YP_002281493.1| hypothetical protein Rleg2_1982 [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209535332|gb|ACI55267.1| Mammalian cell entry related domain protein [Rhizobium
           leguminosarum bv. trifolii WSM2304]
          Length = 456

 Score =  273 bits (697), Expect = 5e-71,   Method: Compositional matrix adjust.
 Identities = 149/458 (32%), Positives = 256/458 (55%), Gaps = 12/458 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K  YT VG F V ++  +F  +YW++   +  GPM E+I+RIPGS +GLS  S VRF
Sbjct: 1   METKANYTIVGFFTVLVIAAAFGFVYWMAEYGR-GGPMTELIVRIPGSANGLSVGSPVRF 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NGI +G +  L +D + P +SLA   +R D P+YPST A +  QGL G  YIELS  RK 
Sbjct: 60  NGIQIGSVQTLSIDADDPQYSLAFTQVRTDAPIYPSTKAALEIQGLTGAAYIELSGGRKG 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
           +++I Q A +  +RA+I A  S +   ++ A+    + +D+   +Q  IE+   PLT T 
Sbjct: 120 EESILQHAIDNGKRAVIVADQSSVTNLLATADKILDRANDAVGELQGFIEDSRAPLTQTF 179

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
            N ET S  LA N  +ID  + +  V   S+  K     +   + +++ ++KA+D +K++
Sbjct: 180 KNAETFSDALAKNSGNIDAFLQS--VGELSNTVKAVSGRVDSTLQAVESLVKAVDAKKID 237

Query: 241 QILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLL---SDFSSKMKSKET 297
            I+ N    + N   +S  +   +    +T  TF + G++    L       +++   + 
Sbjct: 238 NIVSNADKITANVADASGDLKGAIQKFDQTATTFNDFGKQAQATLDRVDTLVAQIDPAKV 297

Query: 298 SAFLENIADSTSNMRSSISAIREITD---QRQKIIS-TINTIENITSNLNDSSQKFAELM 353
              +++IA +T + R+++++IR++ +    RQK I  TI  +  + + LN +S +   ++
Sbjct: 298 KGSVDDIAQATKDARAAVASIRDVANTVSGRQKDIDQTIQDVSQLANKLNSASTRIDGIL 357

Query: 354 SKINNISALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVR 413
            K++ +       SLF +A+  + +F+  ++ +N  I  I +NLQ FS  GL D+Q LV 
Sbjct: 358 IKVDALLGTDNTQSLFTEARDTLESFKKVADNLNARIGPIADNLQKFSSGGLRDVQTLVN 417

Query: 414 KLQETVNHFDDCLNNFERNPQDIVWGREKGSVKIYKPK 451
            ++ TVN+ +D + NF+RNPQ +++G +  +VK Y  +
Sbjct: 418 DMRGTVNNLNDTITNFDRNPQRLIFGGD--TVKQYDGR 453


>gi|86357962|ref|YP_469854.1| putative ABC transporter protein [Rhizobium etli CFN 42]
 gi|86282064|gb|ABC91127.1| putative ABC transporter protein [Rhizobium etli CFN 42]
          Length = 456

 Score =  271 bits (694), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 151/463 (32%), Positives = 262/463 (56%), Gaps = 22/463 (4%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K  YT VG F V ++  +F  +YW++   +  GPM E+I+RIPGS +GLS  S VRF
Sbjct: 1   METKANYTIVGFFTVLVIAAAFGFVYWMAEYGR-GGPMTELIVRIPGSANGLSVGSPVRF 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NGI VG +  L +D + P +SLA   +R D P+YPST A +  QGL G  YIELS  RK 
Sbjct: 60  NGIQVGSVQTLSIDADDPQYSLAFTQVRTDAPIYPSTKAALEIQGLTGAAYIELSGGRKG 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
           +++I + A E  +RA+I A  S +   ++ A+    + +D+   +Q  IE+   PLT T 
Sbjct: 120 EESILKHAIENGKRAVIVADQSSVTNLLATADKILDRANDAVGELQGFIEDSRAPLTQTF 179

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
            N ET S  LA N  +ID  + +  V   S+  K     +   + +++ +++A+D QK++
Sbjct: 180 KNAETFSDALAKNSDNIDAFLQS--VGELSNTVKAVSGRVDSTLQAVESLVRAVDAQKID 237

Query: 241 QILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQ-------KIDHLLSDFS-SKM 292
            I+ N +  + N   +S  +   +    ET  TF + G+       ++D L++    +K+
Sbjct: 238 NIVSNAEKITANVADASGDLKGAIQKFDETATTFNDFGKQAQATLDRVDTLVAQIDPAKI 297

Query: 293 KSKETSAFLENIADSTSNMRSSISAIREITDQ---RQKIIS-TINTIENITSNLNDSSQK 348
           K       +++I+ +T + R ++++IR++ +    RQK I  TI  +  + + LN +S +
Sbjct: 298 KGS-----VDDISQATKDARVAVASIRDVANTVSLRQKDIDQTIQDVSQLANKLNSASTR 352

Query: 349 FAELMSKINNISALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDI 408
              ++ K++ +       SLF +A+  + +F+  ++ +N  I  I +NLQ FS +GL D+
Sbjct: 353 VDGILIKVDALLGTDNTQSLFAEARETLESFKKVADNLNSRIGPIADNLQKFSSAGLRDV 412

Query: 409 QNLVRKLQETVNHFDDCLNNFERNPQDIVWGREKGSVKIYKPK 451
           Q L+  ++ TV++ +D ++NF+RNPQ +++G +  +VK Y  +
Sbjct: 413 QTLINDMRGTVSNLNDTISNFDRNPQRLIFGGD--TVKQYDGR 453


>gi|222086198|ref|YP_002544730.1| ABC transporter protein [Agrobacterium radiobacter K84]
 gi|221723646|gb|ACM26802.1| ABC transporter protein [Agrobacterium radiobacter K84]
          Length = 456

 Score =  263 bits (671), Expect = 5e-68,   Method: Compositional matrix adjust.
 Identities = 144/458 (31%), Positives = 260/458 (56%), Gaps = 12/458 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K  YT VG F + ++  +F  +YW++   +  GPM E+++RIPGS +GLS  S VRF
Sbjct: 1   METKANYTIVGFFTLLVIAAAFGFVYWMAEYGR-GGPMVELVVRIPGSANGLSVGSPVRF 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NGI VG + GL +D + PN+SLA   +R D P+Y ST A +  QGL G  YIELS  R  
Sbjct: 60  NGIQVGSVQGLSIDADDPNYSLAFTEVRADAPVYTSTKAILEIQGLTGAAYIELSGGRNG 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
            + I + + +  +RA++ A  S +   ++ A+    + +D+   IQ  + +   PLT T+
Sbjct: 120 DENILKRSVDTGKRAVLLADQSSVTNLLNTADKILNRANDTIGDIQGFVSDSRAPLTDTV 179

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
            N +T S  L++N  +IDK + +  +   S   KN    I   + +++K+++A+D  K+N
Sbjct: 180 RNAQTFSKALSDNSDNIDKFLAS--MGQLSDTFKNVSTRIDSTLEAVEKLVRAVDANKIN 237

Query: 241 QILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFS---SKMKSKET 297
           +++ N    + N   ++  +  TV   ++T  T+   GQK    L       +++   + 
Sbjct: 238 EVVNNANKITANVADATTDLKATVAAFKQTADTYNAFGQKAQQTLDRVDAIVAQIDPAKL 297

Query: 298 SAFLENIADSTSNMRSSISAIREITD----QRQKIISTINTIENITSNLNDSSQKFAELM 353
              +++I   T + R+++++IRE+ +    ++Q I  TI    +I+  LN +S K   ++
Sbjct: 298 KGSVDDITQVTKDARAAVTSIREVANSVAARQQDIDQTIANARSISEKLNSASGKVDGVL 357

Query: 354 SKINNISALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVR 413
           SK++++    +  SLF +A+  + +F+  ++ +N  I  I +NLQ FS SGL+++Q L+ 
Sbjct: 358 SKVDSLLGSGDTQSLFAEAKDTLTSFKKMADNLNARIGPIADNLQKFSSSGLSNVQTLIN 417

Query: 414 KLQETVNHFDDCLNNFERNPQDIVWGREKGSVKIYKPK 451
            ++ TV++ +  + NF+RNPQ +++G +  +VK Y  +
Sbjct: 418 DMRGTVDNLNSTITNFDRNPQRLLFGGD--TVKQYDGR 453


>gi|325293032|ref|YP_004278896.1| ABC transporter substrate-binding protein [Agrobacterium sp. H13-3]
 gi|325060885|gb|ADY64576.1| ABC transporter, substrate binding protein [Agrobacterium sp.
           H13-3]
          Length = 456

 Score =  241 bits (615), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 134/462 (29%), Positives = 253/462 (54%), Gaps = 20/462 (4%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K  YT VG+F + ++  +F  +YW++   +  GP A++++RIPGS +GLS  S VRF
Sbjct: 1   METKANYTIVGIFTLIVIAAAFGFVYWMAEFGR-GGPTAQLVVRIPGSANGLSVGSPVRF 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NGIPVG + GL +D++ P +S+A   ++ D P++PST A +  QGL G  YIELS   K+
Sbjct: 60  NGIPVGTVRGLAIDRDDPAYSIAFTEVQADAPVFPSTRAVLEIQGLTGAAYIELSGGNKD 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
            + I Q + E    A +TA  S +   ++ A+   K+   +   +Q  +++   PLT T+
Sbjct: 120 GERILQKSVESGVPAELTADLSSVTNLLATADKILKRADGAIGELQGFVQDARGPLTQTV 179

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
            N E  S  LA N   I   + +  ++  S+  ++    +   +T+++ ++KA+D  K++
Sbjct: 180 RNAEKFSDALAANSDGIKSFIAS--LSSLSTTVQSVSVRLDGTLTAVEDLVKAVDAGKID 237

Query: 241 QILENIQVSSNNFVKSSDQVINTVHDVRETTQTF-------QEVGQKIDHLLSDFSSKMK 293
            IL N+   + +   +S  +   +  V+ T + F       Q V ++ D LL    + + 
Sbjct: 238 SILSNVDKVTKDVASASSDIQGIMETVQSTARNFEAASTEVQTVVKRADELL----ASVD 293

Query: 294 SKETSAFLENIADSTSNMRSSISAIREITD----QRQKIISTINTIENITSNLNDSSQKF 349
             + S  + +++ +T++ R +++  + I D    +R  I   ++   ++   LN +S + 
Sbjct: 294 PAKVSTVVGDVSAATADARDAVANFKRIADDVGARRADIDQAVSDFTDMGRKLNLASSRV 353

Query: 350 AELMSKINNISALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQ 409
             +++K++ +    + NSLF  A+  + +F+  ++ +N  I  I +NL  FS SGL D Q
Sbjct: 354 DGILAKVDGMLGTDDANSLFAKARETLTSFKAVADNLNARIGPIADNLTRFSSSGLKDFQ 413

Query: 410 NLVRKLQETVNHFDDCLNNFERNPQDIVWGREKGSVKIYKPK 451
            L+   ++TV++ ++ + N +R+PQ +++G E  +VK Y  +
Sbjct: 414 ALIGSTRQTVDNLNNAITNIDRDPQRLIFGGE--TVKQYDGR 453


>gi|222148409|ref|YP_002549366.1| ABC transporter substrate binding protein [Agrobacterium vitis S4]
 gi|221735397|gb|ACM36360.1| ABC transporter substrate binding protein [Agrobacterium vitis S4]
          Length = 455

 Score =  241 bits (615), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 143/465 (30%), Positives = 255/465 (54%), Gaps = 27/465 (5%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K  YT VGLF + ++  +F  +YW++   +  GPM+ + IRIPGS +GLS  S VRF
Sbjct: 1   METKANYTIVGLFTLLVILAAFGFVYWMAEYGR-GGPMSPLTIRIPGSANGLSVGSPVRF 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NGI +G +V L +D++ P  S+A+  ++ D P+  +T A +  QGL G  Y+E+S     
Sbjct: 60  NGIQIGSVVSLSIDRDDPAFSIAETQVQQDAPIRSNTKAALEVQGLTGAAYVEMSG-GVG 118

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
              + + A E  + A++ A  S +   ++ A+   K+  D+  ++Q  + +   PLT T+
Sbjct: 119 GDDLLKKAQETGKTAVLVADQSSLTNLLATADKIMKRADDAIANVQGFVADARGPLTNTM 178

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDK-------MIKA 233
            N ET S  LA+N   ID  + +              +TIT L   LD        ++KA
Sbjct: 179 RNAETFSKALADNADGIDTFLKSVSALS---------DTITGLSGRLDSTLAAAEDLLKA 229

Query: 234 IDLQKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMK 293
           +D  KVNQIL N +  +     +SD+V   V +   T +TF + G K +  L   ++ + 
Sbjct: 230 VDRNKVNQILTNAETFTGKIADASDKVGVAVDNFSATAKTFNDFGVKAEGTLGQVNALIA 289

Query: 294 SKET---SAFLENIADSTSNMRSSISAIREIT----DQRQKIISTINTIENITSNLNDSS 346
           + +T   S  +++++ + ++ RS+ + ++ +T    D++  I   I+    +++ LN++S
Sbjct: 290 AIDTQKVSRVVDDVSVAVTDARSAAANVQSVTETFKDRKPDIDQAISDFTQLSNRLNNAS 349

Query: 347 QKFAELMSKINNISALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLN 406
            +   +++K++ +    + NSL  +A+R + + R  ++ +N+ I  I +NL  FS SGL 
Sbjct: 350 TRVDGILAKVDALLGSDDTNSLSAEAKRTLQSIRAVADNLNQKIGPIADNLSKFSSSGLK 409

Query: 407 DIQNLVRKLQETVNHFDDCLNNFERNPQDIVWGREKGSVKIYKPK 451
           DIQ LV   + TV + DD ++NF+R+PQ +++G +  +VK Y  +
Sbjct: 410 DIQTLVNDTRSTVKNLDDTISNFDRDPQRLIFGGD--NVKQYDGR 452


>gi|15888955|ref|NP_354636.1| ABC transporter, substrate binding protein [Agrobacterium
           tumefaciens str. C58]
 gi|15156734|gb|AAK87421.1| ABC transporter, substrate binding protein [Agrobacterium
           tumefaciens str. C58]
          Length = 456

 Score =  240 bits (612), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 134/462 (29%), Positives = 252/462 (54%), Gaps = 20/462 (4%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K  YT VG+F + ++  +F  +YW++   +  GP A++++RIPGS +GLS  S VRF
Sbjct: 1   METKANYTIVGIFTLIVIAAAFGFVYWMAEFGR-GGPTAQLVVRIPGSANGLSVGSPVRF 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NGIPVG + GL +D++ P +S+A   ++ D P++PST A +  QGL G  YIELS   K+
Sbjct: 60  NGIPVGTVRGLAIDRDDPAYSIAFTEVQADAPVFPSTRAVLEIQGLTGAAYIELSGGNKD 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
            + I Q + E    A +TA  S +   ++ A+   K+   +   +Q  +++   PLT T+
Sbjct: 120 GERILQKSVESGVPAELTADLSSVTNLLATADKILKRADGAIGELQGFVQDARGPLTQTV 179

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
            N E  S  LA N   I   + +  ++  S+  ++    +   +T+++ ++KA+D  K++
Sbjct: 180 RNAEKFSDALAANSDGIKNFIAS--LSSLSTTVQSVSVRLDGTLTAVENLVKAVDAGKID 237

Query: 241 QILENIQVSSNNFVKSSDQVINTVHDVRETTQTF-------QEVGQKIDHLLSDFSSKMK 293
            IL N+   + +   +S  +   +  V+ T + F       Q V ++ D LL    + + 
Sbjct: 238 SILSNVDKVTKDVASASSDIQGIMETVQSTARNFEAASTEVQTVVKRADELL----ASVD 293

Query: 294 SKETSAFLENIADSTSNMRSSISAIREITD----QRQKIISTINTIENITSNLNDSSQKF 349
             + S  + +++ +T++ R +++  + I D    +R  I   ++    +   LN +S + 
Sbjct: 294 PAKVSTVVGDVSAATADARDAVANFKRIADDVGARRADIDQAVSDFTEMGRKLNLASSRV 353

Query: 350 AELMSKINNISALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQ 409
             +++K++ +    + NSLF  A+  + +F+  ++ +N  I  I +NL  FS SGL D Q
Sbjct: 354 DGILAKVDGMLGTDDANSLFAKARETLTSFKAVADNLNARIGPIADNLTRFSSSGLKDFQ 413

Query: 410 NLVRKLQETVNHFDDCLNNFERNPQDIVWGREKGSVKIYKPK 451
            L+   ++TV++ ++ + N +R+PQ +++G E  +VK Y  +
Sbjct: 414 ALIGSTRQTVDNLNNAITNIDRDPQRLIFGGE--TVKQYDGR 453


>gi|150396762|ref|YP_001327229.1| hypothetical protein Smed_1552 [Sinorhizobium medicae WSM419]
 gi|150028277|gb|ABR60394.1| Mammalian cell entry related domain protein [Sinorhizobium medicae
           WSM419]
          Length = 458

 Score =  235 bits (600), Expect = 8e-60,   Method: Compositional matrix adjust.
 Identities = 144/464 (31%), Positives = 245/464 (52%), Gaps = 24/464 (5%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYD--GPMAEVIIRIPGSVDGLSTDSSV 58
           ME+K  Y  VG F V ++  +F  +YW+S   QY   G M ++++ IPGS +GLS  S V
Sbjct: 3   METKANYAIVGFFTVLVIAAAFGFVYWMS---QYGRTGQMVQLVVNIPGSANGLSVGSPV 59

Query: 59  RFNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLR 118
           RFNGI VG +  L +D   P +S+A   +  D P+  STTAT+  QGL G  YIELS  R
Sbjct: 60  RFNGINVGSVRNLAIDANDPRYSIAITEVSADAPVMKSTTATLEVQGLTGAAYIELSGGR 119

Query: 119 KEKKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTT 178
           K  + I + A ER  +A I A  S +   ++ A+    + + +   IQ  + ++  PLT+
Sbjct: 120 KGDENILKTALERGTQAHILADQSSVTSLLATADQILDRANSAITDIQSFVTDVRGPLTS 179

Query: 179 TIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQK 238
           TI N E  S  LA+N   ID+ + + +    S ++ +    + D +   D++IKA+D +K
Sbjct: 180 TIGNAERFSKALADNSDAIDQFLESVEQLSGSVNAAS--KKLDDTLAGADRLIKAVDPKK 237

Query: 239 VNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVG-------QKIDHLLSDFSSK 291
           +  I+ N +  SNN   +S +V  TV   + T +T+ + G       +++D L+    + 
Sbjct: 238 IENIVGNAEQVSNNLKNASGEVTETVASFQRTLETYNQFGKNAQQTLERVDALV----AA 293

Query: 292 MKSKETSAFLENIADSTSNMR---SSISAIREITDQRQKIIS-TINTIENITSNLNDSSQ 347
           + S++    + +I  ++++ R   + +S   E    RQ  I  TI     +++ LN +S 
Sbjct: 294 VDSQKVGLVVNDITAASADARKVAAQVSDFAEKISARQGDIDQTITDFTQMSNKLNAASG 353

Query: 348 KFAELMSKINNISALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLND 407
           +   ++ KI+      +  SL   A+  + +FR  +E +N  +  I  NL+ FS SGL D
Sbjct: 354 RVDSILVKIDGFLGDADAPSLSAQARETLESFRRVAENLNAQLGPIAENLKRFSNSGLRD 413

Query: 408 IQNLVRKLQETVNHFDDCLNNFERNPQDIVWGREKGSVKIYKPK 451
           ++ L+   + TV    + ++ F++NPQ +++G E  +VK Y  +
Sbjct: 414 VEALIGDTRRTVQGLQNTISEFDKNPQRLLFGGE--TVKQYDGR 455


>gi|15965584|ref|NP_385937.1| hypothetical protein SMc00176 [Sinorhizobium meliloti 1021]
 gi|15074765|emb|CAC46410.1| Conserved hypothetical protein [Sinorhizobium meliloti 1021]
          Length = 458

 Score =  235 bits (600), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 143/464 (30%), Positives = 242/464 (52%), Gaps = 24/464 (5%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K  Y  VG F V ++  +F  +YW+S+  +  G M E+++ IPGS +GLS  S VRF
Sbjct: 3   METKANYAIVGFFTVLVIAAAFGFVYWMSQYGRT-GQMVELVVNIPGSANGLSVGSPVRF 61

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NGI VG +  L +D   P +S+A   +  D P+  STTAT+  QGL G  YIELS  RK 
Sbjct: 62  NGINVGSVRNLAIDANDPRYSIAITEVSADAPVMKSTTATLEVQGLTGAAYIELSGGRKG 121

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
            + I + A E+  +A I A  S +   ++ A+    + + +   IQ  + ++  PLT+TI
Sbjct: 122 DENILKTALEKGTQAHILADQSSVTSLLATADQILDRANSAITDIQSFVTDVRGPLTSTI 181

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
            N E  S  LA+N   ID+ + + +    S ++ +    + D + S D++IK++D +K++
Sbjct: 182 GNAERFSKALADNSGAIDQFLKSVEQLSGSVNAAS--KKLDDTLASADRLIKSVDPKKID 239

Query: 241 QILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVG-------QKIDHLLSDFSSKMK 293
            I+ N +  SNN   +S  V   +   R T +T+ + G       +++D L++   ++  
Sbjct: 240 NIVSNAEQVSNNLKDASGGVSEAIAGFRRTVETYDQFGKSAQETLKRVDTLVAAVDAQKV 299

Query: 294 S------KETSAFLENIADSTSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQ 347
                     SA    +A   S+    ISA ++  DQ      TI     +++ LN +S 
Sbjct: 300 GLVVNDITAASADARKVAAQVSDFAEKISARQDDIDQ------TITDFTQMSNKLNAASN 353

Query: 348 KFAELMSKINNISALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLND 407
           +   ++ KI+      +  SL   A+  + +FR  +E +N  +  I  NL+ FS SGL D
Sbjct: 354 RVDSILVKIDGFLGDADAPSLSAQARETLESFRRVAENLNAQLGPIAENLKRFSNSGLRD 413

Query: 408 IQNLVRKLQETVNHFDDCLNNFERNPQDIVWGREKGSVKIYKPK 451
           ++ LV   + TV    + +++F++NPQ +++G E  +VK Y  +
Sbjct: 414 VEALVGDTRRTVQSLQNTISDFDKNPQRLLFGGE--TVKQYDGR 455


>gi|307302704|ref|ZP_07582460.1| Mammalian cell entry related domain protein [Sinorhizobium meliloti
           BL225C]
 gi|307318552|ref|ZP_07597986.1| Mammalian cell entry related domain protein [Sinorhizobium meliloti
           AK83]
 gi|306895892|gb|EFN26644.1| Mammalian cell entry related domain protein [Sinorhizobium meliloti
           AK83]
 gi|306903068|gb|EFN33659.1| Mammalian cell entry related domain protein [Sinorhizobium meliloti
           BL225C]
          Length = 456

 Score =  235 bits (600), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 143/464 (30%), Positives = 242/464 (52%), Gaps = 24/464 (5%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K  Y  VG F V ++  +F  +YW+S+  +  G M E+++ IPGS +GLS  S VRF
Sbjct: 1   METKANYAIVGFFTVLVIAAAFGFVYWMSQYGRT-GQMVELVVNIPGSANGLSVGSPVRF 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NGI VG +  L +D   P +S+A   +  D P+  STTAT+  QGL G  YIELS  RK 
Sbjct: 60  NGINVGSVRNLAIDANDPRYSIAITEVSADAPVMKSTTATLEVQGLTGAAYIELSGGRKG 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
            + I + A E+  +A I A  S +   ++ A+    + + +   IQ  + ++  PLT+TI
Sbjct: 120 DENILKTALEKGTQAHILADQSSVTSLLATADQILDRANSAITDIQSFVTDVRGPLTSTI 179

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
            N E  S  LA+N   ID+ + + +    S ++ +    + D + S D++IK++D +K++
Sbjct: 180 GNAERFSKALADNSGAIDQFLKSVEQLSGSVNAAS--KKLDDTLASADRLIKSVDPKKID 237

Query: 241 QILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVG-------QKIDHLLSDFSSKMK 293
            I+ N +  SNN   +S  V   +   R T +T+ + G       +++D L++   ++  
Sbjct: 238 NIVSNAEQVSNNLKDASGGVSEAIAGFRRTVETYDQFGKSAQETLKRVDTLVAAVDAQKV 297

Query: 294 S------KETSAFLENIADSTSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQ 347
                     SA    +A   S+    ISA ++  DQ      TI     +++ LN +S 
Sbjct: 298 GLVVNDITAASADARKVAAQVSDFAEKISARQDDIDQ------TITDFTQMSNKLNAASN 351

Query: 348 KFAELMSKINNISALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLND 407
           +   ++ KI+      +  SL   A+  + +FR  +E +N  +  I  NL+ FS SGL D
Sbjct: 352 RVDSILVKIDGFLGDADAPSLSAQARETLESFRRVAENLNAQLGPIAENLKRFSNSGLRD 411

Query: 408 IQNLVRKLQETVNHFDDCLNNFERNPQDIVWGREKGSVKIYKPK 451
           ++ LV   + TV    + +++F++NPQ +++G E  +VK Y  +
Sbjct: 412 VEALVGDTRRTVQSLQNTISDFDKNPQRLLFGGE--TVKQYDGR 453


>gi|227822229|ref|YP_002826200.1| putative solute-binding component of ABC transporter [Sinorhizobium
           fredii NGR234]
 gi|227341229|gb|ACP25447.1| putative solute-binding component of ABC transporter [Sinorhizobium
           fredii NGR234]
          Length = 456

 Score =  233 bits (594), Expect = 5e-59,   Method: Compositional matrix adjust.
 Identities = 138/462 (29%), Positives = 245/462 (53%), Gaps = 20/462 (4%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K  Y  VG F V ++  +F  +YW+S+  +  G M E+++ IPGS +GLS  S VRF
Sbjct: 1   METKANYAIVGFFTVFVIAAAFGFVYWMSQYGR-SGEMVELVVNIPGSANGLSVGSPVRF 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NGI VG +  L +D   P +S+A   +  D P+  ST AT+  QGL G  YIELS  RK 
Sbjct: 60  NGINVGSVRSLAIDANDPRYSIAITEVSADAPVLKSTKATLEIQGLTGAAYIELSGGRKG 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
            + I + A E   +A I A  S +   ++ A+    + + +   IQ  +  +  PLT TI
Sbjct: 120 DENILKSALENGTQARILADQSSVTSLLATADQILDRANSAIGDIQGFVTEVRGPLTATI 179

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
            N +  S  LA+N   ID+ + + Q    S  + +    + D + S D++IK++D +K++
Sbjct: 180 GNAQRFSKALADNSDAIDQFLKSVQELSGSVSAAS--KKLDDTLASADRLIKSVDPKKID 237

Query: 241 QILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVG-------QKIDHLLSDFSSKMK 293
            I+ N++  SN+   +S  V   +   R T  T+ + G       +++D L+    + + 
Sbjct: 238 TIVSNVEDVSNDLKAASGGVSEAIAGFRRTVDTYDQFGKNAQETLKRVDALV----AAVD 293

Query: 294 SKETSAFLENIADSTSNMRSSISAIRE----ITDQRQKIISTINTIENITSNLNDSSQKF 349
           +++    + +I+ ++++ R   + + E    I+ +++ I  TI     +++ LN +S + 
Sbjct: 294 TQKVGLVVNDISAASADARKVAAQVSEFANKISARQEDIDQTITDFTEMSNKLNAASNRV 353

Query: 350 AELMSKINNISALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQ 409
             ++ K++         SL  +A+  + +FR  ++ +N  I  I +NL+ FS SGL D++
Sbjct: 354 DSILVKVDGFLGDANAPSLSAEARSTLESFRRMADNLNAQIGPIADNLKRFSNSGLRDVE 413

Query: 410 NLVRKLQETVNHFDDCLNNFERNPQDIVWGREKGSVKIYKPK 451
            LV + + TV      ++NF+RNPQ +++G E  +VK Y  +
Sbjct: 414 TLVTETRRTVQSLQSTISNFDRNPQRLLFGGE--TVKQYDGR 453


>gi|163759628|ref|ZP_02166713.1| ABC transporter, substrate binding protein [Hoeflea phototrophica
           DFL-43]
 gi|162283225|gb|EDQ33511.1| ABC transporter, substrate binding protein [Hoeflea phototrophica
           DFL-43]
          Length = 456

 Score =  219 bits (559), Expect = 6e-55,   Method: Compositional matrix adjust.
 Identities = 125/459 (27%), Positives = 239/459 (52%), Gaps = 14/459 (3%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++  Y  VG F V ++  +F  +YW++R     G   ++++RIPGS +GLS  S V F
Sbjct: 1   METRANYAIVGFFTVLVMVSAFGFVYWMARYGGT-GDTTQLVVRIPGSANGLSVGSPVHF 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NGIP G +  L +D   PN  +A  ++R D P+Y  T A +  QGL G  YIEL      
Sbjct: 60  NGIPYGVVRRLNIDPNSPNFVIADTVVRSDAPIYTDTRAALEIQGLTGSAYIELQGGTPS 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
              I   A   +  A+I A PSG+   ++ A+    +++     ++  +E    PLT T+
Sbjct: 120 NPNILDQAISDSGVAVIEADPSGVTNLLATADEILTRVNRVIGEVEGFVEEARSPLTGTL 179

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
            N E+ S  L++N   ID+ + +  V+  S   ++    +   + S +++I A+D  +V 
Sbjct: 180 RNAESFSAALSDNADGIDEFLKS--VSALSGTVQSLSVKLEGTLGSAERLINAVDPDQVR 237

Query: 241 QILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQ----EVGQKIDHLLSDFSSKMKSKE 296
            I+ ++   + +   SS  +I T+  +R T Q+ +    + G  +D + +  +S   +K 
Sbjct: 238 NIVSSVDKVTGDLAASSGDIIKTLESLRGTAQSLEQFVTDAGASLDKVDAVIASVDPAK- 296

Query: 297 TSAFLENIADSTSNMRSSISAIREITD----QRQKIISTINTIENITSNLNDSSQKFAEL 352
               ++NI  ++++ R +++  R + +    +++     I  ++ ++  LN +S++   +
Sbjct: 297 VGEVMDNITVASADARQTLADARGVAETFGARKEDFDLIITDVKEMSGRLNAASERVDGV 356

Query: 353 MSKINNISALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLV 412
           ++K++      + +SL  DA+  + +FR+ +  +N  I  I +NLQ FS SGL D++ LV
Sbjct: 357 LAKLDGFLGEGDASSLIADAEETLKSFREVANSLNARIGPIADNLQRFSGSGLRDVEALV 416

Query: 413 RKLQETVNHFDDCLNNFERNPQDIVWGREKGSVKIYKPK 451
              + ++   +  + + ER+PQ +++G E  +VK Y  +
Sbjct: 417 NDARRSIQRIEQSITSIERDPQRLLFGGE--TVKQYDGR 453


>gi|218458932|ref|ZP_03499023.1| putative ABC transporter, substrate-binding protein [Rhizobium etli
           Kim 5]
          Length = 296

 Score =  194 bits (493), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 103/285 (36%), Positives = 160/285 (56%), Gaps = 3/285 (1%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K  YT VG F V ++  +F  +YW++   +  GPM E+I+RIPGS +GLS  S VRF
Sbjct: 1   METKANYTIVGFFTVLVIAAAFGFVYWMAEYGR-GGPMTELIVRIPGSANGLSVGSPVRF 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NGI +G +  L +D + P +SLA   +R D P+YPST A +  QGL G  YIELS  RK 
Sbjct: 60  NGIQIGSVQTLSIDADDPQYSLAFTQVRTDAPIYPSTKAALEIQGLTGAAYIELSGGRKG 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
           +++I Q A + N+RA+I A  S +   ++ A+    + +D+   +Q  IE+   PLT T 
Sbjct: 120 EESILQHAIDNNKRAVIVADQSSVTNLLATADKILDRANDAVGELQGFIEDSRAPLTQTF 179

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
            N ET S  LA N  +ID  + +  V   S   K     +   + +++ ++KA+D QK++
Sbjct: 180 KNAETFSDALAKNSDNIDAFLQS--VGELSDTVKAVSGRVDSTLQAVESLVKAVDAQKID 237

Query: 241 QILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLL 285
           +I+ N +  + N   +S  +   +    ET  TF + G++    L
Sbjct: 238 RIVSNAERITANVADASGDLRGAIQKFDETATTFNDFGKQAQATL 282


>gi|218513900|ref|ZP_03510740.1| putative ABC transporter, substrate-binding protein [Rhizobium etli
           8C-3]
          Length = 255

 Score =  180 bits (457), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 95/257 (36%), Positives = 148/257 (57%), Gaps = 3/257 (1%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K  YT VG F V ++  +F  +YW++   +  GPM E+I+RIPGS +GLS  S VRF
Sbjct: 1   METKANYTIVGFFTVLVIAAAFGFVYWMAEYGR-GGPMTELIVRIPGSANGLSVGSPVRF 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NGI +G +  L +D + P +SLA   +R D P+YPST A +  QGL G  YIELS  RK 
Sbjct: 60  NGIQIGSVQTLSIDADDPQYSLAFTQVRTDAPIYPSTKAALEIQGLTGAAYIELSGGRKG 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
           +++I Q A +  +RA+I A  S +   ++ A+    + +D+   +Q  I++   PLT T 
Sbjct: 120 EESILQHAIDNGKRAVIVADQSSVTNLLATADKILDRANDAVGELQGFIQDSRAPLTQTF 179

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
            N ET S  LA N  +ID  + +  V   S+  K     +   + +++ ++KA+D QK++
Sbjct: 180 KNAETFSDALAKNSDNIDAFLQS--VGELSNTVKAVSGRVDSTLQAVESLVKAVDAQKID 237

Query: 241 QILENIQVSSNNFVKSS 257
            I+ N +  + N   +S
Sbjct: 238 HIVSNAERITANVADAS 254


>gi|110633895|ref|YP_674103.1| hypothetical protein Meso_1542 [Mesorhizobium sp. BNC1]
 gi|110284879|gb|ABG62938.1| Mammalian cell entry related protein [Chelativorans sp. BNC1]
          Length = 458

 Score =  172 bits (437), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 117/463 (25%), Positives = 226/463 (48%), Gaps = 20/463 (4%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K  Y  VG+F +  +  +F  +YW +     +   A +  RIPGS  GL T S+V F
Sbjct: 1   METKANYVIVGIFTIVAILAAFGFVYWTAGVGN-NSNTAPIRFRIPGSAAGLVTGSAVLF 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITY----IELST 116
           NG+ VG +  ++LD   P  ++A A +    P+ PST A +   GLA +T     I+L+ 
Sbjct: 60  NGVRVGTVERVYLDGNNPGIAIADARVDRTAPITPSTKADV---GLASLTTGQANIDLTG 116

Query: 117 LRKEKKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPL 176
              ++  +  +A E+   A++TA PS ++  + +A++   +       ++  + +   PL
Sbjct: 117 GNPQEPKLITLAEEQGTIAVMTANPSAVSNLLQSAQSLMSRADSVVGELENFVSDARGPL 176

Query: 177 TTTIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDL 236
           T T+ N+E  S  LA N   ID  +    V   S         +   ++S +++I ++D 
Sbjct: 177 TQTVRNVEAFSNALARNSEGIDNFL--ANVGELSESISGVSGQLESTLSSAEELINSVDR 234

Query: 237 QKVNQILENIQVSSNNFVKSSDQ---VINTVHDVRETTQTFQ----EVGQKIDHLLSDFS 289
            ++++I+EN+   +      S Q   +   V+D   +  +F     E  Q++D L++   
Sbjct: 235 NEISKIVENLGTFTERLGDVSGQFDTIATGVNDALGSLSSFSTQAGETLQRVDRLVAGID 294

Query: 290 SKMKSKETSAFLENIADSTSNMRSSISAIRE-ITDQRQKIISTINTIENITSNLNDSSQK 348
               ++  S F E  + + +   + I+ + E ++D+   I   I     + S LN +S +
Sbjct: 295 PDQLTETLSNF-EEASQAINKASAEIAEVAETVSDRTDDIDQFITDARELASRLNAASVR 353

Query: 349 FAELMSKINNISALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDI 408
              +++K++ +    E   LF +A   +  FR T++ +N  +  I + L  FS  GL D+
Sbjct: 354 VDGVLAKLDGMLGSGEGQDLFAEASSTLRAFRQTADTLNARLGPITDGLTRFSGQGLRDV 413

Query: 409 QNLVRKLQETVNHFDDCLNNFERNPQDIVWGREKGSVKIYKPK 451
           + LV   +  ++  +  +++ E+NPQ I+ G + G+++ Y  +
Sbjct: 414 EALVGDARRAISRIESAVSDLEQNPQRIITGGD-GTIRRYDGR 455


>gi|13470957|ref|NP_102526.1| hypothetical protein mll0798 [Mesorhizobium loti MAFF303099]
 gi|14021700|dbj|BAB48312.1| mll0798 [Mesorhizobium loti MAFF303099]
          Length = 457

 Score =  171 bits (434), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 115/465 (24%), Positives = 221/465 (47%), Gaps = 25/465 (5%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++  Y  VG+F +  +  +F  +YW +      G    + +RIPGS  GL   S V F
Sbjct: 1   METRANYVIVGIFTLVAILAAFGFVYWTAAIGDR-GETTLLRVRIPGSASGLGRGSFVLF 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NG+ VG +  +++D + P  ++A   I   TP+  ST A I   GL G   IEL     +
Sbjct: 60  NGVKVGDVKRVYIDVDNPTVAIADTEIDRLTPITKSTQADIGLAGLTGQANIELKGADPK 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
           +  +   A +  + A I A PS +   +  A+N   +       ++    ++  PLT T+
Sbjct: 120 EVKLLDQAEKEGKVAEIVANPSAVTNLLQTAQNIFSRADKVLSELEGFTRDVRGPLTQTV 179

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
            N++T S  LA N   IDK + +  V+  S + K     +   + + + ++ A+D  K+ 
Sbjct: 180 QNVQTFSDALAKNSDGIDKFLSS--VSALSEELKGVSGKLDGTLKAAEGLLNAVDRDKIK 237

Query: 241 QILENIQVSSNNF----------VKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSS 290
            I+ N+   + N           +K+ D  + +V+D  + TQ       K+D +L     
Sbjct: 238 SIVANVDTVTANLKQTSQQLDGVIKNVDTAVGSVNDFAKQTQGTLA---KVDGVL----D 290

Query: 291 KMKSKETSAFLENIADSTSNMRSSISAIREITDQ----RQKIISTINTIENITSNLNDSS 346
            +   +  A L NI  ++ N   + + I  +T++       I  TI   + +   LND+S
Sbjct: 291 GVDPAQVRAALANIQKASENANKAAADIAVVTEKFANRADDIDQTIKDAKQLAQRLNDAS 350

Query: 347 QKFAELMSKINNISALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLN 406
            +   ++++++ +    + + L  DA+  + +F+  ++ +N  +  I +NL  FS  GL+
Sbjct: 351 VRVDGILARVDTLLGSGQADGLMADARDTLKSFKQVADTLNARLGVITDNLARFSGQGLS 410

Query: 407 DIQNLVRKLQETVNHFDDCLNNFERNPQDIVWGREKGSVKIYKPK 451
           +++ LV+  + ++   ++ + +  RNPQ I+ G + G V+ +  +
Sbjct: 411 NVEALVQDSRRSITRIEEAVTDLSRNPQRILSGGD-GEVRQFDGR 454


>gi|260463970|ref|ZP_05812166.1| Mammalian cell entry related domain protein [Mesorhizobium
           opportunistum WSM2075]
 gi|259030345|gb|EEW31625.1| Mammalian cell entry related domain protein [Mesorhizobium
           opportunistum WSM2075]
          Length = 457

 Score =  170 bits (431), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 114/465 (24%), Positives = 221/465 (47%), Gaps = 25/465 (5%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++  Y  VG+F +  +  +F  +YW +      G    + +RIPGS  GL   S V F
Sbjct: 1   METRANYVIVGIFTLVAILAAFGFVYWTAAIGDR-GETTLLRVRIPGSASGLGRGSFVLF 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NG+ VG +  +++D + P  ++A   I   TP+  ST A I   GL G   IEL     +
Sbjct: 60  NGVKVGDVKRVYIDVDNPTVAIADTEIDRMTPITKSTQADIGLAGLTGQANIELKGADPK 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
           +  +   A +  + A I A PS +   +  A+N   +       ++   +++  PLT T+
Sbjct: 120 EVKLLDQAEKEGKVAEIVANPSAVTNLLQTAQNIFNRADKVLSELEGFTKDVRGPLTQTV 179

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
            N++T S  LA N   IDK + +  V+  S + K     +   + + + ++ A+D  K+ 
Sbjct: 180 KNVQTFSDALAKNSDGIDKFLSS--VSALSDELKGVSGKLDGTLKAAEGLLNAVDKDKIK 237

Query: 241 QILENIQVSSNNF----------VKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSS 290
            I+ N+   + N           +K+ D  + +V+D  + TQ       K+D +L     
Sbjct: 238 SIVANVDTVTANLKQTSQQLDGVIKNVDTAVGSVNDFAKQTQGTLA---KVDGVL----D 290

Query: 291 KMKSKETSAFLENIADSTSNMRSSISAIREITDQ----RQKIISTINTIENITSNLNDSS 346
            +   +    L NI  ++ N   + + I  +T++       I  TI   + +   LND+S
Sbjct: 291 GIDPAQVRTALANIQKASENANKAAADIAVVTNKFANRADDIDQTIKDAKQLARRLNDAS 350

Query: 347 QKFAELMSKINNISALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLN 406
            +   ++++++ +    + + +  DA+  + +F+  ++ +N  +  I +NL  FS  GL 
Sbjct: 351 VRVDGILARVDKLLGSGQADGVMADARATLKSFKQVADTLNARLGVITDNLARFSGQGLT 410

Query: 407 DIQNLVRKLQETVNHFDDCLNNFERNPQDIVWGREKGSVKIYKPK 451
           +++ LV+  + ++N  ++ + +  RNPQ I+ G + G V+ +  +
Sbjct: 411 NVEALVQDSRRSINRIEEAVTDLSRNPQRILSGGD-GEVRQFDGR 454


>gi|319783793|ref|YP_004143269.1| hypothetical protein Mesci_4106 [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317169681|gb|ADV13219.1| Mammalian cell entry related domain protein [Mesorhizobium ciceri
           biovar biserrulae WSM1271]
          Length = 457

 Score =  163 bits (413), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 112/465 (24%), Positives = 225/465 (48%), Gaps = 25/465 (5%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++  Y  VG+F ++ +  +F  +YW +      G    + +RIPGS  GL   S V F
Sbjct: 1   METRANYVIVGIFTLAAILAAFAFVYWTAAIGDK-GETTLLRVRIPGSASGLGRGSFVLF 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NG+ VG +  +++D + P  ++A   I   TP+  ST A I   GL G   IEL     +
Sbjct: 60  NGVKVGDVKRVYIDVDNPTVAIADTEIDRMTPITKSTQADIGLAGLTGQANIELKGADPK 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
           +  +   A +  + A I A PS +   +  A+N   +       ++   +++  PLT T+
Sbjct: 120 EVKLLDQAEKEGKVAEIVANPSAVTNLLQTAQNIFTRADKVLTELEGFTKDVRGPLTQTV 179

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
            N++T S  LA N   IDK +  +  +  + + K     +   + + + ++ A+D  K+ 
Sbjct: 180 QNVQTFSDALAKNSDGIDKFL--SAASTLADELKGVSGKLDGTLKAAEGLLNAVDKDKIK 237

Query: 241 QILENIQVSSNNF----------VKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSS 290
            I+ N+   + N           +K+ D  + +V+D  + TQ       K+D++L     
Sbjct: 238 SIVANVDAVTGNLKETSKQLDGVIKNVDTAVGSVNDFAKRTQGTLA---KVDNVL----D 290

Query: 291 KMKSKETSAFLENIADSTSNMRSSISAIREIT----DQRQKIISTINTIENITSNLNDSS 346
            +   +  + L NI  ++ +   + + I E+T    ++   I  TI   + +   LND+S
Sbjct: 291 GIDPAQVRSALANIQKASESADKAAADIAEVTHKFANRADDIDQTIKDAKQLAQRLNDAS 350

Query: 347 QKFAELMSKINNISALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLN 406
            +   +++K++ +    + + +  DA+  + +F+  ++ +N  +  I +NL  FS  GL+
Sbjct: 351 VRVDGILAKVDTLLGSGQADGVMADARATLKSFKQVADTLNARLGVITDNLARFSGQGLS 410

Query: 407 DIQNLVRKLQETVNHFDDCLNNFERNPQDIVWGREKGSVKIYKPK 451
           +++ LV+  + +++  ++ + +  RNPQ I+ G + G V+ +  +
Sbjct: 411 NVEALVQDSRRSISRIEEAVTDLSRNPQRILSGGD-GEVRQFDGR 454


>gi|218679529|ref|ZP_03527426.1| putative ABC transporter, substrate-binding protein [Rhizobium etli
           CIAT 894]
          Length = 177

 Score =  146 bits (369), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 73/177 (41%), Positives = 108/177 (61%), Gaps = 1/177 (0%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K  YT VG F V ++  +F  +YW++   +  GPM E+I+RIPGS +GLS  S VRF
Sbjct: 1   METKANYTIVGFFTVLVIAAAFGFVYWMAEYGR-GGPMTELIVRIPGSANGLSVGSPVRF 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NGI +G +  L +D + P +SLA   +R D P+YPST A +  QGL G  YIELS  RK 
Sbjct: 60  NGIQIGSVQTLSIDADDPQYSLAFTQVRTDAPIYPSTKAALEIQGLTGAAYIELSGGRKG 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLT 177
           +++I Q A +  +RA+I A  S +   ++ A+    + +D+   +Q  I++   PLT
Sbjct: 120 EESILQHAIDNGKRAVIVADQSSVTNLLATADKILDRANDAVGELQGFIQDSRAPLT 176


>gi|239831969|ref|ZP_04680298.1| Hypothetical protein, conserved [Ochrobactrum intermedium LMG 3301]
 gi|239824236|gb|EEQ95804.1| Hypothetical protein, conserved [Ochrobactrum intermedium LMG 3301]
          Length = 331

 Score =  128 bits (322), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 85/269 (31%), Positives = 141/269 (52%), Gaps = 17/269 (6%)

Query: 1   MESKNYYTSVGLF--VVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSV 58
           ME+K  Y  VG+F  +VS+L F+F  ++W++R  +    + E+ +RIPGSV GLS  S V
Sbjct: 1   METKANYVLVGVFTLIVSLLAFAF--VFWIARFGEARDSL-ELDVRIPGSVTGLSIGSQV 57

Query: 59  RFNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLR 118
            FNGI VG +  L LD+  P   + K  +   TP+  ST AT+  QGL G  YIEL   R
Sbjct: 58  LFNGIKVGDVRALHLDETNPEMVIVKTRVNATTPITRSTAATLGFQGLTGQAYIELKGGR 117

Query: 119 KEKKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTT 178
            ++  +   A + +  A I A PS IN  ++ A++ + + +     ++  +++   PLT 
Sbjct: 118 LDEPNLLTEAAKVDSVARIDADPSSINNLLATAQDIAARANSVLGQLEGFVKDARGPLTD 177

Query: 179 TIANIETISTVLANNISHIDKMMHTT----QVTPHSSDSKNTFNT----ITDLITSLDKM 230
           TI N +T +  LA N + I+++   T    Q+   + D     N     +  ++   DK+
Sbjct: 178 TINNTKTFTDALAKNANIIEELGQNTGNINQIVTDAKDMMARLNAASVRVDAILAKTDKL 237

Query: 231 IKAID----LQKVNQILENIQVSSNNFVK 255
           + + D    + +    LE+I+ +S+N  K
Sbjct: 238 LSSDDKDGVVAQAKATLESIRQTSDNLDK 266



 Score = 62.8 bits (151), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 31/134 (23%), Positives = 72/134 (53%), Gaps = 1/134 (0%)

Query: 318 IREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNISALKENNSLFKDAQRAMH 377
           I E+      I   +   +++ + LN +S +   +++K + + +  + + +   A+  + 
Sbjct: 196 IEELGQNTGNINQIVTDAKDMMARLNAASVRVDAILAKTDKLLSSDDKDGVVAQAKATLE 255

Query: 378 TFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFERNPQDIV 437
           + R TS+ +++ +  I +NLQ FS  GL D+Q++V   + ++   +  + + ERNPQ ++
Sbjct: 256 SIRQTSDNLDKRLGPIADNLQRFSGQGLRDVQSVVVDSRRSIQRIEQAITDLERNPQRLI 315

Query: 438 WGREKGSVKIYKPK 451
           +G  +G+V  Y  +
Sbjct: 316 FG-GQGNVPRYDGR 328


>gi|153009439|ref|YP_001370654.1| hypothetical protein Oant_2109 [Ochrobactrum anthropi ATCC 49188]
 gi|151561327|gb|ABS14825.1| Mammalian cell entry related domain protein [Ochrobactrum anthropi
           ATCC 49188]
          Length = 331

 Score =  125 bits (313), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 85/269 (31%), Positives = 138/269 (51%), Gaps = 17/269 (6%)

Query: 1   MESKNYYTSVGLF--VVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSV 58
           ME+K  Y  VG+F  +VS+L F+F  ++W++R  +      E+ +RIPGSV GLS  S V
Sbjct: 1   METKANYVLVGVFTLIVSLLAFAF--VFWIARFGEARDSQ-ELDVRIPGSVTGLSLGSQV 57

Query: 59  RFNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLR 118
            FNGI VG +  L LD+  P   + K  +   TP+  ST AT+  QGL G  YIEL   R
Sbjct: 58  LFNGIKVGDVRALKLDETNPEMVIVKTRVNATTPITRSTAATLGFQGLTGQAYIELKGGR 117

Query: 119 KEKKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTT 178
            ++  +   A   +  A I A PS IN  ++ A++ + + +     ++  +++   PLT 
Sbjct: 118 LDEPNLLTEAANVDSVARIDADPSSINNLLATAQDIAARANAVLGQLEGFVKDARGPLTD 177

Query: 179 TIANIETISTVLANNISHIDKMMHTT----QVTPHSSDSKNTFNT----ITDLITSLDKM 230
           TI N +T +  LA N + I ++   T    Q+   + D     N     +  ++   DK+
Sbjct: 178 TINNTKTFTDALAQNANIIQELGENTGNINQIVTDAKDMMARLNAASVRVDAILAKTDKL 237

Query: 231 IKAID----LQKVNQILENIQVSSNNFVK 255
           + + D    + +    LE+I+ +S+N  K
Sbjct: 238 LSSDDKDGVVAQAKATLESIRQTSDNLDK 266



 Score = 65.1 bits (157), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 32/134 (23%), Positives = 74/134 (55%), Gaps = 1/134 (0%)

Query: 318 IREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNISALKENNSLFKDAQRAMH 377
           I+E+ +    I   +   +++ + LN +S +   +++K + + +  + + +   A+  + 
Sbjct: 196 IQELGENTGNINQIVTDAKDMMARLNAASVRVDAILAKTDKLLSSDDKDGVVAQAKATLE 255

Query: 378 TFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFERNPQDIV 437
           + R TS+ +++ +  I +NLQ FS  GL D+Q++V   + ++   +  + + ERNPQ ++
Sbjct: 256 SIRQTSDNLDKRMGPIADNLQRFSGQGLRDVQSVVVDSRRSIQRIEQAITDLERNPQRLI 315

Query: 438 WGREKGSVKIYKPK 451
           +G  KG+V  Y  +
Sbjct: 316 FG-GKGNVPQYDGR 328


>gi|225627499|ref|ZP_03785536.1| Hypothetical protein, conserved [Brucella ceti str. Cudo]
 gi|260168731|ref|ZP_05755542.1| ABC transporter, periplasmic substrate-binding protein, putative
           [Brucella sp. F5/99]
 gi|261758209|ref|ZP_06001918.1| ABC transporter [Brucella sp. F5/99]
 gi|225617504|gb|EEH14549.1| Hypothetical protein, conserved [Brucella ceti str. Cudo]
 gi|261738193|gb|EEY26189.1| ABC transporter [Brucella sp. F5/99]
          Length = 331

 Score =  122 bits (305), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 85/299 (28%), Positives = 138/299 (46%), Gaps = 26/299 (8%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K  Y  VG+F + +   +F  +YW++R  +    +  + +RI GSV GL   S V F
Sbjct: 1   METKANYVLVGVFTLLVSLLAFGFVYWIARYGEARDSL-PLDVRIQGSVTGLGIGSQVLF 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NGI VG +  L LD   P   + +  +   TP+  STTAT+  QGL G  YIEL   R +
Sbjct: 60  NGIKVGDVRRLHLDDSNPGMVIVQTRVNATTPITRSTTATLGFQGLTGQAYIELKGGRLD 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
           +  +   A + +  A I A PS +N  ++ A++ + + ++    ++  +++   PLT TI
Sbjct: 120 EPNLLTEAAKEDTVARINADPSAVNNLLATAQDIAARANNVLSQLEGFVKDARGPLTDTI 179

Query: 181 ANIETISTVLANNISHIDKMMHTT----QVTPHSSDSKNTFNT----ITDLITSLDKMIK 232
            N +T +  LA+N   I ++        Q+   + D     N     +  ++   DKM+ 
Sbjct: 180 NNTKTFTQALADNADIIQELGQNAGNIRQIVVDAKDMMARLNAASVKVESILNKTDKMLS 239

Query: 233 AIDLQKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSK 291
           A D               N  V    Q I T+  +RET+         I + L  FS +
Sbjct: 240 ADD--------------KNGLVA---QAITTLQSIRETSNNLDARLAPIANNLDRFSGQ 281



 Score = 61.6 bits (148), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 43/188 (22%), Positives = 85/188 (45%), Gaps = 17/188 (9%)

Query: 273 TFQEVGQKIDHLLSDFSSKMKSKE---------TSAFLENIADSTSNMRSSISAIREITD 323
           T Q++  + +++LS     +K            T  F + +AD+          I+E+  
Sbjct: 149 TAQDIAARANNVLSQLEGFVKDARGPLTDTINNTKTFTQALADNAD-------IIQELGQ 201

Query: 324 QRQKIISTINTIENITSNLNDSSQKFAELMSKINNISALKENNSLFKDAQRAMHTFRDTS 383
               I   +   +++ + LN +S K   +++K + + +  + N L   A   + + R+TS
Sbjct: 202 NAGNIRQIVVDAKDMMARLNAASVKVESILNKTDKMLSADDKNGLVAQAITTLQSIRETS 261

Query: 384 EKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFERNPQDIVWGREKG 443
             ++  +  I NNL  FS  GL ++Q +V   +  +   +  +   ERNPQ +++G   G
Sbjct: 262 NNLDARLAPIANNLDRFSGQGLREMQGVVIDSRRAIQRIEQVITELERNPQRLIFG-GPG 320

Query: 444 SVKIYKPK 451
           SV  Y  +
Sbjct: 321 SVPQYDGR 328


>gi|161618973|ref|YP_001592860.1| hypothetical protein BCAN_A1036 [Brucella canis ATCC 23365]
 gi|254701772|ref|ZP_05163600.1| hypothetical protein Bsuib55_13071 [Brucella suis bv. 5 str. 513]
 gi|254704314|ref|ZP_05166142.1| hypothetical protein Bsuib36_10364 [Brucella suis bv. 3 str. 686]
 gi|254706784|ref|ZP_05168612.1| hypothetical protein BpinM_07300 [Brucella pinnipedialis
           M163/99/10]
 gi|254710106|ref|ZP_05171917.1| hypothetical protein BpinB_07491 [Brucella pinnipedialis B2/94]
 gi|254714107|ref|ZP_05175918.1| hypothetical protein BcetM6_12270 [Brucella ceti M644/93/1]
 gi|254716836|ref|ZP_05178647.1| hypothetical protein BcetM_10524 [Brucella ceti M13/05/1]
 gi|254719097|ref|ZP_05180908.1| hypothetical protein Bru83_06090 [Brucella sp. 83/13]
 gi|256031602|ref|ZP_05445216.1| hypothetical protein BpinM2_13273 [Brucella pinnipedialis
           M292/94/1]
 gi|256061113|ref|ZP_05451267.1| hypothetical protein Bneo5_12207 [Brucella neotomae 5K33]
 gi|256159740|ref|ZP_05457487.1| hypothetical protein BcetM4_12243 [Brucella ceti M490/95/1]
 gi|256255002|ref|ZP_05460538.1| hypothetical protein BcetB_12045 [Brucella ceti B1/94]
 gi|256369445|ref|YP_003106953.1| ABC transporter, periplasmic substrate-binding protein, putative
           [Brucella microti CCM 4915]
 gi|260566439|ref|ZP_05836909.1| ABC transporter [Brucella suis bv. 4 str. 40]
 gi|261218638|ref|ZP_05932919.1| conserved hypothetical protein [Brucella ceti M13/05/1]
 gi|261222190|ref|ZP_05936471.1| conserved hypothetical protein [Brucella ceti B1/94]
 gi|261314252|ref|ZP_05953449.1| conserved hypothetical protein [Brucella pinnipedialis M163/99/10]
 gi|261317655|ref|ZP_05956852.1| conserved hypothetical protein [Brucella pinnipedialis B2/94]
 gi|261321864|ref|ZP_05961061.1| conserved hypothetical protein [Brucella ceti M644/93/1]
 gi|261325114|ref|ZP_05964311.1| conserved hypothetical protein [Brucella neotomae 5K33]
 gi|261752325|ref|ZP_05996034.1| conserved hypothetical protein [Brucella suis bv. 5 str. 513]
 gi|261754983|ref|ZP_05998692.1| conserved hypothetical protein [Brucella suis bv. 3 str. 686]
 gi|265984088|ref|ZP_06096823.1| conserved hypothetical protein [Brucella sp. 83/13]
 gi|265988690|ref|ZP_06101247.1| conserved hypothetical protein [Brucella pinnipedialis M292/94/1]
 gi|265998154|ref|ZP_06110711.1| conserved hypothetical protein [Brucella ceti M490/95/1]
 gi|294852388|ref|ZP_06793061.1| ABC transport system substrate-binding protein [Brucella sp. NVSL
           07-0026]
 gi|306838381|ref|ZP_07471226.1| ABC transporter, periplasmic substrate-binding protein [Brucella
           sp. NF 2653]
 gi|161335784|gb|ABX62089.1| Mammalian cell entry related domain protein [Brucella canis ATCC
           23365]
 gi|255999605|gb|ACU48004.1| ABC transporter, periplasmic substrate-binding protein, putative
           [Brucella microti CCM 4915]
 gi|260155957|gb|EEW91037.1| ABC transporter [Brucella suis bv. 4 str. 40]
 gi|260920774|gb|EEX87427.1| conserved hypothetical protein [Brucella ceti B1/94]
 gi|260923727|gb|EEX90295.1| conserved hypothetical protein [Brucella ceti M13/05/1]
 gi|261294554|gb|EEX98050.1| conserved hypothetical protein [Brucella ceti M644/93/1]
 gi|261296878|gb|EEY00375.1| conserved hypothetical protein [Brucella pinnipedialis B2/94]
 gi|261301094|gb|EEY04591.1| conserved hypothetical protein [Brucella neotomae 5K33]
 gi|261303278|gb|EEY06775.1| conserved hypothetical protein [Brucella pinnipedialis M163/99/10]
 gi|261742078|gb|EEY30004.1| conserved hypothetical protein [Brucella suis bv. 5 str. 513]
 gi|261744736|gb|EEY32662.1| conserved hypothetical protein [Brucella suis bv. 3 str. 686]
 gi|262552622|gb|EEZ08612.1| conserved hypothetical protein [Brucella ceti M490/95/1]
 gi|264660887|gb|EEZ31148.1| conserved hypothetical protein [Brucella pinnipedialis M292/94/1]
 gi|264662680|gb|EEZ32941.1| conserved hypothetical protein [Brucella sp. 83/13]
 gi|294820977|gb|EFG37976.1| ABC transport system substrate-binding protein [Brucella sp. NVSL
           07-0026]
 gi|306406521|gb|EFM62755.1| ABC transporter, periplasmic substrate-binding protein [Brucella
           sp. NF 2653]
          Length = 331

 Score =  121 bits (304), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 85/299 (28%), Positives = 138/299 (46%), Gaps = 26/299 (8%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K  Y  VG+F + +   +F  +YW++R  +    +  + +RI GSV GL   S V F
Sbjct: 1   METKANYVLVGVFTLLVSLLAFGFVYWIARYGEARDSL-PLDVRIQGSVTGLGIGSQVLF 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NGI VG +  L LD   P   + +  +   TP+  STTAT+  QGL G  YIEL   R +
Sbjct: 60  NGIKVGDVRRLHLDDSNPGMVIVQTRVNATTPITRSTTATLGFQGLTGQAYIELKGGRLD 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
           +  +   A + +  A I A PS +N  ++ A++ + + ++    ++  +++   PLT TI
Sbjct: 120 EPNLLTEAAKEDTVARIDADPSAVNNLLATAQDIAARANNVLSQLEGFVKDARGPLTDTI 179

Query: 181 ANIETISTVLANNISHIDKMMHTT----QVTPHSSDSKNTFNT----ITDLITSLDKMIK 232
            N +T +  LA+N   I ++        Q+   + D     N     +  ++   DKM+ 
Sbjct: 180 NNTKTFTQALADNADIIQELGQNAGNIRQIVVDAKDMMARLNAASVKVESILNKTDKMLS 239

Query: 233 AIDLQKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSK 291
           A D               N  V    Q I T+  +RET+         I + L  FS +
Sbjct: 240 ADD--------------KNGLVA---QAITTLQSIRETSNNLDARLAPIANNLDRFSGQ 281



 Score = 61.6 bits (148), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 43/188 (22%), Positives = 85/188 (45%), Gaps = 17/188 (9%)

Query: 273 TFQEVGQKIDHLLSDFSSKMKSKE---------TSAFLENIADSTSNMRSSISAIREITD 323
           T Q++  + +++LS     +K            T  F + +AD+          I+E+  
Sbjct: 149 TAQDIAARANNVLSQLEGFVKDARGPLTDTINNTKTFTQALADNAD-------IIQELGQ 201

Query: 324 QRQKIISTINTIENITSNLNDSSQKFAELMSKINNISALKENNSLFKDAQRAMHTFRDTS 383
               I   +   +++ + LN +S K   +++K + + +  + N L   A   + + R+TS
Sbjct: 202 NAGNIRQIVVDAKDMMARLNAASVKVESILNKTDKMLSADDKNGLVAQAITTLQSIRETS 261

Query: 384 EKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFERNPQDIVWGREKG 443
             ++  +  I NNL  FS  GL ++Q +V   +  +   +  +   ERNPQ +++G   G
Sbjct: 262 NNLDARLAPIANNLDRFSGQGLREMQGVVIDSRRAIQRIEQVITELERNPQRLIFG-GPG 320

Query: 444 SVKIYKPK 451
           SV  Y  +
Sbjct: 321 SVPQYDGR 328


>gi|163843289|ref|YP_001627693.1| hypothetical protein BSUIS_A1064 [Brucella suis ATCC 23445]
 gi|163674012|gb|ABY38123.1| Mammalian cell entry related domain protein [Brucella suis ATCC
           23445]
          Length = 331

 Score =  121 bits (304), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 85/299 (28%), Positives = 138/299 (46%), Gaps = 26/299 (8%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K  Y  VG+F + +   +F  +YW++R  +    +  + +RI GSV GL   S V F
Sbjct: 1   METKANYVLVGVFTLLVSLLAFGFVYWIARYGEARDSL-PLDVRIQGSVTGLGIGSQVLF 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NGI VG +  L LD   P   + +  +   TP+  STTAT+  QGL G  YIEL   R +
Sbjct: 60  NGIKVGDVRRLHLDDSNPGMVIVQTRVNATTPITRSTTATLGFQGLTGQAYIELKGGRLD 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
           +  +   A + +  A I A PS +N  ++ A++ + + ++    ++  +++   PLT TI
Sbjct: 120 EPNLLTEAAKEDTVARIDADPSAVNNLLATAQDIAARANNVLSQLEGFVKDARGPLTDTI 179

Query: 181 ANIETISTVLANNISHIDKMMHTT----QVTPHSSDSKNTFNT----ITDLITSLDKMIK 232
            N +T +  LA+N   I ++        Q+   + D     N     +  ++   DKM+ 
Sbjct: 180 NNTKTFTQALADNADIIQELGQNAGSIRQIVVDAKDMMARLNAASVKVESILNKTDKMLS 239

Query: 233 AIDLQKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSK 291
           A D               N  V    Q I T+  +RET+         I + L  FS +
Sbjct: 240 ADD--------------KNGLVA---QAITTLQSIRETSNNLDARLAPIANNLDRFSGQ 281



 Score = 62.0 bits (149), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 43/186 (23%), Positives = 86/186 (46%), Gaps = 13/186 (6%)

Query: 273 TFQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNMRSSISAIREITDQRQKIISTI 332
           T Q++  + +++LS     +K          + D+ +N ++   A+ +  D  Q++    
Sbjct: 149 TAQDIAARANNVLSQLEGFVKDARGP-----LTDTINNTKTFTQALADNADIIQELGQNA 203

Query: 333 NTIENIT-------SNLNDSSQKFAELMSKINNISALKENNSLFKDAQRAMHTFRDTSEK 385
            +I  I        + LN +S K   +++K + + +  + N L   A   + + R+TS  
Sbjct: 204 GSIRQIVVDAKDMMARLNAASVKVESILNKTDKMLSADDKNGLVAQAITTLQSIRETSNN 263

Query: 386 INRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFERNPQDIVWGREKGSV 445
           ++  +  I NNL  FS  GL ++Q +V   +  +   +  +   ERNPQ +++G   GSV
Sbjct: 264 LDARLAPIANNLDRFSGQGLREMQGVVIDSRRAIQRIEQVITELERNPQRLIFG-GPGSV 322

Query: 446 KIYKPK 451
             Y  +
Sbjct: 323 PQYDGR 328


>gi|17987246|ref|NP_539880.1| toluene tolerance protein TTG2C [Brucella melitensis bv. 1 str.
           16M]
 gi|62289944|ref|YP_221737.1| ABC transporter periplasmic substrate-binding protein [Brucella
           abortus bv. 1 str. 9-941]
 gi|82699872|ref|YP_414446.1| hypothetical protein BAB1_1040 [Brucella melitensis biovar Abortus
           2308]
 gi|189024187|ref|YP_001934955.1| ABC transporter, periplasmic substrate-binding protein [Brucella
           abortus S19]
 gi|225852526|ref|YP_002732759.1| mammalian cell entry related domain-containing protein [Brucella
           melitensis ATCC 23457]
 gi|237815445|ref|ZP_04594443.1| toluene tolerance protein TTG2C [Brucella abortus str. 2308 A]
 gi|254689251|ref|ZP_05152505.1| Mammalian cell entry related domain protein [Brucella abortus bv. 6
           str. 870]
 gi|254693735|ref|ZP_05155563.1| Mammalian cell entry related domain protein [Brucella abortus bv. 3
           str. Tulya]
 gi|254697386|ref|ZP_05159214.1| Mammalian cell entry related domain protein [Brucella abortus bv. 2
           str. 86/8/59]
 gi|254730284|ref|ZP_05188862.1| Mammalian cell entry related domain protein [Brucella abortus bv. 4
           str. 292]
 gi|256044680|ref|ZP_05447584.1| Mammalian cell entry related domain protein [Brucella melitensis
           bv. 1 str. Rev.1]
 gi|256113574|ref|ZP_05454394.1| Mammalian cell entry related domain protein [Brucella melitensis
           bv. 3 str. Ether]
 gi|256257501|ref|ZP_05463037.1| Mammalian cell entry related domain protein [Brucella abortus bv. 9
           str. C68]
 gi|256263984|ref|ZP_05466516.1| ABC transporter [Brucella melitensis bv. 2 str. 63/9]
 gi|260545307|ref|ZP_05821048.1| ABC transporter [Brucella abortus NCTC 8038]
 gi|260564026|ref|ZP_05834512.1| ABC transporter [Brucella melitensis bv. 1 str. 16M]
 gi|260754757|ref|ZP_05867105.1| conserved hypothetical protein [Brucella abortus bv. 6 str. 870]
 gi|260757980|ref|ZP_05870328.1| conserved hypothetical protein [Brucella abortus bv. 4 str. 292]
 gi|260761803|ref|ZP_05874146.1| conserved hypothetical protein [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260883777|ref|ZP_05895391.1| conserved hypothetical protein [Brucella abortus bv. 9 str. C68]
 gi|261214009|ref|ZP_05928290.1| conserved hypothetical protein [Brucella abortus bv. 3 str. Tulya]
 gi|265991104|ref|ZP_06103661.1| conserved hypothetical protein [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|265994941|ref|ZP_06107498.1| conserved hypothetical protein [Brucella melitensis bv. 3 str.
           Ether]
 gi|297248345|ref|ZP_06932063.1| ABC transport system substrate-binding protein [Brucella abortus
           bv. 5 str. B3196]
 gi|17982920|gb|AAL52144.1| toluene tolerance protein ttg2c [Brucella melitensis bv. 1 str.
           16M]
 gi|62196076|gb|AAX74376.1| ABC transporter, periplasmic substrate-binding protein [Brucella
           abortus bv. 1 str. 9-941]
 gi|82615973|emb|CAJ10996.1| Mce4/Rv3499c/MTV023.06c protein [Brucella melitensis biovar Abortus
           2308]
 gi|189019759|gb|ACD72481.1| ABC transporter, periplasmic substrate-binding protein [Brucella
           abortus S19]
 gi|225640891|gb|ACO00805.1| Mammalian cell entry related domain protein [Brucella melitensis
           ATCC 23457]
 gi|237790282|gb|EEP64492.1| toluene tolerance protein TTG2C [Brucella abortus str. 2308 A]
 gi|260096714|gb|EEW80589.1| ABC transporter [Brucella abortus NCTC 8038]
 gi|260154042|gb|EEW89134.1| ABC transporter [Brucella melitensis bv. 1 str. 16M]
 gi|260668298|gb|EEX55238.1| conserved hypothetical protein [Brucella abortus bv. 4 str. 292]
 gi|260672235|gb|EEX59056.1| conserved hypothetical protein [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260674865|gb|EEX61686.1| conserved hypothetical protein [Brucella abortus bv. 6 str. 870]
 gi|260873305|gb|EEX80374.1| conserved hypothetical protein [Brucella abortus bv. 9 str. C68]
 gi|260915616|gb|EEX82477.1| conserved hypothetical protein [Brucella abortus bv. 3 str. Tulya]
 gi|262766054|gb|EEZ11843.1| conserved hypothetical protein [Brucella melitensis bv. 3 str.
           Ether]
 gi|263001888|gb|EEZ14463.1| conserved hypothetical protein [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|263094128|gb|EEZ18050.1| ABC transporter [Brucella melitensis bv. 2 str. 63/9]
 gi|297175514|gb|EFH34861.1| ABC transport system substrate-binding protein [Brucella abortus
           bv. 5 str. B3196]
 gi|326409042|gb|ADZ66107.1| ABC transporter, periplasmic substrate-binding protein [Brucella
           melitensis M28]
 gi|326538751|gb|ADZ86966.1| mammalian cell entry related domain protein [Brucella melitensis
           M5-90]
          Length = 331

 Score =  121 bits (304), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 85/299 (28%), Positives = 138/299 (46%), Gaps = 26/299 (8%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K  Y  VG+F + +   +F  +YW++R  +    +  + +RI GSV GL   S V F
Sbjct: 1   METKANYVLVGVFTLLVSLLAFGFVYWIARYGEARDSL-PLDVRIQGSVTGLGIGSQVLF 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NGI VG +  L LD   P   + +  +   TP+  STTAT+  QGL G  YIEL   R +
Sbjct: 60  NGIKVGDVRRLHLDDSNPGMVIVQTRVNATTPITRSTTATLGFQGLTGQAYIELKGGRLD 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
           +  +   A + +  A I A PS +N  ++ A++ + + ++    ++  +++   PLT TI
Sbjct: 120 EPNLLTEAAKEDTVARIDADPSAVNNLLATAQDIAARANNVLSQLEGFVKDARGPLTDTI 179

Query: 181 ANIETISTVLANNISHIDKMMHTT----QVTPHSSDSKNTFNT----ITDLITSLDKMIK 232
            N +T +  LA+N   I ++        Q+   + D     N     +  ++   DKM+ 
Sbjct: 180 NNTKTFTQALADNADIIQELGQNAGNIRQIVVDAKDMMARLNAASVKVESILNKTDKMLS 239

Query: 233 AIDLQKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSK 291
           A D               N  V    Q I T+  +RET+         I + L  FS +
Sbjct: 240 ADD--------------KNGLVA---QAITTLQSIRETSNNLDARLAPIANNLDRFSGQ 281



 Score = 60.1 bits (144), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 39/176 (22%), Positives = 80/176 (45%), Gaps = 16/176 (9%)

Query: 273 TFQEVGQKIDHLLSDFSSKMKSKE---------TSAFLENIADSTSNMRSSISAIREITD 323
           T Q++  + +++LS     +K            T  F + +AD+          I+E+  
Sbjct: 149 TAQDIAARANNVLSQLEGFVKDARGPLTDTINNTKTFTQALADNAD-------IIQELGQ 201

Query: 324 QRQKIISTINTIENITSNLNDSSQKFAELMSKINNISALKENNSLFKDAQRAMHTFRDTS 383
               I   +   +++ + LN +S K   +++K + + +  + N L   A   + + R+TS
Sbjct: 202 NAGNIRQIVVDAKDMMARLNAASVKVESILNKTDKMLSADDKNGLVAQAITTLQSIRETS 261

Query: 384 EKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFERNPQDIVWG 439
             ++  +  I NNL  FS  GL ++Q +V   +  +   +  +   ERNPQ +++G
Sbjct: 262 NNLDARLAPIANNLDRFSGQGLREMQGVVIDSRRAIQRIEQVITELERNPQRLIFG 317


>gi|306840508|ref|ZP_07473267.1| ABC transporter, periplasmic substrate-binding protein [Brucella
           sp. BO2]
 gi|306843895|ref|ZP_07476490.1| ABC transporter, periplasmic substrate-binding protein [Brucella
           sp. BO1]
 gi|306275650|gb|EFM57374.1| ABC transporter, periplasmic substrate-binding protein [Brucella
           sp. BO1]
 gi|306289523|gb|EFM60741.1| ABC transporter, periplasmic substrate-binding protein [Brucella
           sp. BO2]
          Length = 331

 Score =  121 bits (304), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 85/299 (28%), Positives = 138/299 (46%), Gaps = 26/299 (8%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K  Y  VG+F + +   +F  +YW++R  +    +  + +RI GSV GL   S V F
Sbjct: 1   METKANYVLVGVFTLLVSLLAFGFVYWIARYGEARDSL-PLDVRIQGSVTGLGIGSQVLF 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NGI VG +  L LD   P   + +  +   TP+  STTAT+  QGL G  YIEL   R +
Sbjct: 60  NGIKVGDVRRLHLDDSNPGMVIVQTRVNATTPITRSTTATLGFQGLTGQAYIELKGGRLD 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
           +  +   A + +  A I A PS +N  ++ A++ + + ++    ++  +++   PLT TI
Sbjct: 120 EPNLLTEAAKEDTVARIDADPSAVNNLLATAQDIAARANNVLSELEGFVKDARGPLTDTI 179

Query: 181 ANIETISTVLANNISHIDKMMHTT----QVTPHSSDSKNTFNT----ITDLITSLDKMIK 232
            N +T +  LA+N   I ++        Q+   + D     N     +  ++   DKM+ 
Sbjct: 180 NNTKTFTQALADNADIIQELGQNAGNIRQIVVDAKDMMARLNAASVKVESILNKTDKMLS 239

Query: 233 AIDLQKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSK 291
           A D               N  V    Q I T+  +RET+         I + L  FS +
Sbjct: 240 ADD--------------KNGLVA---QAITTLQSIRETSNNLDARLAPIANNLDRFSGQ 281



 Score = 62.8 bits (151), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 43/188 (22%), Positives = 86/188 (45%), Gaps = 17/188 (9%)

Query: 273 TFQEVGQKIDHLLSDFSSKMKSKE---------TSAFLENIADSTSNMRSSISAIREITD 323
           T Q++  + +++LS+    +K            T  F + +AD+          I+E+  
Sbjct: 149 TAQDIAARANNVLSELEGFVKDARGPLTDTINNTKTFTQALADNAD-------IIQELGQ 201

Query: 324 QRQKIISTINTIENITSNLNDSSQKFAELMSKINNISALKENNSLFKDAQRAMHTFRDTS 383
               I   +   +++ + LN +S K   +++K + + +  + N L   A   + + R+TS
Sbjct: 202 NAGNIRQIVVDAKDMMARLNAASVKVESILNKTDKMLSADDKNGLVAQAITTLQSIRETS 261

Query: 384 EKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFERNPQDIVWGREKG 443
             ++  +  I NNL  FS  GL ++Q +V   +  +   +  +   ERNPQ +++G   G
Sbjct: 262 NNLDARLAPIANNLDRFSGQGLREMQGVVIDSRRAIQRIEQVITELERNPQRLIFG-GPG 320

Query: 444 SVKIYKPK 451
           SV  Y  +
Sbjct: 321 SVPQYDGR 328


>gi|23501901|ref|NP_698028.1| ABC transporter periplasmic substrate-binding protein [Brucella
           suis 1330]
 gi|23347842|gb|AAN29943.1| ABC transporter, periplasmic substrate-binding protein, putative
           [Brucella suis 1330]
          Length = 331

 Score =  121 bits (303), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 85/299 (28%), Positives = 137/299 (45%), Gaps = 26/299 (8%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K  Y  VG+F + +   +F  +YW++R  +    +  + +RI GSV GL   S V F
Sbjct: 1   METKANYVLVGVFTLLVSLLAFGFVYWIARYGEARDSL-PLDVRIQGSVTGLGIGSQVLF 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NGI VG +  L LD   P   + +  +   TP+  STTAT+  QGL G  YIEL   R +
Sbjct: 60  NGIKVGDVRRLHLDDSNPGMVIVQTRVNATTPITRSTTATLGFQGLTGQAYIELKGGRLD 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
           +  +   A + +  A I A PS +N  ++ A++ + + ++    ++  ++    PLT TI
Sbjct: 120 EPNLLTEAAKEDTVARIDADPSAVNNLLATAQDIAARANNVLSQLEGFVKGARGPLTDTI 179

Query: 181 ANIETISTVLANNISHIDKMMHTT----QVTPHSSDSKNTFNT----ITDLITSLDKMIK 232
            N +T +  LA+N   I ++        Q+   + D     N     +  ++   DKM+ 
Sbjct: 180 NNTKTFTQALADNADIIQELGQNAGNIRQIVVDAKDMMARLNAASVKVESILNKTDKMLS 239

Query: 233 AIDLQKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSK 291
           A D               N  V    Q I T+  +RET+         I + L  FS +
Sbjct: 240 ADD--------------KNGLVA---QAITTLQSIRETSNNLDARLAPIANNLDRFSGQ 281



 Score = 62.4 bits (150), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 43/188 (22%), Positives = 85/188 (45%), Gaps = 17/188 (9%)

Query: 273 TFQEVGQKIDHLLSDFSSKMKSKE---------TSAFLENIADSTSNMRSSISAIREITD 323
           T Q++  + +++LS     +K            T  F + +AD+          I+E+  
Sbjct: 149 TAQDIAARANNVLSQLEGFVKGARGPLTDTINNTKTFTQALADNAD-------IIQELGQ 201

Query: 324 QRQKIISTINTIENITSNLNDSSQKFAELMSKINNISALKENNSLFKDAQRAMHTFRDTS 383
               I   +   +++ + LN +S K   +++K + + +  + N L   A   + + R+TS
Sbjct: 202 NAGNIRQIVVDAKDMMARLNAASVKVESILNKTDKMLSADDKNGLVAQAITTLQSIRETS 261

Query: 384 EKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFERNPQDIVWGREKG 443
             ++  +  I NNL  FS  GL ++Q +V   +  +   +  +   ERNPQ +++G   G
Sbjct: 262 NNLDARLAPIANNLDRFSGQGLREMQGVVIDSRRAIQRIEQVITELERNPQRLIFG-GPG 320

Query: 444 SVKIYKPK 451
           SV  Y  +
Sbjct: 321 SVPQYDGR 328


>gi|114707111|ref|ZP_01440009.1| putative ABC transporter protein [Fulvimarina pelagi HTCC2506]
 gi|114537307|gb|EAU40433.1| putative ABC transporter protein [Fulvimarina pelagi HTCC2506]
          Length = 938

 Score =  120 bits (302), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 111/478 (23%), Positives = 226/478 (47%), Gaps = 68/478 (14%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYW--LSRSNQYDGPMAEVIIRIPGSVDGLSTDSSV 58
           ME+K  Y  VG+F +++L  +F  +YW  L+  +    P+   ++RI GSV GL   S V
Sbjct: 1   METKANYVRVGIFTITVLALAFGFVYWSVLATQSTTRVPL---LVRITGSVTGLQQGSQV 57

Query: 59  RFNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLR 118
           +FNG+PVG +  L LD   P   +A   + P  P+  ST A +    L G +YIEL   +
Sbjct: 58  QFNGLPVGSVQSLELDPNNPRVVIASTTVEPGLPISESTDANLVANPLTGYSYIELRGGQ 117

Query: 119 KEKKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENI------ 172
            +++++ + A E+   A+ITA+PS +   +     T++ I++ + +I    EN+      
Sbjct: 118 IDQESLLEQAQEQGTIAVITASPSEVTDIL----QTARDIAERANNIMTQFENVVGTVGP 173

Query: 173 -----EKPLTTTIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSL 227
                 + +T    N+   +  LA+N   ID  +   ++T  +  +      + D I ++
Sbjct: 174 SVEASAQNITDITGNVSAFTDSLADNTDDID--LFIARLTDLAESANTVAQRLPDAIGNV 231

Query: 228 DKMIKAIDLQKVNQILENIQVSS-------NNFVKSSDQVINTVHDVRETTQTFQEVGQK 280
             ++ A+D  +++ I++N+  +S        N    ++ V +    V +  +T Q     
Sbjct: 232 QAILDAVDPAQISTIIDNVSATSVSIRDGAENLTAVTEAVQSAAAGVSQIGETIQRNADG 291

Query: 281 IDHLLSDF-------SSKMKSKETSAFLEN----------IADSTSNM---RSSISAIRE 320
           ID  + +        +S  +  +T+    N          ++D+ S +    S+++A+ E
Sbjct: 292 IDAFIGNLGPLSQTATSVARQLDTTVSSANEIFAAVDPQQVSDTLSGVSATASNLAAVSE 351

Query: 321 -ITDQRQKIISTI----NTIENI---TSNLNDSSQKFAELMSKINNISALKENNSLFKDA 372
            +++QR+ I S I    NT++NI   T  + + +++   L+S+++ IS          ++
Sbjct: 352 TVSNQRESIESAITSASNTMQNIDTVTGTIANRTEQIDALLSRLDPIS----------ES 401

Query: 373 QRAMHT-FRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNF 429
              + T   DT+ +I   + S+  +  + +  GL+   + +  + +T+++  D +  F
Sbjct: 402 IGTLSTQLTDTASRIGEVVSSVEPDTVSDTLVGLSSTASNLSAITDTISNARDAITEF 459



 Score = 75.9 bits (185), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 83/343 (24%), Positives = 159/343 (46%), Gaps = 24/343 (6%)

Query: 127 IATERNQ-RAMITAT-PSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTT---IA 181
           I T  NQ R +I A  P  ++  + +  +T++ +S  S  + +  E I   ++     I 
Sbjct: 601 IETTANQAREVIAAVDPEAVSNTVDSLSSTAENLSAVSDTVAQQREQISTAISGASNLIQ 660

Query: 182 NIETISTVLANNISHIDKMMH-----TTQVTPHSSDSKNTFNTITDLITSLD--KMIKAI 234
           N+  IST +AN    ID  +      T  +   S+    T +   + I  +D  ++ ++I
Sbjct: 661 NVNRISTTIANRGEEIDAALANIRPITDSLRDASARLSGTVDKAGNFIDRIDTDQLNRSI 720

Query: 235 DLQKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKS 294
           D  +V  + E I   S+      D V   V  +      F +  ++ID +L++   ++ +
Sbjct: 721 D--QVGNLAETIGSKSDTIDSIIDGVDTAVGSLTTALNGFDQTRRQIDSILNEVEPQLVN 778

Query: 295 KETSAFLENIADSTSNMR---SSISAIREITDQRQKIISTINTIENITS-NLNDSSQKFA 350
              S    N++ +T+N+     SI  + +I ++RQ  I  I T  NITS  +  +S K  
Sbjct: 779 NAVS----NVSSATNNIARAADSIGRVGDIINKRQDEIDEILTNANITSRQVAAASGKLD 834

Query: 351 ELMSKINNI-SALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQ 409
            +++ +N + S       L  +   A+   RDT++ +   +  +  NLQNFS S   ++Q
Sbjct: 835 TVITSVNGLLSGSDAGRPLGVEVTEALRAIRDTAQSVQGQVGPLSANLQNFSDSTRREVQ 894

Query: 410 NLVRKLQETVNHFDDCLNNFERNPQDIVWGREKGSVKIYKPKH 452
           +L R+L +TV      +++   +P  +++G E  +V+ Y  + 
Sbjct: 895 SLARQLNQTVERIGRAVDDIADDPSQVIFGGES-NVRTYDGRR 936



 Score = 38.5 bits (88), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 57/304 (18%), Positives = 131/304 (43%), Gaps = 54/304 (17%)

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
           A++  ++T +A+    + K +   ++ P ++ +    + ++      ++++  ID Q+V+
Sbjct: 468 ADVNRVTTTIASRSEALGKALD--RIDPITASAVTAADNLSQTGERANQLLAGIDPQQVS 525

Query: 241 QILENIQVSSNNFVKSSDQVI--------------NTVHDVRETTQTFQEVGQKIDHLLS 286
           + ++ +  ++ N    S+ V+              NT+ +V   + T      +ID LLS
Sbjct: 526 ETVDGLSSTAQNLSAVSETVVAEREAIQSAITGASNTLQNVSAVSDTIAARRDQIDTLLS 585

Query: 287 DF---------------SSKMKSKETSAFLE-----NIADSTSNMRSSISAIRE-ITDQR 325
                            ++  +++E  A ++     N  DS S+   ++SA+ + +  QR
Sbjct: 586 RLDPISQSVQNASGAIETTANQAREVIAAVDPEAVSNTVDSLSSTAENLSAVSDTVAQQR 645

Query: 326 QKIISTINTIENITSNLNDSSQKFA----ELMSKINNISALKENNSLFKDAQRAMHTFRD 381
           ++I + I+   N+  N+N  S   A    E+ + + NI  + ++    +DA   +    D
Sbjct: 646 EQISTAISGASNLIQNVNRISTTIANRGEEIDAALANIRPITDS---LRDASARLSGTVD 702

Query: 382 TS---------EKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFERN 432
            +         +++NR I  +G NL     S  + I +++  +   V      LN F++ 
Sbjct: 703 KAGNFIDRIDTDQLNRSIDQVG-NLAETIGSKSDTIDSIIDGVDTAVGSLTTALNGFDQT 761

Query: 433 PQDI 436
            + I
Sbjct: 762 RRQI 765


>gi|148560680|ref|YP_001258962.1| putative ABC transporter periplasmic substrate-binding protein
           [Brucella ovis ATCC 25840]
 gi|148371937|gb|ABQ61916.1| putative ABC transporter, periplasmic substrate-binding protein
           [Brucella ovis ATCC 25840]
          Length = 331

 Score =  120 bits (300), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 85/299 (28%), Positives = 139/299 (46%), Gaps = 26/299 (8%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K  Y  VG+F + +   +F  +YW++R  +    +  + +RI GSV GL   S V F
Sbjct: 1   METKANYVLVGVFTLLVSLLAFGFVYWIARYGEARDSL-PLDVRIQGSVTGLGIGSQVLF 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NGI VG +  L LD   P   + +  +   TP+  STTAT+  QGL G  YIEL   R +
Sbjct: 60  NGIKVGDVRRLHLDDSNPGMVIVQTHVNATTPITRSTTATLGFQGLTGQAYIELKGGRLD 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
           +  +   A + +  A I A  S +N  ++ A++ + + ++    ++  +++   PLT TI
Sbjct: 120 EPNLLTEAAKEDTVARIDADLSAVNNLLATAQDIAARANNVLSQLEGFVKDARGPLTDTI 179

Query: 181 ANIETISTVLANNISHIDKMMHTT----QVTPHSSDSKNTFNT----ITDLITSLDKMIK 232
            N +T +  LA+N   I ++        Q+   + D     N     +  ++   DKM+ 
Sbjct: 180 NNTKTFTQALADNADIIQELGQNASNIRQIVVDAKDMMARLNAASVKVESILNKTDKMLS 239

Query: 233 AIDLQKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSK 291
           A D               N  V    Q I T+  +RET+  F+     I + L  FS +
Sbjct: 240 ADD--------------KNGLVA---QAITTLQSIRETSNNFEARLAPIANNLDRFSGQ 281



 Score = 60.1 bits (144), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 43/188 (22%), Positives = 83/188 (44%), Gaps = 17/188 (9%)

Query: 273 TFQEVGQKIDHLLSDFSSKMKSKE---------TSAFLENIADSTSNMRSSISAIREITD 323
           T Q++  + +++LS     +K            T  F + +AD+          I+E+  
Sbjct: 149 TAQDIAARANNVLSQLEGFVKDARGPLTDTINNTKTFTQALADNAD-------IIQELGQ 201

Query: 324 QRQKIISTINTIENITSNLNDSSQKFAELMSKINNISALKENNSLFKDAQRAMHTFRDTS 383
               I   +   +++ + LN +S K   +++K + + +  + N L   A   + + R+TS
Sbjct: 202 NASNIRQIVVDAKDMMARLNAASVKVESILNKTDKMLSADDKNGLVAQAITTLQSIRETS 261

Query: 384 EKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFERNPQDIVWGREKG 443
                 +  I NNL  FS  GL ++Q +V   +  +   +  +   ERNPQ +++G   G
Sbjct: 262 NNFEARLAPIANNLDRFSGQGLREMQGVVIDSRRAIQRIEQVITELERNPQRLIFG-GPG 320

Query: 444 SVKIYKPK 451
           SV  Y  +
Sbjct: 321 SVPQYDGR 328


>gi|90417913|ref|ZP_01225825.1| conserved hypothetical protein [Aurantimonas manganoxydans
           SI85-9A1]
 gi|90337585|gb|EAS51236.1| conserved hypothetical protein [Aurantimonas manganoxydans
           SI85-9A1]
          Length = 649

 Score =  120 bits (300), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 107/427 (25%), Positives = 187/427 (43%), Gaps = 36/427 (8%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWL----SRSNQYDGPMAEVIIRIPGSVDGLSTDS 56
           ME+K  Y  VGLF + ++  SF  +YW     S S +       +++RI GSV GL   S
Sbjct: 1   METKANYVRVGLFTMLVIALSFGFVYWAIFATSGSERV-----RLLVRIEGSVTGLQQGS 55

Query: 57  SVRFNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELST 116
            V FNG+PVG +  L LD   P   +A   + PD P+  ST A I  QGL G  ++EL  
Sbjct: 56  QVLFNGLPVGSVKALRLDSNNPEVVIATTEVDPDLPIKASTQANIGFQGLTGAAFVELKG 115

Query: 117 LRKEKKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPL 176
            + ++  I   A E+    +I A PS +   ++ A + + + +      + ++  +   +
Sbjct: 116 GQADEADIIGEAAEQGTVPVIKANPSDVTDILATARDIADRANSILGQFESLVGTVGPSV 175

Query: 177 TTTIA-------NIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDK 229
            TT+        NIET +  LA N   ID  + +      S+++      +   I     
Sbjct: 176 ETTVENVAQTSRNIETFTASLAENSDDIDNFLTSLSQLSSSANT--VAEELPGAIRQAKN 233

Query: 230 MIKAIDLQKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQ-------KID 282
           ++ A+D   V  +++N+   S+     SD + +    V+    +  EVG         ID
Sbjct: 234 ILDAVDPASVTTVVDNVAAVSDTLRAQSDNLDSIFASVQTAADSVGEVGDVIRRNTTGID 293

Query: 283 HLLSDFSSKMKSKETSAFLENIADSTSNMRSSISAIREITDQRQKIISTINTIENITSNL 342
             +S+    +  K T+     +AD       S + +    D  Q +  TI  I +   N+
Sbjct: 294 SFVSNL-GPLAEKATA-----VADRLDTTLQSANTVVAAIDPAQ-VSKTIEGISSAAENV 346

Query: 343 NDSSQKFAELMSKINNISALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQ 402
           +  ++        IN  SA+   ++  ++  R   T  + SE +++ + S+G    N +Q
Sbjct: 347 SSLAETIGAQKEAIN--SAIAGASNAAQNVNRITTTIVERSEDVDKLLASLGPITDNITQ 404

Query: 403 S--GLND 407
           +  G N+
Sbjct: 405 ASTGFNE 411



 Score = 81.3 bits (199), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 70/321 (21%), Positives = 154/321 (47%), Gaps = 32/321 (9%)

Query: 154 TSKKISDSSRHIQKIIENI---EKPLTTTIA-------NIETISTVLANNISHIDKMMHT 203
           T + IS ++ ++  + E I   ++ + + IA       N+  I+T +      +DK++ +
Sbjct: 335 TIEGISSAAENVSSLAETIGAQKEAINSAIAGASNAAQNVNRITTTIVERSEDVDKLLAS 394

Query: 204 -TQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVNQILENIQVSSNNFVKSSDQVIN 262
              +T + + +   FN   + + S + +I ++D   VNQ + ++Q  +      ++Q+ +
Sbjct: 395 LGPITDNITQASTGFN---EAVASANALIGSVDSATVNQAIGDVQRVTGAVSGKTEQIQS 451

Query: 263 TVHDVRETTQT-------FQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNMRSSI 315
            +  V  T QT       F E   + D LL+     +   + +  +EN++ +T N+ ++ 
Sbjct: 452 IIDGVERTVQTLDTTLTGFTETRTQFDTLLA----SIDPGKVNTAVENVSAATGNVAAAA 507

Query: 316 SAIREITD----QRQKIISTINTIENITSNLNDSSQKFAELMSKINNI-SALKENNSLFK 370
            +I ++ +    +R+ I + I   +  +  L+ +S +   +++ +N + +   +  SL  
Sbjct: 508 DSIAKVANDVGARREDIDAIITNAKTTSEQLSAASGRIDSVVNSVNRVLAGAGDGTSLGV 567

Query: 371 DAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFE 430
           D  RA+ + R  ++ I   +  I  NLQ FS  GL +++ L+  +  TV+  D  + +F 
Sbjct: 568 DLARALRSVRGAADSIQTQVTPISANLQRFSGEGLREVRGLISNVNRTVDRIDSAVEDFT 627

Query: 431 RNPQDIVWGREKGSVKIYKPK 451
            NP  +++G E   VK Y  +
Sbjct: 628 TNPSRLIYGGED--VKQYDGR 646


>gi|304391806|ref|ZP_07373748.1| ABC transporter, substrate binding protein [Ahrensia sp. R2A130]
 gi|303296035|gb|EFL90393.1| ABC transporter, substrate binding protein [Ahrensia sp. R2A130]
          Length = 551

 Score =  118 bits (295), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 115/534 (21%), Positives = 219/534 (41%), Gaps = 106/534 (19%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++     VGLF++S L  SF  +YW       D  M  + +RI G+V GL   S V+F
Sbjct: 1   METRANTIVVGLFMLSALVASFALVYWFGAVGDKD-RMQRLDVRIQGAVSGLVEGSIVQF 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NGI VGR+ GL  D++ P       L+ PD PL   T  ++  +GL+G ++I+L     +
Sbjct: 60  NGITVGRVTGLAYDKDDPRFVTVNTLVEPDVPLREDTRVSVGARGLSGGSFIQLEGGTPD 119

Query: 121 KKTIFQIATERNQRAMITATPS-------------------------------------- 142
              + Q  T R+    +   PS                                      
Sbjct: 120 ALRLVQPNTPRDGVVELKGNPSAFTDIIDQVGSIAVRAEKVVGVLEGFVERNDQVISDTL 179

Query: 143 ---------------GINYFISNA-------ENTSKKISDSSRHIQKIIENIE-KPLTTT 179
                          G+  F+++A       E  S KI  +   ++ I+  ++ + ++ T
Sbjct: 180 INTRKFSKALADNSEGVEQFLASAQSVGVSLEALSGKIDGTVTRVEAILAAVDPQTVSGT 239

Query: 180 IANIETISTVLANNISHIDKMMH------------TTQVTPHSSDSKNTFNTITDL---- 223
           + N+E+ +  LA+  + I+ ++             T +V P     + T   +       
Sbjct: 240 LENVESFTKGLADQRAEIETLIQAAGQAVADVRGATARVGPIIGRIEETVQAVEPARVRT 299

Query: 224 -ITSLDK-------MIKAIDLQKVNQILENIQVSSNNFVKS------------SDQVINT 263
            I +LD+       +++ +D + V + + N++ +S++ V +            ++ V   
Sbjct: 300 AIANLDQATARARAVLEVVDEESVQRTISNVERASSSIVTATGRANDIISAIDAETVKAL 359

Query: 264 VHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNMRSSISAIREIT- 322
           V D+R  TQ    +   +D    + +    SK   A  E   D+    R  ++ +R++T 
Sbjct: 360 VADMRVATQNVSTLLAAVDAERVNAAVDDVSKAARAASEAATDA----RGIVTDVRKVTQ 415

Query: 323 --DQRQKIISTINT-IENITSNLNDSSQKFAELMSKINNISALKENNSLFKDAQRAMHTF 379
              +R   +  I T    + + LN+SS+K   L+ +  ++   + +  L  DA+  +  F
Sbjct: 416 PLGERAGDVEKILTDTTELAARLNESSKKVDALLEQAGDLLGTEGDGGLAADARSTLAEF 475

Query: 380 RDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFERNP 433
           R T+   +  +  I  ++   +  GL D   L+R   ++++  D  + N + NP
Sbjct: 476 RRTARNFSGNMAQITGSVTKLADRGLGDTPALIRAATQSLSRLDRVIRNIQDNP 529


>gi|254503068|ref|ZP_05115219.1| mce related protein [Labrenzia alexandrii DFL-11]
 gi|222439139|gb|EEE45818.1| mce related protein [Labrenzia alexandrii DFL-11]
          Length = 667

 Score =  113 bits (283), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 88/327 (26%), Positives = 151/327 (46%), Gaps = 40/327 (12%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWL-----SRSNQYDGPMAEVIIRIPGSVDGLSTD 55
           ME++  Y  +G F+++ LF +F  IYWL     SR N       EV I  PG+V GL   
Sbjct: 1   METRANYILIGAFMIATLFSAFGFIYWLAVTAESRQN------VEVKILFPGAVTGLPVG 54

Query: 56  SSVRFNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELS 115
             V FNGI VG +  L      P   LA   IRP TPL   T AT+   GL G+ Y++L 
Sbjct: 55  GQVLFNGIKVGDVSSLDFAPGDPTKVLATVRIRPSTPLREDTKATLNFTGLTGVAYVDLI 114

Query: 116 TLRKEKKTIFQIATER--NQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIE 173
                   +      +  N   +I A  S  +  +  A +  K+   + + + +++++  
Sbjct: 115 GGTSSSPLLLNPDGSQTPNNIPLINAERSFFDDIVDGARDVLKRADSTMKTVDQLLQDNG 174

Query: 174 KPLTTTIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNT-ITDLITSLDKMIK 232
             ++ TI N+ET S  LA N   +   M +      +SD+ ++ +T +  L+   ++++ 
Sbjct: 175 PVISKTIQNVETFSDALAANSDGVKDFMASIG---KASDAFSSLSTRLEGLVDEGERLLA 231

Query: 233 AIDLQKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKM 292
           A+   KV  I++++Q  S +  K+S                       ID L++D  ++ 
Sbjct: 232 AVPSDKVTAIVDDLQAFSGSLGKAS---------------------TDIDTLMAD--AQN 268

Query: 293 KSKETSAFLENIADSTSNMRSSISAIR 319
            +KE + F E + D   N++S + A++
Sbjct: 269 AAKELTEFTERLNDGLGNVQSIVQAVK 295



 Score = 44.7 bits (104), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 48/259 (18%), Positives = 107/259 (41%), Gaps = 42/259 (16%)

Query: 224 ITSLDKMIKAIDLQKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEV-----G 278
           +  +D++I ++D   + + ++++    +NF     Q+   +   + T Q F+ V     G
Sbjct: 399 LVRVDEIIASVDPATIGETVDSVASIVDNFNNQQSQINEIIASTKSTIQNFEAVSATVRG 458

Query: 279 Q--KIDHLLSD-------FSSKMKSKET---SAFLENIADSTSNMRSSISAI-------- 318
           Q  +I  L+ D       F+S ++S +    +   E IA+   ++ ++ S +        
Sbjct: 459 QDDRIAALVEDVQVAAERFASTLQSADELLRAVDPEKIANIVGSVETAASGLAGEDGIPA 518

Query: 319 -----REITDQRQKIIS-----------TINTIENITSNLNDSSQKFAELMSKINNISAL 362
                R+  D  Q++ +            I   + +T+ LN +S +   L+ K++ +   
Sbjct: 519 ILQSARQAADNVQQMTADLSKRTPDVDQIITDAQQMTATLNSTSVRVESLVEKVSEMVD- 577

Query: 363 KENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNHF 422
            +   L K+A  A    R  +        +I   L  F+  G  D+ + + +   T+   
Sbjct: 578 GDGEGLIKEATLAAQAIRKVAVAFESRADAIAGGLSKFATQGSADLTSALAQFNRTLVSI 637

Query: 423 DDCLNNFERNPQDIVWGRE 441
                +FE++P  +++G E
Sbjct: 638 QRAAQSFEQSPNRVIFGGE 656


>gi|298292075|ref|YP_003694014.1| hypothetical protein Snov_2099 [Starkeya novella DSM 506]
 gi|296928586|gb|ADH89395.1| Mammalian cell entry related domain protein [Starkeya novella DSM
           506]
          Length = 348

 Score =  109 bits (272), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 77/312 (24%), Positives = 138/312 (44%), Gaps = 33/312 (10%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++  YT +GLF ++++   FF ++W +  N   GP     +   G V GL T S+V F
Sbjct: 1   METRANYTIIGLFTLAVVAAGFFFVWWFTGLNNR-GPRTSYDVVFSGVVSGLQTGSAVTF 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NGIPVG + GL LD + P   +A   ++P+TP+   T A + +  L G++ + L     +
Sbjct: 60  NGIPVGEVTGLRLDAQDPRKVVATIAVQPNTPVKSDTRANLDSTLLTGLSSVGLVGGSTD 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
              +         R  I A  S +   + +A     ++ D +  I  ++   +  + + I
Sbjct: 120 AAPLPPPPEGELPR--IDANTSAVQDLMRSAREVLGRVDDIATRIDDLLRANDSKIASVI 177

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
            N++  S  L +N  +ID  +   QV   +       + I+ L  +LDK++ + D  KV 
Sbjct: 178 DNVDKFSKALGDNAQNIDAFLR--QVGGAA-------DRISTLANNLDKVVTSFDPNKVG 228

Query: 241 QILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAF 300
                                +T+ DV   TQ    +  K + +L + +S   S+E    
Sbjct: 229 ---------------------DTIDDVNRFTQQLDGMAMKFNTILDNVNSMTTSEEGKGM 267

Query: 301 LENIADSTSNMR 312
              I+ + + +R
Sbjct: 268 FNEISSAATEIR 279



 Score = 55.5 bits (132), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 43/199 (21%), Positives = 83/199 (41%), Gaps = 20/199 (10%)

Query: 260 VINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKS----------------KETSAFLEN 303
           V + +   RE      ++  +ID LL    SK+ S                +   AFL  
Sbjct: 141 VQDLMRSAREVLGRVDDIATRIDDLLRANDSKIASVIDNVDKFSKALGDNAQNIDAFLRQ 200

Query: 304 I---ADSTSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNIS 360
           +   AD  S + +++  +    D   K+  TI+ +   T  L+  + KF  ++  +N+++
Sbjct: 201 VGGAADRISTLANNLDKVVTSFDP-NKVGDTIDDVNRFTQQLDGMAMKFNTILDNVNSMT 259

Query: 361 ALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVN 420
             +E   +F +   A    R  +  +++    +  NL  F+  GL   + L    ++T+ 
Sbjct: 260 TSEEGKGMFNEISSAATEIRKLAVNLDKRTAELSTNLNQFTGPGLRQYEALAADGRKTLA 319

Query: 421 HFDDCLNNFERNPQDIVWG 439
             D     FERNP+  ++G
Sbjct: 320 EIDRVFRKFERNPRQFLFG 338


>gi|163850326|ref|YP_001638369.1| hypothetical protein Mext_0893 [Methylobacterium extorquens PA1]
 gi|254559577|ref|YP_003066672.1| ABC transporter periplasmic protein [Methylobacterium extorquens
           DM4]
 gi|163661931|gb|ABY29298.1| Mammalian cell entry related domain protein [Methylobacterium
           extorquens PA1]
 gi|254266855|emb|CAX22654.1| putative ABC transporter, periplasmic protein [Methylobacterium
           extorquens DM4]
          Length = 360

 Score =  108 bits (271), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 96/439 (21%), Positives = 174/439 (39%), Gaps = 91/439 (20%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++  Y  +G F + ++  +F  ++WL   ++     A  I+   GSV GL+  S+V F
Sbjct: 1   METRANYVLIGAFTIGVVLAAFGFVFWLQGGSRGQATQALRIV-FSGSVGGLAKGSTVSF 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NGI VG  + + L  + P   +A   + P TPL   T A + +  L G++ I LS    +
Sbjct: 60  NGIKVGEALDVRLLPQDPRRVVAIVQVDPSTPLRADTRARLDSAMLTGVSQIALSGGSAD 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
              +       ++   I A  S I   ++ A+  +++  D  + + K++   E  +T T+
Sbjct: 120 APAL--TPGSGDKMPTIFADSSDIQDMMAAAKQIAQRADDVLQRLDKVVAGNEGAITRTL 177

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
           AN+E+ S  LA             +  P                 S+  ++K++D Q++N
Sbjct: 178 ANVESFSKTLA-------------EAGP-----------------SIAGLVKSVDGQRLN 207

Query: 241 QILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAF 300
           +++EN +  S     SS  +   +HD R           KID +L         K    F
Sbjct: 208 RVIENAETFSTALANSSGDIQAGLHDARSLAAKLNASADKIDGVL---------KGAEGF 258

Query: 301 LENIADSTSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNIS 360
           L                                     +++    +  FAE+        
Sbjct: 259 LG------------------------------------SASGQQGAGTFAEI-------- 274

Query: 361 ALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVN 420
             +E     +DA RA   FR  SE +++   +I  +    S +   +++ L    Q T+N
Sbjct: 275 --REAAISVRDAGRA---FRALSENLDKRTANISTSFNRLSGTSRREVEALSSDGQRTLN 329

Query: 421 HFDDCLNNFERNPQDIVWG 439
                  + ER+P  +++G
Sbjct: 330 TLSRAARSLERDPSQVIFG 348


>gi|254470341|ref|ZP_05083745.1| putative periplasmic binding protein for ABC transporter
           [Pseudovibrio sp. JE062]
 gi|211960652|gb|EEA95848.1| putative periplasmic binding protein for ABC transporter
           [Pseudovibrio sp. JE062]
          Length = 645

 Score =  107 bits (267), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 72/264 (27%), Positives = 126/264 (47%), Gaps = 13/264 (4%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWL----SRSNQYDGPMAEVIIRIPGSVDGLSTDS 56
           ME++    ++G FV++++  +F   +WL     RS++ D     + I  PG+V GL    
Sbjct: 1   METRANNIAIGAFVLTVVGIAFLFTFWLLSAGDRSSRRD-----IKIIFPGAVTGLPIGG 55

Query: 57  SVRFNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELST 116
            V FNGI +G +  L  D E P   +A   +  + PL   T A++   GL G+ Y++LS 
Sbjct: 56  QVLFNGIKIGDVSALTYDAENPKLVVATVRVDANAPLRRDTVASLGFTGLTGVAYVDLSG 115

Query: 117 LRKEKKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPL 176
              E   +F  AT+     ++ A  S     +  A++  +K   +  HI +++ N +  +
Sbjct: 116 GSSESPPLFSKATD--TVPVMYARRSQFEDLLEGAKDIMRKADSTLTHIDELVMNAQPDV 173

Query: 177 TTTIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDL 236
             TI N+E  +  LANN   +D  +  + VT  S         I +L+   D ++  +  
Sbjct: 174 QKTIQNVEVFTQALANNAKGVDDFL--SGVTETSKALTGLSGKIGNLVDRGDDLLANVPP 231

Query: 237 QKVNQILENIQVSSNNFVKSSDQV 260
            K+ QI+ N++  +N    S+D V
Sbjct: 232 DKLGQIVTNVESMTNKLSASTDGV 255



 Score = 64.7 bits (156), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 62/302 (20%), Positives = 131/302 (43%), Gaps = 52/302 (17%)

Query: 144 INYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTIANIETISTVLANNISHIDKMMHT 203
           ++  +++ E  +K +SD  + I K I++         ANI  +S  +A     ID ++ +
Sbjct: 377 VSSIVTSVEKVTKTLSDKDQVIAKAIDD----AGAATANIREVSNTIAGRNKEIDSVIVS 432

Query: 204 -----TQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVNQILENIQVSSNNFVKSSD 258
                T ++  S     T +    LI++ + +++AID  KV+           N V S+D
Sbjct: 433 AREVGTNLSAASDQLSETMDNANTLISNTNGIVEAIDPAKVS-----------NIVASAD 481

Query: 259 QVINTVHD-VRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNMRSSISA 317
           +V  T+ +   E ++   E+G                       +++ D T+ ++  +  
Sbjct: 482 KVATTLAEKTPELSKAIDEIGNA--------------------AKSVNDMTTELKKKVPD 521

Query: 318 IREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNISALKENNSLFKDAQRAMH 377
           + ++ DQ +          +I +NLN +S +   ++ K++ + +  +     K+A  A  
Sbjct: 522 VDKVIDQAK----------SIATNLNAASVRVNTILEKVDGMVS-ADGQGFIKEATDAAA 570

Query: 378 TFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFERNPQDIV 437
           + R  ++   +    I   L   SQ G  D    +++L +T+      +NNF+RNP  ++
Sbjct: 571 SIRKVADAFAKRAEPISLALLKLSQQGGQDFTAAMQQLNQTLIEIRRAVNNFDRNPNRVI 630

Query: 438 WG 439
           +G
Sbjct: 631 FG 632


>gi|218528883|ref|YP_002419699.1| hypothetical protein Mchl_0853 [Methylobacterium chloromethanicum
           CM4]
 gi|240137397|ref|YP_002961868.1| putative ABC transporter, periplasmic protein [Methylobacterium
           extorquens AM1]
 gi|218521186|gb|ACK81771.1| Mammalian cell entry related domain protein [Methylobacterium
           chloromethanicum CM4]
 gi|240007365|gb|ACS38591.1| putative ABC transporter, periplasmic protein [Methylobacterium
           extorquens AM1]
          Length = 360

 Score =  106 bits (265), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 95/439 (21%), Positives = 173/439 (39%), Gaps = 91/439 (20%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++  Y  +G F + ++  +F  ++WL   ++     A  I+   GSV GL+  S+V F
Sbjct: 1   METRANYVLIGAFTIGVVLAAFGFVFWLQGGSRGQATQALRIV-FSGSVGGLAKGSTVSF 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NGI VG  + + L  + P   +A   + P TPL   T A + +  L G++ I LS    +
Sbjct: 60  NGIKVGEALDVRLLPQDPRRVVAIVQVDPSTPLRADTRARLDSAMLTGVSQIALSGGSAD 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
              +       ++   I A  S I   ++ A+  +++  D  + + K++   E  +  T+
Sbjct: 120 APAL--TPGSGDKMPTIFADSSDIQDMMAAAKQIAQRADDVLQRLDKVVAGNEGAINRTL 177

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
           AN+E+ S  LA             +  P                 S+  ++K++D Q++N
Sbjct: 178 ANVESFSKTLA-------------EAGP-----------------SIAGLVKSVDGQRLN 207

Query: 241 QILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAF 300
           +++EN +  S     SS  +   +HD R           KID +L         K    F
Sbjct: 208 RVIENAETFSTALANSSGDIQAGLHDARSLAAKLNASADKIDGVL---------KGAEGF 258

Query: 301 LENIADSTSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNIS 360
           L                                     +++    +  FAE+        
Sbjct: 259 LG------------------------------------SASGQQGAGTFAEI-------- 274

Query: 361 ALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVN 420
             +E     +DA RA   FR  SE +++   +I  +    S +   +++ L    Q T+N
Sbjct: 275 --REAAISVRDAGRA---FRALSENLDKRTANISTSFNRLSGTSRREVEALSSDGQRTLN 329

Query: 421 HFDDCLNNFERNPQDIVWG 439
                  + ER+P  +++G
Sbjct: 330 TLSRAARSLERDPSQVIFG 348


>gi|188580087|ref|YP_001923532.1| Mammalian cell entry related domain protein [Methylobacterium
           populi BJ001]
 gi|179343585|gb|ACB78997.1| Mammalian cell entry related domain protein [Methylobacterium
           populi BJ001]
          Length = 360

 Score =  106 bits (264), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 88/391 (22%), Positives = 165/391 (42%), Gaps = 54/391 (13%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++  Y  +G F + ++  +F  ++WL   ++     A  I+   GSV GL+  S+V F
Sbjct: 1   METRANYVLIGAFTIGVVLAAFGFVFWLQGGSRGQATQALRIV-FSGSVGGLAKGSTVSF 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NGI VG  + + L  + P   +A   + P TPL   T A + +  L G++ I LS    +
Sbjct: 60  NGIKVGEALDVRLLPQDPRRVVAVVQVDPSTPLRADTRARLDSAMLTGVSQIALSGGSAD 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
              +       ++   I A  S I   ++ A+  +++  D  + + K++   E  +  T+
Sbjct: 120 APAL--TPGSGDKMPTIFADSSDIQDMMAAAKQIAQRADDVLQRLDKVVAGNEGAINRTL 177

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
           AN+E  S  LA             +  P                 S+  ++K++D Q++N
Sbjct: 178 ANVEAFSKTLA-------------EAGP-----------------SIAGLVKSVDGQRLN 207

Query: 241 QILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLL---SDFSSKMKSKET 297
           +++EN    S     SS  +   +HD RE          +ID +L     F      ++ 
Sbjct: 208 RVIENADTFSTALANSSPDIEAGLHDARELAAKLSASADRIDGVLKGAEGFLGSASGQQG 267

Query: 298 SAFLENIADSTSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKIN 357
           +     I ++  ++R +  A R +++   K  + I+T  N    L+ +S++  E +S   
Sbjct: 268 AGTFAEIREAAISVRDAGKAFRTLSENLDKRTANISTSFN---RLSGTSRREVEALS--- 321

Query: 358 NISALKENNSLFKDAQRAMHTFRDTSEKINR 388
                        D QR ++T    +  + R
Sbjct: 322 ------------SDGQRTLNTLSRAARSLER 340


>gi|307945711|ref|ZP_07661047.1| ABC transporter, periplasmic substrate-binding protein [Roseibium
           sp. TrichSKD4]
 gi|307771584|gb|EFO30809.1| ABC transporter, periplasmic substrate-binding protein [Roseibium
           sp. TrichSKD4]
          Length = 667

 Score =  105 bits (263), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 109/462 (23%), Positives = 195/462 (42%), Gaps = 75/462 (16%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQ------YDGPMAEVIIRIPGSVDGLST 54
           ME++  Y  +G F+V  L  +F  IYWL+ + +      +D       I  P  V GL  
Sbjct: 1   METRANYVVIGAFMVGTLALAFGFIYWLALTAETRENVFFD-------IVFPAPVTGLPV 53

Query: 55  DSSVRFNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIEL 114
              V FNGI VG +  L  D+  P   +A   ++PDTPL   T AT+   GL G+ Y++L
Sbjct: 54  GGQVLFNGIKVGDVSQLNFDRTDPTKVVATVRVKPDTPLRKDTKATLNFTGLTGVAYVDL 113

Query: 115 STLRKEKKTIFQIATERNQ--RAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENI 172
           +    +   +F       +  R +I A  S  +     A +   KI  +   ++ ++ + 
Sbjct: 114 NGGSLDSPLLFTGYENLGEGPRPVIYAEKSLFDDITGGARDVLHKIETTLDEVEGLLVDN 173

Query: 173 EKPLTTTIANIETISTVLANNISHIDKMMHT----TQVTPHSSDSKNTF----------- 217
              +T  + N+ET ST LA+N   +   M +    T+     S    T            
Sbjct: 174 RPAITKIVTNVETFSTALASNSDGVSDFMASLSSATEAFVKLSGRMETLVVEGERILAAI 233

Query: 218 --NTITDLI-------TSLDKMIKAI-----DLQKVNQILENIQVSSNNFVKSSDQVINT 263
             + +TD++        SL K+ K I     D Q   Q LE   V  N  + S  +++  
Sbjct: 234 PSDKVTDIVDNVDVFTDSLGKVGKDIEVVLADAQSAAQELEKFSVGLNAQLDSVGKIVAA 293

Query: 264 V--HDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNMRSS----ISA 317
           V   DV++       +G+ +    S+ ++ + +  T+  ++N+A  ++ +R      ++A
Sbjct: 294 VNPEDVQQVVSGAASLGKVLKDRTSEINTLISASSTT--MDNLASVSTTIREQDQNLVAA 351

Query: 318 IR-----------------EITD--QRQKIISTINTIENITSNLNDSSQKFAELMSKINN 358
           I                  EI D      +  T+ ++E+ T+NLN S  +   +++ ++ 
Sbjct: 352 IESGKGVLEKADVMMARGIEIVDAVDPASVQQTVASVESFTTNLNASLGRVDAIVAAVDP 411

Query: 359 ISALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNF 400
           +S      S+  D    +  FR    +IN  I +  +++QN 
Sbjct: 412 VSV----QSVVDDTAEIVSNFRAQEAQINEIITATRSSIQNI 449



 Score = 57.8 bits (138), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 51/220 (23%), Positives = 99/220 (45%), Gaps = 27/220 (12%)

Query: 228 DKMIKAIDLQKVNQILENIQVSSNNFVKSS---DQVINTVHDVRETTQTFQEVGQKIDHL 284
           D++I  ID  +V  +     ++S + V S+   +QV N V  V   T       Q ID +
Sbjct: 461 DRIIALIDDLRVASVQFTETLASADTVISAVKPEQVANIVGSVETMTGGLSAQKQTIDEI 520

Query: 285 LSDFSSKMKSKETSAFLENIADSTSNMRSSISAIREITDQRQKIISTINTIENITSNLND 344
           +   S++  ++      EN+A  T ++       + ITD +Q           +T+NLN 
Sbjct: 521 I--LSARATAQNVEKMSENLASRTPDVD------QIITDAKQ-----------LTANLNA 561

Query: 345 SSQKFAELMSKINNISAL--KENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQ 402
           +S +   +   ++N+  +   +   L K+A  A  + R  +E       +I + L  F+ 
Sbjct: 562 TSVR---IQGIVDNVGTMVDADGEGLIKEATAAAASIRKIAEAFESRAGTIADGLAKFAN 618

Query: 403 SGLNDIQNLVRKLQETVNHFDDCLNNFERNPQDIVWGREK 442
            G +D    + ++  T+      + +F+RNPQ +++G E+
Sbjct: 619 QGSSDFAAAMEQVNRTLISIQRAVESFDRNPQRVIFGGEQ 658


>gi|170748372|ref|YP_001754632.1| hypothetical protein Mrad2831_1954 [Methylobacterium radiotolerans
           JCM 2831]
 gi|170654894|gb|ACB23949.1| Mammalian cell entry related domain protein [Methylobacterium
           radiotolerans JCM 2831]
          Length = 360

 Score =  101 bits (252), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 91/393 (23%), Positives = 160/393 (40%), Gaps = 58/393 (14%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRI--PGSVDGLSTDSSV 58
           ME++  Y  +G F ++++   F ++ WLS  +         ++RI   GSV GLS  SSV
Sbjct: 1   METRANYALIGAFTIAVILAGFGTVLWLSGGSSR---QVSQLVRIVFSGSVGGLSRGSSV 57

Query: 59  RFNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLR 118
            FNGI VG +  + L  + P   LA   + P TPL   T A + +  L G++ I LS   
Sbjct: 58  NFNGIKVGEVTDIRLAPQDPRRVLATIKVDPATPLRADTRARLDSAMLTGVSVISLSGGN 117

Query: 119 KEKKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTT 178
            +   +  +A    +   I A  S +   ++ A   +++  D    + +++   E  +  
Sbjct: 118 ADAPVLTPMAN--GEPPTIFADSSDMQDMMALARQVAQRADDMLARLDRLVSANEGAINR 175

Query: 179 TIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQK 238
           ++AN+ET S  LA                              D   ++  ++KA+D  K
Sbjct: 176 SLANVETFSKTLA------------------------------DAGPNISALVKAVDGAK 205

Query: 239 VNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSD---FSSKMKSK 295
           + ++++N    S    K+S  +   +HD R           KID +L+    F      +
Sbjct: 206 LGRVIDNADRFSAALSKASPDIEAGLHDARLLAGKLSASADKIDAVLNGAESFLGSASGQ 265

Query: 296 ETSAFLENIADSTSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSK 355
           E S+    I  +  ++R +  A R +++   K  ++I             S  F  L   
Sbjct: 266 EGSSTFAEIRAAAISVRDAGKAFRTMSENLDKRTASI-------------SANFGRLSG- 311

Query: 356 INNISALKENNSLFKDAQRAMHTFRDTSEKINR 388
               +  +E  +L  D QR + T   T   + R
Sbjct: 312 ----TGRREVEALSGDGQRTLSTLNRTVRSLER 340


>gi|328543114|ref|YP_004303223.1| ABC transporter, substrate binding protein [Polymorphum gilvum
           SL003B-26A1]
 gi|326412860|gb|ADZ69923.1| ABC transporter, substrate binding protein [Polymorphum gilvum
           SL003B-26A1]
          Length = 549

 Score =  100 bits (248), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 105/546 (19%), Positives = 201/546 (36%), Gaps = 113/546 (20%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSR---SNQYDGPMAEVIIRIPGSVDGLSTDSS 57
           ME++  Y  +G FV+ ILF +F  IYWL+    S Q       V +  PG V GL     
Sbjct: 1   METRANYVLIGGFVLGILFAAFVFIYWLAATVDSRQS----VNVKVIFPGPVTGLPIGGQ 56

Query: 58  VRFNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTL 117
           V FNGI +G +  L  DQ  P   +A   + P+ PL     AT+  QGL G+ Y++L   
Sbjct: 57  VLFNGIKIGDVGSLDFDQTDPQVVIATIRVNPNAPLRRDIRATLGFQGLTGVAYVDLKGG 116

Query: 118 RKEKKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLT 177
             E   + Q   E     +I A  S  +  + N  +  KK   +   +  +++     ++
Sbjct: 117 STETPLLIQPDME--SEPVIYADRSFFDDILENGRDVLKKADTTLDTLNSVLQESRPAIS 174

Query: 178 TTIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQ 237
             + N+ET S  LA N   ++  M +      +  S +    +  L+   ++++ A+   
Sbjct: 175 EIVRNVETFSKALAENADGVEGFMASVGKATEAFSSLS--GRMEGLVEQGERILAAVPSD 232

Query: 238 KVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMK---- 293
           KV +++ N+   + +  + +  +   V +    T   Q+  ++++  +    + +K    
Sbjct: 233 KVEEMVGNVTDFTASLKEIAPDIRQMVAEAESATANLQQFTERLNAGMDGVEAVIKAVRP 292

Query: 294 --------------------SKETSAFLENIADSTSNMRSSISAIRE--------ITDQR 325
                               S E    + +  ++  N+RS  S+IR         I   R
Sbjct: 293 EDVEKAVAGAGALGAVLEKRSAELDTLIASTGETMDNIRSVSSSIRAREEDISAFIAGAR 352

Query: 326 ----------------------QKIISTINTIENITSNLNDSSQKFAELMSKINNISALK 363
                                 QK+ + + ++E +T  L+   +     ++   N +   
Sbjct: 353 DVVGKIGTGVERTTEVVQAIDPQKVSNIVASVEEVTGKLSGQGEAIEATIASARNAAGTI 412

Query: 364 ENNS------------LFKDAQRAMHTFRDTSEKINRYIPSIG----------------- 394
           E  S            +  DA++        S +++  +  +G                 
Sbjct: 413 EKMSADLSARTADVDQIITDAKQIATNLNAASARVDEIVSKVGTMVDGDGEGFIVEATRA 472

Query: 395 -------------------NNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFERNPQD 435
                              + L  F+  G  D+   + ++  T       + NF+RNP  
Sbjct: 473 AEAIRKVAEAFESRADGIASGLSKFANQGTADLTAALGQVNRTFVSIQRAVENFDRNPNR 532

Query: 436 IVWGRE 441
           +++G E
Sbjct: 533 VIFGGE 538


>gi|118588762|ref|ZP_01546170.1| ABC transporter, substrate binding protein [Stappia aggregata IAM
           12614]
 gi|118438748|gb|EAV45381.1| ABC transporter, substrate binding protein [Stappia aggregata IAM
           12614]
          Length = 668

 Score = 98.2 bits (243), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 118/498 (23%), Positives = 207/498 (41%), Gaps = 89/498 (17%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWL-----SRSNQYDGPMAEVIIRIPGSVDGLSTD 55
           ME++  Y  +G F+V++L  +F  +YWL     SR N       E+ I  PG V GL   
Sbjct: 1   METRANYILIGAFMVAVLIGAFGFVYWLAVTADSRQN------VELKIVYPGPVTGLPVG 54

Query: 56  SSVRFNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELS 115
             V FNGI VG +  L      P   +A   I+P TPL   T AT+   GL G+ Y++LS
Sbjct: 55  GQVLFNGIKVGDVKSLDFAPGDPTKVVATIGIKPSTPLREDTKATLNFTGLTGVAYVDLS 114

Query: 116 TLRKEKKTIFQIATERNQR--AMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIE 173
               E   +     ++++    +I A  S  +  +  A +  K+   + + +  ++++  
Sbjct: 115 GGSSESPLLLSSNEDQDEDNIPVIYAERSFFDDIVDGARDVLKRADSTMKTVDDLLKDNG 174

Query: 174 KPLTTTIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNT-ITDLITSLDKMIK 232
             +T  + N ET S  LA N   +   M +      +S++ ++ +  +  L+   ++++ 
Sbjct: 175 PAITEIVNNAETFSAALAANSDGVKDFMASIG---KASEAFSSLSARLETLVQEGERILA 231

Query: 233 AIDLQKVNQILENIQVSSNNFVKSSDQV------------------------INTVH--- 265
           A+   KV  I++++   S +  K+S  +                        ++ VH   
Sbjct: 232 AVPSDKVTTIVDDLSKFSASLGKASSDIDLLMADAQSAAKELQTFTVNLNEGLDRVHKIV 291

Query: 266 ------DVRETTQ---TFQEVGQK----IDHLLSDFSSKMKSKETSAFLENIADSTSNMR 312
                 DV++  Q      EV QK    ID L+S  S  M++   +A +ENI +    ++
Sbjct: 292 GAVNPEDVQKVVQGAAALGEVLQKRTGDIDKLISSTSETMQN--VNAVVENIRNQEGAIK 349

Query: 313 SSISAIREITDQRQKIIS----------------TINTIENITSNLNDSSQKFAELMSKI 356
             +   RE+  +   I++                 +  +   T NLN S  K  EL++ +
Sbjct: 350 DIVQGGREVVVKVDAIMTRGVEIAAAIDPLKVEEVVANVSTFTDNLNASLGKVDELVASV 409

Query: 357 N--NISALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQ-----SGLND-I 408
           +   +S   +N S   D       F +   +IN  I S  + +QNF        G +D I
Sbjct: 410 DPEKVSKAVDNVSSIID------NFNNQQSQINEIIASTKSTVQNFEAVSATVRGQDDRI 463

Query: 409 QNLVRKLQETVNHFDDCL 426
             L+  +Q     F   L
Sbjct: 464 AALITDVQAAAERFATTL 481



 Score = 48.1 bits (113), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 51/257 (19%), Positives = 102/257 (39%), Gaps = 43/257 (16%)

Query: 227 LDKMIKAIDLQKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEV-----GQ-- 279
           +D+++ ++D +KV++ ++N+    +NF     Q+   +   + T Q F+ V     GQ  
Sbjct: 402 VDELVASVDPEKVSKAVDNVSSIIDNFNNQQSQINEIIASTKSTVQNFEAVSATVRGQDD 461

Query: 280 KIDHLLSDFSSKMKSKETS--------------------AFLENIADSTSNMRSSISAIR 319
           +I  L++D  +  +   T+                      +E      +N    I AI 
Sbjct: 462 RIAALITDVQAAAERFATTLQTANDLMKAVDPEKVANIVGSVETATSGLANPEDGIPAIL 521

Query: 320 E-----------ITDQRQKIISTINTI----ENITSNLNDSSQKFAELMSKINNISALKE 364
           E           +TD   K    ++ I    + +T+ LN +S +   L+ K++ +    +
Sbjct: 522 ESARKAADNVQRMTDDLSKRTPDVDQIISDAKQMTATLNSTSVRVESLVEKVSTM-VDGD 580

Query: 365 NNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDD 424
              L K+A  A    R  +        +I   L  F+  G  D    + ++  T+     
Sbjct: 581 GEGLIKEATLAAQAIRKVAVAFESRADAIAGGLSKFATQGSADFAAALAQVNRTLISIQR 640

Query: 425 CLNNFERNPQDIVWGRE 441
              +FER+P  +++G E
Sbjct: 641 AAESFERSPNRVIFGGE 657


>gi|323136830|ref|ZP_08071911.1| Mammalian cell entry related domain protein [Methylocystis sp. ATCC
           49242]
 gi|322398147|gb|EFY00668.1| Mammalian cell entry related domain protein [Methylocystis sp. ATCC
           49242]
          Length = 301

 Score = 94.4 bits (233), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 74/260 (28%), Positives = 121/260 (46%), Gaps = 11/260 (4%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++  Y  +G F ++I F +F  +YW S  +Q  G      I   G+V GL+  S V F
Sbjct: 1   METRANYALIGAFTLAIAFAAFGFVYWFSGPSQI-GRQETYQIVFSGAVSGLTRGSGVLF 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIEL--STLR 118
           NG+ VG +  L + +  P+    +  I   TP+   T A + T+G  G+  + L   T R
Sbjct: 60  NGVKVGEVTHLAISESDPSKVDVEVKIDNRTPVKTDTRARLETRGFTGVADVLLVGGTPR 119

Query: 119 KEKKTIFQIATERNQR-AMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLT 177
             K     +  +  QR   I A  S I   + N ++ S K ++    + K+++     +T
Sbjct: 120 APK-----LVAQPGQRYPQIQAERSEIQNLLGNVQHLSTKAAEVLVKLDKLLDQNSDSIT 174

Query: 178 TTIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQ 237
            T+ N ET +  LA+N S +   M       HS   K     +  ++ + +  +KAID +
Sbjct: 175 ATLKNAETFTKTLADNSSAVTAFMRDAADVAHS--LKPVAARLDKVLAAGEARLKAIDPR 232

Query: 238 KVNQILENIQVSSNNFVKSS 257
           K+ +I  NI  +S N  K S
Sbjct: 233 KIKEITGNIAGASANINKFS 252


>gi|220924821|ref|YP_002500123.1| Mammalian cell entry related domain-containing protein
           [Methylobacterium nodulans ORS 2060]
 gi|219949428|gb|ACL59820.1| Mammalian cell entry related domain protein [Methylobacterium
           nodulans ORS 2060]
          Length = 359

 Score = 94.4 bits (233), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 96/439 (21%), Positives = 166/439 (37%), Gaps = 91/439 (20%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++     +G F ++++   F   YW+  S   +G M   I+   G V GL+  S V F
Sbjct: 1   METRANNVLIGTFTLAVIAAGFLFAYWMRGSVSNEGRMPLRIV-FSGGVGGLAKGSIVTF 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NGI VG    + L  + P    A   +   TPL   T A +    L G+  I L     +
Sbjct: 60  NGIRVGEATDVQLLPQDPRRVTALVEVERTTPLRADTRARLDMTMLTGVASIALVGGSAD 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
              +   A E  + A I A  S I   + +A   +++  D  + + +++   E  +  T+
Sbjct: 120 APPL--KAPEGERMATIFADSSEIQDLMQSARTIAQRADDMLQRLDRVVAGNEGAINRTL 177

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
           AN+E  S                               T+ D   +LD ++KA+D +K+ 
Sbjct: 178 ANVEQFS------------------------------KTLNDSAPALDALVKAVDGRKLG 207

Query: 241 QILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAF 300
            +++N    S     ++  +   +HD R+          ++D +L         K    F
Sbjct: 208 SLIDNADRFSAALAAAAPDIAAGLHDARQLAAKLNASADRVDAVL---------KGAEGF 258

Query: 301 LENIADSTSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNIS 360
           L +   S    RS+   IRE                                      IS
Sbjct: 259 LGSA--SGEEGRSTFGEIREAA------------------------------------IS 280

Query: 361 ALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVN 420
                    ++A RA   FR  SE +++   +I  +    S +G  ++QNL  + Q T+N
Sbjct: 281 --------IREAGRA---FRTMSENLDKRTATITTSFGRLSGAGRREVQNLSTEGQRTLN 329

Query: 421 HFDDCLNNFERNPQDIVWG 439
             +    + ER+P  +++G
Sbjct: 330 SLNSAARSLERDPSQVIFG 348


>gi|170743043|ref|YP_001771698.1| hypothetical protein M446_4935 [Methylobacterium sp. 4-46]
 gi|168197317|gb|ACA19264.1| Mammalian cell entry related domain protein [Methylobacterium sp.
           4-46]
          Length = 359

 Score = 92.0 bits (227), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 93/439 (21%), Positives = 165/439 (37%), Gaps = 91/439 (20%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++     +G F ++++   F   +W+      DG M   I+   G V GL+  S V F
Sbjct: 1   METRANNVLIGTFTLAVIAAGFLFAFWMRGPVSNDGRMPLRIV-FSGGVGGLAKGSVVTF 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NGI VG    + L  + P   +A   +   TPL   T A +    L G+  I L     +
Sbjct: 60  NGIRVGEATEVELLPQDPRRVMALVEVERSTPLRADTRARLDMTMLTGVASIALVGGSAD 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
              +   A E ++ A I A  S I   + +A   +++  D  + + +++   E  +  T+
Sbjct: 120 APPL--KAPEGDRMATIFADSSDIQDLMQSARTIAQRADDMLQRLDRVVAGNEGAINRTL 177

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
           AN+E  S  L                               D   +LD ++KA+D +K+ 
Sbjct: 178 ANVEQFSKAL------------------------------NDSAPALDALVKAVDGRKLG 207

Query: 241 QILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAF 300
            +++N    S     ++  + + +HD R           ++D +L         K    F
Sbjct: 208 SLIDNADRFSAALAAAAPDIQDGLHDARLLAAKLNASADRVDAVL---------KGAEGF 258

Query: 301 LENIADSTSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNIS 360
           L + +      +S+   IRE                                      IS
Sbjct: 259 LGSASGEAG--KSTFGEIREAA------------------------------------IS 280

Query: 361 ALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVN 420
                    ++A RA   FR  SE +++   +I  +    S +G  ++QNL  + Q T+N
Sbjct: 281 --------IREAGRA---FRTMSENLDKRTATITTSFGRLSGAGRREVQNLSTEGQRTLN 329

Query: 421 HFDDCLNNFERNPQDIVWG 439
             +      ER+P  +++G
Sbjct: 330 SLNSAARTIERDPSQVIFG 348


>gi|158423839|ref|YP_001525131.1| ABC-type transport system protein [Azorhizobium caulinodans ORS
           571]
 gi|158330728|dbj|BAF88213.1| ABC-type transport system protein [Azorhizobium caulinodans ORS
           571]
          Length = 307

 Score = 89.7 bits (221), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 64/250 (25%), Positives = 121/250 (48%), Gaps = 20/250 (8%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDG-PMAEVIIRIPGSVDGLSTDSSVR 59
           ME++  YT +G+F ++++  +F  +YW +     D   + EV+ +  GSV GL   ++V 
Sbjct: 1   METRANYTVIGIFTLAVIAAAFVFVYWFAGPKDSDKRKLYEVLYQ--GSVSGLREGNAVL 58

Query: 60  FNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRK 119
           FNGIPVG++  L L    PN  L +  +R D P+     A++ +QG+ GI  +   +++ 
Sbjct: 59  FNGIPVGQVTKLGLVPGAPNEVLVQIGVRNDVPILADARASLESQGITGIVAV---SIQG 115

Query: 120 EKKTIFQIATERNQRAMITA-TPSGINYFISNAENTSKKIS--------DSSRHIQKIIE 170
                  I    N    I A   +G+   + NA+ T  K++        D  R I   +E
Sbjct: 116 GNAKAGPIPPGPNGLPRIEALGGTGMAGLLQNAQGTVAKVNSILDAIDPDQVRQIVANVE 175

Query: 171 NIEKPLTTTIANIETISTVLANNISHIDKMMHTTQVT----PHSSDSKNT-FNTITDLIT 225
           N+ K L+    +I ++ + + + ++ ++++     V      H+S  K+   N  T+  T
Sbjct: 176 NVSKQLSDNSGDIASMISGVKDAVAQVNEIAKKVDVVVVNLQHASGDKDGLLNQATEAAT 235

Query: 226 SLDKMIKAID 235
           ++ K+   +D
Sbjct: 236 AVRKLADNLD 245



 Score = 45.1 bits (105), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 34/161 (21%), Positives = 71/161 (44%), Gaps = 24/161 (14%)

Query: 298 SAFLENIADSTSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMS--- 354
           +  L+N   + + + S + AI    DQ ++I++ +   EN++  L+D+S   A ++S   
Sbjct: 142 AGLLQNAQGTVAKVNSILDAID--PDQVRQIVANV---ENVSKQLSDNSGDIASMISGVK 196

Query: 355 ----KINNIS------------ALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQ 398
               ++N I+            A  + + L   A  A    R  ++ +++    + N + 
Sbjct: 197 DAVAQVNEIAKKVDVVVVNLQHASGDKDGLLNQATEAATAVRKLADNLDQRTALLTNEIS 256

Query: 399 NFSQSGLNDIQNLVRKLQETVNHFDDCLNNFERNPQDIVWG 439
            F+  GL   + L    + T+   +    N ERNP+  ++G
Sbjct: 257 RFTGPGLRQYEALAADGRRTLTEIERVFRNLERNPRQFIFG 297


>gi|154252956|ref|YP_001413780.1| hypothetical protein Plav_2514 [Parvibaculum lavamentivorans DS-1]
 gi|154156906|gb|ABS64123.1| Mammalian cell entry related domain protein [Parvibaculum
           lavamentivorans DS-1]
          Length = 302

 Score = 88.6 bits (218), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 70/285 (24%), Positives = 133/285 (46%), Gaps = 37/285 (12%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME K+    +G+F +  +   F  + W+S   Q++   A   I   GSV GLS    V++
Sbjct: 1   MEIKSNNVLIGVFTLVTVVGMFLFLLWIS-GVQFNRQFAYYKIIFDGSVSGLSQSGPVQY 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NG+PVG++  L+L    PN  +A   +   TP+   + A +   GL G+ +I+L+    E
Sbjct: 60  NGLPVGKVTDLYLMARNPNKVVAIIQVDARTPVKEDSVAQLELSGLTGVAFIQLTGGSPE 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
              +   A       +I A PS +   + +   T +  ++  + + K++ + ++ ++  +
Sbjct: 120 SAEL--QARPGQDYPVIKAAPSSLQDLLKSGPETLQNANELIKELNKVVADNQRSISEAL 177

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
           AN+ TIS  LA                    DS        D+ T+LD++ +A      +
Sbjct: 178 ANLNTISKALA--------------------DSSG------DVTTALDQIAQA------S 205

Query: 241 QILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLL 285
           + L +I  S++  +K  + V   + D RE  ++++EV  ++D +L
Sbjct: 206 RHLNSISRSADGLMK--EDVKAFIADAREAARSYREVANELDAIL 248


>gi|182680565|ref|YP_001834711.1| hypothetical protein Bind_3670 [Beijerinckia indica subsp. indica
           ATCC 9039]
 gi|182636448|gb|ACB97222.1| Mammalian cell entry related domain protein [Beijerinckia indica
           subsp. indica ATCC 9039]
          Length = 353

 Score = 88.2 bits (217), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 98/406 (24%), Positives = 167/406 (41%), Gaps = 74/406 (18%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIP--GSVDGLSTDSSV 58
           ME++  Y  +G F ++++   F  I W S SN+   P  +V +R+   GS+ GLS   +V
Sbjct: 1   METRANYALIGGFTLAVIVSIFLFILWFSGSNR---PAHQVPLRVLFNGSISGLSRGGAV 57

Query: 59  RFNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLR 118
            FNG+ VG +  + L  + P+   A  +I    PL   T A +    L GI  + L+   
Sbjct: 58  LFNGVKVGEVTHIDLAPDDPSRVQADVVIDARVPLRSDTKARLEFTNLTGIAALALTGGS 117

Query: 119 KEKKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTT 178
            +   +   A      ++I A  S     + +A   + + S+       ++++    L  
Sbjct: 118 SDAPPL--PAAADGGPSVIRADRSDFQDLLESARRIATQASEFLDRANGLVDSNSASLGK 175

Query: 179 TIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITD----LITSLDKMIKAI 234
           TI N E  S  LA N   I   M +       +D   T   +T     L T  DK++K+I
Sbjct: 176 TIKNAEKFSDALAANSDGIKDFMGSM------ADIGRTIKPLTGKLETLATDTDKVVKSI 229

Query: 235 DLQKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKS 294
           +  +V  ILE+    +++F                 +      G KI+ +++   S + S
Sbjct: 230 EPDRVKSILEH----ADSF-----------------SGKLDAAGNKIEGVMASLESFLGS 268

Query: 295 KETSAFLENIADSTSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMS 354
            E+   L +I  S S + S+  A+R   D                 N+N    +FA    
Sbjct: 269 GESKNALNDIKGSFSEVASAAKAVRRAAD-----------------NIN----RFAG--- 304

Query: 355 KINNISALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNF 400
                S L++  +L  D ++ + T       I++ + SI NN Q F
Sbjct: 305 -----SGLRQYEALAVDGRKTLDT-------ISQAVRSIENNPQQF 338


>gi|296445996|ref|ZP_06887946.1| Mammalian cell entry related domain protein [Methylosinus
           trichosporium OB3b]
 gi|296256514|gb|EFH03591.1| Mammalian cell entry related domain protein [Methylosinus
           trichosporium OB3b]
          Length = 294

 Score = 87.8 bits (216), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 71/282 (25%), Positives = 126/282 (44%), Gaps = 22/282 (7%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSN---QYDGPMAEVIIRIPGSVDGLSTDSS 57
           ME++  Y  +G F ++++F +F  ++W S  +   QY        I   GSV GL+   +
Sbjct: 1   METRANYALIGAFTIAVVFAAFGFVFWFSGPSTTAQYK----TYQIVFSGSVSGLTRGGA 56

Query: 58  VRFNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTL 117
           V F+G+ VG +  L + +E P+       I   TP+   T A + + G  G+  + L   
Sbjct: 57  VEFDGLKVGEVTQLAISEEDPSRVDVLVNIDKKTPIKIDTKARLESAGFTGVKTVALVGG 116

Query: 118 RKEKKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLT 177
                 +     +   R  I A  S +   I + +  SKK +D+   I K+++     ++
Sbjct: 117 TPRAPVLAAAPGQAYPR--IEAEGSDLQNIIDSVQRLSKKATDALDKIDKLLDANSATIS 174

Query: 178 TTIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQ 237
            T+ N ET +  LA+N  +I  +M          D      ++  +   LDK++ AID +
Sbjct: 175 QTLQNAETFTKALADNSENIGSVMK---------DMAALGRSLKPIPERLDKLLAAIDPK 225

Query: 238 KVNQILENIQVSSNNFVKSSDQVINTVH----DVRETTQTFQ 275
           K++ I  +I  +SNN    S   +        D R+T +T +
Sbjct: 226 KLSSISTDIAAASNNLKTFSGGGLKQYELLAVDARKTLETVE 267



 Score = 41.6 bits (96), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 38/148 (25%), Positives = 66/148 (44%), Gaps = 14/148 (9%)

Query: 301 LENIADSTSNMRS----SISAIREITDQRQKIIS-TINTIENITSNLNDSSQKFAELMSK 355
           L+NI DS   +      ++  I ++ D     IS T+   E  T  L D+S+    +M  
Sbjct: 141 LQNIIDSVQRLSKKATDALDKIDKLLDANSATISQTLQNAETFTKALADNSENIGSVM-- 198

Query: 356 INNISALKENNSLFKDAQRAMHTFRDTSEK----INRYIPSIGNNLQNFSQSGLNDIQNL 411
             +++AL    SL    +R          K    I+  I +  NNL+ FS  GL   + L
Sbjct: 199 -KDMAAL--GRSLKPIPERLDKLLAAIDPKKLSSISTDIAAASNNLKTFSGGGLKQYELL 255

Query: 412 VRKLQETVNHFDDCLNNFERNPQDIVWG 439
               ++T+   +  + + E+NPQ +++G
Sbjct: 256 AVDARKTLETVERAVRSLEKNPQQVLFG 283


>gi|29654063|ref|NP_819755.1| ABC transporter periplasmic substrate-binding protein [Coxiella
           burnetii RSA 493]
 gi|153209294|ref|ZP_01947329.1| ABC transporter, periplasmic substrate-binding protein [Coxiella
           burnetii 'MSU Goat Q177']
 gi|154706397|ref|YP_001424138.1| hypothetical protein CBUD_0743 [Coxiella burnetii Dugway 5J108-111]
 gi|161830138|ref|YP_001596959.1| ABC transporter, periplasmic substrate-binding protein [Coxiella
           burnetii RSA 331]
 gi|165924019|ref|ZP_02219851.1| ABC transporter, periplasmic substrate-binding protein [Coxiella
           burnetii RSA 334]
 gi|212219046|ref|YP_002305833.1| hypothetical protein CbuK_1526 [Coxiella burnetii CbuK_Q154]
 gi|29541329|gb|AAO90269.1| hypothetical exported protein [Coxiella burnetii RSA 493]
 gi|120575410|gb|EAX32034.1| ABC transporter, periplasmic substrate-binding protein [Coxiella
           burnetii 'MSU Goat Q177']
 gi|154355683|gb|ABS77145.1| hypothetical exported protein [Coxiella burnetii Dugway 5J108-111]
 gi|161762005|gb|ABX77647.1| ABC transporter, periplasmic substrate-binding protein [Coxiella
           burnetii RSA 331]
 gi|165916542|gb|EDR35146.1| ABC transporter, periplasmic substrate-binding protein [Coxiella
           burnetii RSA 334]
 gi|212013308|gb|ACJ20688.1| hypothetical exported protein [Coxiella burnetii CbuK_Q154]
          Length = 308

 Score = 85.1 bits (209), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 74/314 (23%), Positives = 151/314 (48%), Gaps = 39/314 (12%)

Query: 1   MESKNYYTSVGLFVV-----SILFFSFFSIYWLSRSNQ-YDGPMAEVIIRIPGSVDGLST 54
           M++K  YT VG F++     SI+ F +FS +   R  Q +D      ++ +   V G+ST
Sbjct: 1   MDTKVNYTLVGFFIILLGAASIVIFLWFSTF---RHRQTFD----TYLVYMHEEVSGIST 53

Query: 55  DSSVRFNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIEL 114
            + VRFNG+ VG +  + ++   P   +    I+ +TP+  ST AT+R++G+ G  Y+ L
Sbjct: 54  QTPVRFNGVKVGYVQKIEINPADPQQVVLTLKIKHETPITTSTVATLRSEGIMGTDYVAL 113

Query: 115 STLRKEKKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKII-ENIE 173
             L      +  IA    +  +I + PS +    +  +  +K I + S ++ K+  E   
Sbjct: 114 KALTATAPPL--IAKPGEKYPVIPSEPSLLMKLSTALQEVTKTIKELSDNVGKVFDEKNR 171

Query: 174 KPLTTTIANIETISTVLANNISHIDKMMHTT-QVTPHSSDSKNTFNTITDLITSLDKMIK 232
           + ++ ++ NI+ ++  L++N  +ID  +H+  Q+  +S+ +     TI            
Sbjct: 172 RAISASLVNIQKVTKTLSDNSENIDATLHSMKQLMKNSAKASEQLPTI------------ 219

Query: 233 AIDLQKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQ-EVGQKIDHLLSDFSSK 291
              + ++   L NI++++  F ++   +  TV D     Q+   ++   +  LL+  ++ 
Sbjct: 220 ---MHQLQDTLANIKITARQFDRAGHGIELTVGDAHTAMQSMSTQILPTVQQLLTKLNA- 275

Query: 292 MKSKETSAFLENIA 305
                T+A L+ ++
Sbjct: 276 -----TAAHLQQLS 284


>gi|83858856|ref|ZP_00952378.1| ABC transporter, periplasmic substrate-binding protein, putative
           [Oceanicaulis alexandrii HTCC2633]
 gi|83853679|gb|EAP91531.1| ABC transporter, periplasmic substrate-binding protein, putative
           [Oceanicaulis alexandrii HTCC2633]
          Length = 318

 Score = 85.1 bits (209), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 62/212 (29%), Positives = 105/212 (49%), Gaps = 10/212 (4%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K ++  VG FVV +         WLS ++  D    E  +   G+V GL   S VRF
Sbjct: 1   METKAHHAIVGFFVVFLTVSGVMLTLWLSGAS-LDKEFREYDVVFDGAVRGLRPASEVRF 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NGI VG +  L L+ + P   +A+  +  +TP+   + A +  QGL G++YI++S    +
Sbjct: 60  NGIQVGEVTELGLNPDNPGQVIARIRVNVETPVKSDSEAQLEPQGLTGLSYIQISAGSPD 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKII--ENIEKPLTT 178
              +     +R  R  I AT + I+  +   E+  +    S   + +++  EN+E  LT 
Sbjct: 120 AARLESRQGDRAPR--IYATQAQIDQLVEGGESLLESAQLSFVRVSRLLSDENLES-LTN 176

Query: 179 TIANIETISTVLANNISHIDKMMHTTQVTPHS 210
           T+ +IETI+     N++  + +M   +   HS
Sbjct: 177 TLNHIETIT----GNLAERELLMSEARAALHS 204


>gi|260430756|ref|ZP_05784728.1| mammalian cell entry related domain protein [Silicibacter
           lacuscaerulensis ITI-1157]
 gi|260418197|gb|EEX11455.1| mammalian cell entry related domain protein [Silicibacter
           lacuscaerulensis ITI-1157]
          Length = 438

 Score = 84.3 bits (207), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 100/463 (21%), Positives = 202/463 (43%), Gaps = 57/463 (12%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSR---SNQYDGPMAEVIIRIPGSVDGLSTDSS 57
           ME++  Y  +G F ++ +  +F    WL++   + QY     +V+     +V GLS    
Sbjct: 1   METRANYILIGAFTLAGILSAFGFFLWLAKFEVTRQY--AYYDVLFD---NVSGLSAAGG 55

Query: 58  VRFNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTL 117
           V +NG+PVG+++ L LD + P+    +  I  D P+   T A +++ G+ G++Y+ELS  
Sbjct: 56  VSYNGLPVGQVIALDLDDDDPSKVRVRLEIDADIPVTTDTIAQLQSLGVTGVSYVELSGG 115

Query: 118 RKEKKTIFQIATERNQRAMI----TATPSGINYFISNAENTSKKISDSSRH-IQKIIENI 172
             + + + Q +  +++R+ I       P  ++  ++  EN +  + D +R  +  I++N+
Sbjct: 116 SPDAERLPQFSVIKSKRSAIQSLFEGAPKVLDEAVTLLENLNAVVDDDNRKAVADILDNL 175

Query: 173 EKP---LTTTIANIETISTVL---ANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLI-T 225
                 L  T+ + ET+S  L   A  I    K + T  +   +  +  T     D I T
Sbjct: 176 ASASGRLDKTLTDFETLSGDLGGAAKEIGAFTKRLDT--LADTAETTLTTGTETLDSIKT 233

Query: 226 SLDKMIKAIDLQKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLL 285
           + D    A+D              +N  + ++DQV+    D+R       E+  ++  L 
Sbjct: 234 AADSAKTALD-------------GANKTLATADQVLE--QDIRPFIARGSELADRLIGLS 278

Query: 286 SDFSSKMKSKETSAFLENIADSTSNMRSSISAIREITDQRQKIISTINTIEN-----ITS 340
            + S  M +  T+   +N   +  ++ S++ A +      ++   + N + +     + +
Sbjct: 279 DEASVTMATVNTT--FQNANQTLDSVTSAMEAAKGTLTSAERAFDSANRVMDEDVATVAA 336

Query: 341 NLNDSSQKFAELMS----KINNISALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNN 396
           ++  ++ + AE +S    +I+ ISA         D   A  +  D    I+  +      
Sbjct: 337 DIRTAANQVAETVSNVTQRIDAISA---------DILSASQSASDLLGTIDGIVQQNRRQ 387

Query: 397 LQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFERNPQDIVWG 439
           + +F + GL      V + Q  V   D  ++  ER+P   + G
Sbjct: 388 VSDFLRVGLPQFVRFVEESQRLVISLDRLVDKVERDPARFLLG 430


>gi|212212805|ref|YP_002303741.1| hypothetical protein CbuG_1274 [Coxiella burnetii CbuG_Q212]
 gi|212011215|gb|ACJ18596.1| hypothetical exported protein [Coxiella burnetii CbuG_Q212]
          Length = 308

 Score = 84.0 bits (206), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 73/314 (23%), Positives = 151/314 (48%), Gaps = 39/314 (12%)

Query: 1   MESKNYYTSVGLFVV-----SILFFSFFSIYWLSRSNQ-YDGPMAEVIIRIPGSVDGLST 54
           M++K  YT VG F++     SI+ F +FS +   R  Q +D      ++ +   V G++T
Sbjct: 1   MDTKVNYTLVGFFIILLGAASIVIFLWFSTF---RHRQTFD----TYLVYMHEEVSGINT 53

Query: 55  DSSVRFNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIEL 114
            + VRFNG+ VG +  + ++   P   +    I+ +TP+  ST AT+R++G+ G  Y+ L
Sbjct: 54  QTPVRFNGVKVGYVQKIEINPADPQQVVLTLKIKHETPITTSTVATLRSEGIMGTDYVAL 113

Query: 115 STLRKEKKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKII-ENIE 173
             L      +  IA    +  +I + PS +    +  +  +K I + S ++ K+  E   
Sbjct: 114 KALTATAPPL--IAKPGEKYPVIPSEPSLLMKLSTALQEVTKTIKELSDNVGKVFDEKNR 171

Query: 174 KPLTTTIANIETISTVLANNISHIDKMMHTT-QVTPHSSDSKNTFNTITDLITSLDKMIK 232
           + ++ ++ NI+ ++  L++N  +ID  +H+  Q+  +S+ +     TI            
Sbjct: 172 RAISASLVNIQKVTKTLSDNSENIDATLHSMKQLMKNSAKASEQLPTI------------ 219

Query: 233 AIDLQKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQ-EVGQKIDHLLSDFSSK 291
              + ++   L NI++++  F ++   +  TV D     Q+   ++   +  LL+  ++ 
Sbjct: 220 ---MHQLQDTLANIKITARQFDRAGHGIELTVGDAHTAMQSMSTQILPTVQQLLTKLNA- 275

Query: 292 MKSKETSAFLENIA 305
                T+A L+ ++
Sbjct: 276 -----TAAHLQQLS 284


>gi|218507224|ref|ZP_03505102.1| putative ABC transporter, substrate-binding protein [Rhizobium etli
           Brasil 5]
          Length = 197

 Score = 83.6 bits (205), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 58/198 (29%), Positives = 110/198 (55%), Gaps = 24/198 (12%)

Query: 269 ETTQTFQEVGQ-------KIDHLLSDFS-SKMKSKETSAFLENIADSTSNMRSSISAIRE 320
           ET  TF + G+       ++D L++    +K+K       +++I+ +T + R+++++IR+
Sbjct: 6   ETATTFNDFGKQAQDTLDRVDTLVAQIDPAKLKGS-----VDDISQATKDARAAVASIRD 60

Query: 321 ITD---QRQKIIS-TINTIENITSNLNDSSQKFAELMSKINNISALKENNSLFK---DAQ 373
           + +    RQK I  TI  +  + + LN +S +   ++ K++ +  L  +N+ F     A+
Sbjct: 61  VANTVSGRQKDIDQTIQDVSQLANKLNSASTRIDGILIKVDAL--LGTDNTQFDVRASAR 118

Query: 374 RAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFERNP 433
            A    R  ++ +N  I  I +NLQ FS  GL D+Q LV  ++ TVN+ +D + NF+RNP
Sbjct: 119 DAGILSRKVADNLNSRIGPIADNLQKFSSGGLRDVQTLVNDMRGTVNNLNDTITNFDRNP 178

Query: 434 QDIVWGREKGSVKIYKPK 451
           Q +++G +  +VK Y  +
Sbjct: 179 QRLIFGGD--TVKQYDGR 194


>gi|206575547|ref|YP_002235753.1| putative ABC transporter, periplasmic substrate-binding protein
           [Klebsiella pneumoniae 342]
 gi|206570391|gb|ACI12037.1| putative ABC transporter, periplasmic substrate-binding protein
           [Klebsiella pneumoniae 342]
          Length = 312

 Score = 82.8 bits (203), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 78/308 (25%), Positives = 146/308 (47%), Gaps = 54/308 (17%)

Query: 1   MESKNYYTSVGLFVV----SILFFSFFSIYWLSRSNQ------YDGPMAEVIIRIPGSVD 50
           ME++ ++  +GLF +    ++L FS     WLS++++      YD   +E       +V 
Sbjct: 1   METRAHHVLIGLFTLIIFTAVLLFSL----WLSKADRDRQFHTYDIVFSE-------AVS 49

Query: 51  GLSTDSSVRFNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGIT 110
           GLS  S+V F+GI VG ++ L LD+E P    A+  +   TP+   T A +   G+ G +
Sbjct: 50  GLSQGSTVNFSGIRVGEVIQLRLDRENPGKVWARIRVEASTPVRQDTQARLAMAGITGTS 109

Query: 111 YIELSTLRKEKKTIFQIATERNQRAMITATPSGINYFISNAENTSKKI------------ 158
            I+LS    E   + +   +R    +I ATPS +N  ++N E+    +            
Sbjct: 110 IIQLSG-GSETSPVLEGVNDR--IPVIIATPSPLNQLLTNGEDVMTNVNEVLLRLNQILT 166

Query: 159 SDSSRHIQKIIENIEKPLTTTIAN-IETISTVLAN----------NISHIDKMMHTTQVT 207
           +++ + I K ++N+EK +T T+A+  E IST+L             ++  +++M    + 
Sbjct: 167 TENQQRIVKTLDNLEK-ITGTVADQREDISTILQQLAVVTKQSNETLAQTNRLMRNANLL 225

Query: 208 PHSSDSKNTFNTITDLITSLDKMIKAIDLQKVNQILENIQVSSNNFVKSSDQVINTVHDV 267
                 K+  N   + +  L K    +     NQI+ + Q S NN ++  +++   + ++
Sbjct: 226 -LDGKGKDLVNNAANTLALLQKTTSLL-----NQIVIDNQHSLNNGIQGFNELGPALAEL 279

Query: 268 RETTQTFQ 275
           R+T  T +
Sbjct: 280 RKTLATLR 287



 Score = 37.4 bits (85), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 34/173 (19%), Positives = 80/173 (46%), Gaps = 25/173 (14%)

Query: 300 FLENIADSTSNMRSSISAIREI--TDQRQKIISTINTIENITSNLNDSSQKFAELMSKIN 357
            L N  D  +N+   +  + +I  T+ +Q+I+ T++ +E IT  + D  +  + ++ ++ 
Sbjct: 143 LLTNGEDVMTNVNEVLLRLNQILTTENQQRIVKTLDNLEKITGTVADQREDISTILQQLA 202

Query: 358 NIS-----ALKENNSLFKDA---------------QRAMHTFRDTSEKINRYIPSIGNNL 397
            ++      L + N L ++A                  +   + T+  +N+ +    ++L
Sbjct: 203 VVTKQSNETLAQTNRLMRNANLLLDGKGKDLVNNAANTLALLQKTTSLLNQIVIDNQHSL 262

Query: 398 QNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFERNPQDIVWGREKGSVKIYKP 450
            N  Q G N++   + +L++T+      +N+ E NP  ++ G E+  +K + P
Sbjct: 263 NNGIQ-GFNELGPALAELRKTLATLRGAINSLEANPAALLRGPER--MKEFTP 312


>gi|154248036|ref|YP_001418994.1| hypothetical protein Xaut_4115 [Xanthobacter autotrophicus Py2]
 gi|154162121|gb|ABS69337.1| Mammalian cell entry related domain protein [Xanthobacter
           autotrophicus Py2]
          Length = 307

 Score = 82.8 bits (203), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 57/204 (27%), Positives = 100/204 (49%), Gaps = 13/204 (6%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++  YT +G F +++L  +F  +YW +         A  ++   GSV GL   ++V F
Sbjct: 1   METRANYTIIGAFTLAVLAAAFGFVYWFAGPQDSSARKAYEVL-FDGSVAGLRQGNNVLF 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NGIPVG++ GL L    P   LA+  I  D P+    TA + +QGL GI  +   ++   
Sbjct: 60  NGIPVGQVTGLGLVPGQPGQVLARVAINNDVPVLSDATAGLESQGLTGIVVV---SIHGG 116

Query: 121 KKTIFQIATERNQRAMITA-TPSGINYFISNAENTSKKISDSSRHIQKIIENI-EKPLTT 178
                 +    N    ITA   +G++  I++A+  ++K       I+ +++ I  + +  
Sbjct: 117 HPGAPPLPLGPNGVPRITADGGAGMSGLINSAQGVARK-------IEVVLDAINPQDIKN 169

Query: 179 TIANIETISTVLANNISHIDKMMH 202
            IANI+T S  +A+    +  ++ 
Sbjct: 170 IIANIDTFSKAVASKSEDVASLIE 193



 Score = 42.7 bits (99), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 33/163 (20%), Positives = 70/163 (42%), Gaps = 28/163 (17%)

Query: 305 ADSTSNMRSSISAIREITDQRQKIISTINT--IENITSNLNDSSQKFA------------ 350
           AD  + M   I++ + +  + + ++  IN   I+NI +N++  S+  A            
Sbjct: 135 ADGGAGMSGLINSAQGVARKIEVVLDAINPQDIKNIIANIDTFSKAVASKSEDVASLIEQ 194

Query: 351 --ELMSKINNIS------------ALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNN 396
              L+ ++N ++            A ++ + L   A  A  + R  ++ +++    +   
Sbjct: 195 SNALVKQLNGVAEKVDRVVVNLQKATEDKDGLLVQATDAATSVRKLADNLDQRTALLTEQ 254

Query: 397 LQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFERNPQDIVWG 439
           +  F+  GL   + L    + T++  D  L N ERNPQ  ++G
Sbjct: 255 VSRFTGPGLKQYEALATDGRRTLSEIDRVLRNIERNPQQFIFG 297


>gi|217969577|ref|YP_002354811.1| hypothetical protein Tmz1t_1156 [Thauera sp. MZ1T]
 gi|217506904|gb|ACK53915.1| Mammalian cell entry related domain protein [Thauera sp. MZ1T]
          Length = 313

 Score = 81.6 bits (200), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 68/332 (20%), Positives = 143/332 (43%), Gaps = 47/332 (14%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQ------YDGPMAEVIIRIPGSVDGLST 54
           ME++ ++  +GLF V ++  +     WL +S+       YD       I    +V GLS 
Sbjct: 1   METRAHHVLIGLFTVLVVGAALMFALWLGKSDADRQFEVYD-------IVFQEAVSGLSK 53

Query: 55  DSSVRFNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIEL 114
             +V FNGI +G +V L LD       +A+  +    P+   T A +   G+ G+T I L
Sbjct: 54  GGTVEFNGIKIGDVVSLRLDPADARRVIARVRVDSAAPVRSDTRARLVPAGITGLTMIRL 113

Query: 115 STLRKEKKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKII--ENI 172
           ++   E      + ++ ++ A I A PS ++  +++ E+    ++D     ++++  +N+
Sbjct: 114 TS--GEDPASTPLVSKGDEVARIIAAPSPLSRLLADGEDAITNVNDLLVQARELLSADNV 171

Query: 173 EKPLTTTIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIK 232
                 T+ N+E  +  LA     ++  +   +VT  S D+         ++ S +++++
Sbjct: 172 AS-FGRTLGNLELATGALAAQREDLNAALR--EVTQASRDASTALAEAARMLGSANRLVE 228

Query: 233 AIDLQKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKM 292
                                     Q   T+   R+  + F+     +D L++D  + +
Sbjct: 229 V-------------------------QGTQTLDSARDAMRAFERAMGTVDRLIADNRAPL 263

Query: 293 KSKETSAFLENIADSTSNMRSSISAIREITDQ 324
                   L  I  + + +R++++++R IT Q
Sbjct: 264 DGGMRG--LAEIGPAVAELRTTLASLRIITRQ 293


>gi|209885949|ref|YP_002289806.1| putative ABC transporter [Oligotropha carboxidovorans OM5]
 gi|209874145|gb|ACI93941.1| putative ABC transporter [Oligotropha carboxidovorans OM5]
          Length = 371

 Score = 81.3 bits (199), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 63/204 (30%), Positives = 94/204 (46%), Gaps = 22/204 (10%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVI--IRIPGSVDGLSTDSSV 58
           ME++  Y  VGLFV+SI    F  +YWL   N   G  A  I  ++    V GL   + V
Sbjct: 1   METRAPYIIVGLFVLSIAAAVFGFVYWL---NNAGGLGARSIYQVQFDEPVPGLLVGAGV 57

Query: 59  RFNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLR 118
            FNGI VG +  L LD + P    A   +  DTP+   T   +  QGL G+  I L    
Sbjct: 58  LFNGIRVGEVTRLALDPQSPRRVNASVSVLTDTPVRADTKVGLEFQGLTGVPVIAL---- 113

Query: 119 KEKKTIFQIATERNQRAMITATPSGINYFISNA-ENTSKKISDSSRHIQKIIENIEKPLT 177
                      E N+  + T TP G+      A ++ ++   ++ R I  ++ +  +PL 
Sbjct: 114 -----------EGNKDTLAT-TPIGVLVASPGAGQSMTQAAREALRKIDSVLSDNSQPLH 161

Query: 178 TTIANIETISTVLANNISHIDKMM 201
            TIAN+ T +  LA N   +D ++
Sbjct: 162 DTIANLSTFAEGLARNTGRLDGIL 185


>gi|182680398|ref|YP_001834544.1| hypothetical protein Bind_3498 [Beijerinckia indica subsp. indica
           ATCC 9039]
 gi|182636281|gb|ACB97055.1| Mammalian cell entry related domain protein [Beijerinckia indica
           subsp. indica ATCC 9039]
          Length = 378

 Score = 80.5 bits (197), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 60/207 (28%), Positives = 93/207 (44%), Gaps = 23/207 (11%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYW------LSRSNQYDGPMAEVIIRIPGSVDGLST 54
           ME+   Y  VGLF ++++   F    W      L++ + Y        +R  G V GL T
Sbjct: 1   METTARYLWVGLFSLAVIAAGFILYLWSHNSGGLAKHSYYQ-------VRFAGPVSGLQT 53

Query: 55  DSSVRFNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIEL 114
            S+V+FNGI VG +  L LD   P+   A   I P TP+   T   I  QGL G   I L
Sbjct: 54  GSTVQFNGIRVGEVTALALDARDPSSLTATIAIAPGTPVRSDTKIDINFQGLLGTPAIAL 113

Query: 115 STLRKEKKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEK 174
           S       T  ++     Q  ++ A            ++ ++    + +HI KI+++   
Sbjct: 114 S---GGTLTAPELHGSETQPPLLRAD-------ALTGQDLTQAARAALQHINKILDDNAD 163

Query: 175 PLTTTIANIETISTVLANNISHIDKMM 201
            L  T+ N++T + VLA N    DK++
Sbjct: 164 SLKGTLGNLKTFTDVLARNTGDFDKII 190


>gi|238754552|ref|ZP_04615906.1| hypothetical protein yruck0001_4200 [Yersinia ruckeri ATCC 29473]
 gi|238707183|gb|EEP99546.1| hypothetical protein yruck0001_4200 [Yersinia ruckeri ATCC 29473]
          Length = 312

 Score = 79.0 bits (193), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 67/294 (22%), Positives = 136/294 (46%), Gaps = 25/294 (8%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSN---QYDGPMAEVIIRIPGSVDGLSTDSS 57
           ME++ ++  +GLF + ++  +     WL+ +    Q+   + +++   P  V GLS  S+
Sbjct: 1   METRAHHVIIGLFTLIVVSAALLFCLWLTNAGSNSQFR--LYDIVFNEP--VSGLSQGST 56

Query: 58  VRFNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTL 117
           V+++GI VG +  L LD++ PN   A+  +   TP+   T A +   G+ G + I+ S+ 
Sbjct: 57  VQYSGIRVGEVTQLRLDKDNPNKVWARIRVSASTPVRQDTQARLTVAGITGTSNIQFSSG 116

Query: 118 RKEKKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDS-SRHIQKIIENIEKPL 176
            +      ++  E  +  +I ATPS ++  ++N EN    +++   R  Q +  + ++ L
Sbjct: 117 SQGSP---RLEGEDGEIPVIVATPSPMSQLLANGENFMSNVNEVLVRLNQLLAPDNQQRL 173

Query: 177 TTTIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKA--- 233
             T+ N+E ++  +A+    +  M+   Q+   S  + +T      L+ + + +++    
Sbjct: 174 VKTLENLELVTQTVADQREDLRTMLQ--QLAQASKQANDTLAQTNRLLRNTNGLVEGQGK 231

Query: 234 ---IDLQKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHL 284
               D  K    L+N  V  N  V  +   +N         Q   E+G  +D L
Sbjct: 232 QLLSDAAKTMASLQNTSVILNKLVNENKTSLNN------GMQGMNELGPAVDEL 279



 Score = 44.7 bits (104), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 28/122 (22%), Positives = 59/122 (48%), Gaps = 2/122 (1%)

Query: 321 ITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNISALKENNSLFKDAQRAMHTFR 380
           + DQR+ + + +  +   +   ND+  +   L+   N +    +   L  DA + M + +
Sbjct: 187 VADQREDLRTMLQQLAQASKQANDTLAQTNRLLRNTNGLVE-GQGKQLLSDAAKTMASLQ 245

Query: 381 DTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFERNPQDIVWGR 440
           +TS  +N+ +     +L N  Q G+N++   V +L+ T+      ++  E NP  ++ GR
Sbjct: 246 NTSVILNKLVNENKTSLNNGMQ-GMNELGPAVDELRRTLATLRAAVSRLEENPAALLRGR 304

Query: 441 EK 442
           E+
Sbjct: 305 ER 306


>gi|92117462|ref|YP_577191.1| hypothetical protein Nham_1923 [Nitrobacter hamburgensis X14]
 gi|91800356|gb|ABE62731.1| Mammalian cell entry related protein [Nitrobacter hamburgensis X14]
          Length = 369

 Score = 77.8 bits (190), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 52/204 (25%), Positives = 93/204 (45%), Gaps = 22/204 (10%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++  +  +G FV++ +   F  +YWL  +    GP A   ++  GSV GL   ++V F
Sbjct: 1   METRAPFVIIGAFVLAAIAAVFGFVYWLHNTGGL-GPRATYHVQFEGSVPGLLVGAAVLF 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NGI VG +  L L  + P+   A   +   TP+   T   +  QGL G+  + L      
Sbjct: 60  NGIRVGEVTELSLAPDNPHRVDAAIAVTSTTPVRSDTKVGLEFQGLTGVPVVAL------ 113

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNA---ENTSKKISDSSRHIQKIIENIEKPLT 177
                       +   + A    ++  I+ A   ++ ++   D+ RH+  ++     P+ 
Sbjct: 114 ------------EGGQLLAASGPVSTLIAEAGAGQSMTQAARDALRHVDAVLAENAGPIK 161

Query: 178 TTIANIETISTVLANNISHIDKMM 201
           +TIAN++  S  LA N   +D ++
Sbjct: 162 STIANLQVFSDGLARNTDKLDGIV 185


>gi|299132340|ref|ZP_07025535.1| protein of unknown function DUF330 [Afipia sp. 1NLS2]
 gi|298592477|gb|EFI52677.1| protein of unknown function DUF330 [Afipia sp. 1NLS2]
          Length = 370

 Score = 77.8 bits (190), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 59/202 (29%), Positives = 93/202 (46%), Gaps = 18/202 (8%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++  Y  VGLFV+SI    F  +YWL+ +    G  +   +R    V GL   + V F
Sbjct: 1   METRAPYIIVGLFVLSIAAAIFGFVYWLNNAGGL-GARSVYQVRFDEPVPGLLVGAGVLF 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NGI VG +  L LD + P    A   +  DTP+   T   +  QGL G+  + L      
Sbjct: 60  NGIRVGEVTRLALDPQSPRRVNASVSVLTDTPVRADTKVGLEFQGLTGVPVVAL------ 113

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNA-ENTSKKISDSSRHIQKIIENIEKPLTTT 179
                    E N+  + TA P G+      A ++ ++   ++ R I  ++ +  +PL  T
Sbjct: 114 ---------EGNKDTLSTA-PIGVLIASPGAGQSMTQAAREALRKIDSVLSDNSQPLHDT 163

Query: 180 IANIETISTVLANNISHIDKMM 201
           I N+ T +  LA N   +D ++
Sbjct: 164 IVNLSTFAEGLARNTGRLDGII 185


>gi|52842262|ref|YP_096061.1| ABC transport system periplasmic substrate binding protein
           [Legionella pneumophila subsp. pneumophila str.
           Philadelphia 1]
 gi|52629373|gb|AAU28114.1| ABC transport system periplasmic substrate binding protein
           [Legionella pneumophila subsp. pneumophila str.
           Philadelphia 1]
          Length = 307

 Score = 77.4 bits (189), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 70/237 (29%), Positives = 114/237 (48%), Gaps = 16/237 (6%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRS-NQYDGPMAEVIIRIPGSVDGLSTDSSVR 59
           MESK  YT VGL V+ +      +  WLS   NQ +       + +  SV GLS +S V+
Sbjct: 1   MESKTNYTIVGLIVLILTAGLLSAGLWLSVGFNQKE--YTSYTVYLKESVSGLSVESPVK 58

Query: 60  FNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRK 119
           FNG+ VG +  + L++  P        I   TP+  ST+AT+ TQG+ G+TY+ LS    
Sbjct: 59  FNGVQVGYVKEIKLNKNDPRQVELLLNIEKSTPITTSTSATLITQGITGVTYVGLSAGSS 118

Query: 120 EKKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKII-----ENIEK 174
           E   + ++  E     +I + PS +N   +  +  ++ +   S   Q I      +N+ K
Sbjct: 119 ELTPLRKMPGE--PYPVIPSKPSLLNQLDAVLKEVAENVGAVSEKAQLIFNEENADNVRK 176

Query: 175 PLTTTIANIETISTVLANNISHIDKMMHTTQ--VTPHSSDSKNTFNTITDLITSLDK 229
               ++AN+E I+ ++A+    ID  ++     V   ++ SK     I DL T + K
Sbjct: 177 ----SLANLERITEIIADKGQTIDSSLNNLDVFVANMANASKQFPQLIKDLKTGISK 229



 Score = 38.1 bits (87), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 37/169 (21%), Positives = 79/169 (46%), Gaps = 23/169 (13%)

Query: 280 KIDHLLSDFSSKMKSKETSAFLENIADSTSNMRSSISAIREIT----DQRQKIISTINTI 335
           ++D +L + +  + +    A L    ++  N+R S++ +  IT    D+ Q I S++N +
Sbjct: 143 QLDAVLKEVAENVGAVSEKAQLIFNEENADNVRKSLANLERITEIIADKGQTIDSSLNNL 202

Query: 336 ENITSNLNDSSQKFAELM----SKINNISALKENNSLF-KDAQRAMHTFRDTSEKINRYI 390
           +   +N+ ++S++F +L+    + I+   +L +N S   KD  + M   ++T ++I    
Sbjct: 203 DVFVANMANASKQFPQLIKDLKTGISKFKSLADNMSAAGKDVSKTMIAGKNTIDQI---- 258

Query: 391 PSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFERNPQDIVWG 439
                     SQ  +     L+R+L     + +   N   +NP  I+ G
Sbjct: 259 ----------SQQAIPPAVILLRRLNAISANLEKVSNEMRQNPSVIIRG 297


>gi|90422965|ref|YP_531335.1| hypothetical protein RPC_1454 [Rhodopseudomonas palustris BisB18]
 gi|90104979|gb|ABD87016.1| Mammalian cell entry related [Rhodopseudomonas palustris BisB18]
          Length = 289

 Score = 77.4 bits (189), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 56/263 (21%), Positives = 126/263 (47%), Gaps = 26/263 (9%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLS--RSNQYDGPMAEVIIRIPGSVDGLSTDSSV 58
           ME++  Y  +G FV++++  +   + W     + +   P+    I   GS  GL    +V
Sbjct: 1   METRANYFLIGSFVLAVIVAALGFVLWFQSLHTTKTRSPLR---IIFEGSASGLRNGGNV 57

Query: 59  RFNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLR 118
            FNG+ +G ++ + LD   P   +A A++    P+   T   +  QGL G+  I   +L+
Sbjct: 58  NFNGVRIGEVISVKLDN--PRRVVALAMVENSAPIRKDTLVGLEFQGLTGVAAI---SLK 112

Query: 119 KEKKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTT 178
             ++T   +  + +   M+TA P+ +       ++ ++ I  + +++ +I  + E+ + T
Sbjct: 113 GGQETAPPVPLDEDGTPMLTADPAAL-------QDVTEAIRATLKNVNRIFADNEEAVRT 165

Query: 179 TIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQK 238
           ++ N++T ++ LA++  HID +M         +D         +L+  LD +    D  +
Sbjct: 166 SLQNVQTFTSSLASSSEHIDSIMKKADGVITKTD---------NLMLGLDALAGGKDGGE 216

Query: 239 VNQILENIQVSSNNFVKSSDQVI 261
           + Q +++ +  ++N  K +  ++
Sbjct: 217 LLQAVKSFRELTDNLDKRAGALM 239


>gi|229587673|ref|YP_002869792.1| hypothetical protein PFLU0096 [Pseudomonas fluorescens SBW25]
 gi|229359539|emb|CAY46380.1| conserved hypothetical membrane protein [Pseudomonas fluorescens
           SBW25]
          Length = 312

 Score = 77.4 bits (189), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 70/304 (23%), Positives = 142/304 (46%), Gaps = 32/304 (10%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++ ++  +GLF V ++  +     WL++S+  D    +  +    +V GLS  SSV++
Sbjct: 1   METRAHHVMIGLFSVIVVVGAMLFGLWLAKSS-VDSAFQDYEVIFNEAVSGLSQGSSVQY 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           +GI VG ++ L LD + P   LA+  +  +TP+   T A +   G+ G + I+LS    +
Sbjct: 60  SGIKVGDVISLRLDPKDPRRVLARIRLAGETPIKEDTQAKLALTGITGTSIIQLSGGTPQ 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKII--ENIEKPLTT 178
                ++  +      I A+PS I   ++N+ +    I+    +   +   EN+E+ L+ 
Sbjct: 120 SP---ELKGKDGNLPEIIASPSPIARLLNNSNDLMTSINLLLHNANDLFSRENVER-LSN 175

Query: 179 TIANIETISTVLANNISHIDKMM-HTTQVTPHSS-------------------DSKNTFN 218
           T+ N++  + V+A+    I  +M    QV+  +S                     K  F 
Sbjct: 176 TLDNLQKTTGVIADQRGDIKVVMQQLMQVSKQASAALEQTTVLMRNANGLLNEQGKQAFG 235

Query: 219 TITDLITSLDKMIKAIDLQKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVG 278
           +    + SL+     I     N +L N + S N+ ++  +++   V ++RET  + + + 
Sbjct: 236 SAEQAMKSLEHSTATI-----NTLLTNNKDSVNSGMQGLNELAPAVRELRETLGSLRAIS 290

Query: 279 QKID 282
           ++++
Sbjct: 291 RRLE 294



 Score = 38.9 bits (89), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 28/122 (22%), Positives = 56/122 (45%), Gaps = 2/122 (1%)

Query: 321 ITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNISALKENNSLFKDAQRAMHTFR 380
           I DQR  I   +  +  ++   + + ++   LM   N +   ++    F  A++AM +  
Sbjct: 187 IADQRGDIKVVMQQLMQVSKQASAALEQTTVLMRNANGLLN-EQGKQAFGSAEQAMKSLE 245

Query: 381 DTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFERNPQDIVWGR 440
            ++  IN  + +  +++ N    GLN++   VR+L+ET+          E NP   + G 
Sbjct: 246 HSTATINTLLTNNKDSV-NSGMQGLNELAPAVRELRETLGSLRAISRRLEANPSGYLLGS 304

Query: 441 EK 442
           +K
Sbjct: 305 DK 306


>gi|238759497|ref|ZP_04620660.1| hypothetical protein yaldo0001_13610 [Yersinia aldovae ATCC 35236]
 gi|238702272|gb|EEP94826.1| hypothetical protein yaldo0001_13610 [Yersinia aldovae ATCC 35236]
          Length = 312

 Score = 77.0 bits (188), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 65/297 (21%), Positives = 137/297 (46%), Gaps = 31/297 (10%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQ------YDGPMAEVIIRIPGSVDGLST 54
           ME++ ++  +GLF + ++  +     WL+ +        YD       I    +V GLS 
Sbjct: 1   METRAHHVIIGLFTLIVVSAALLFCLWLTNAGSNRQFSLYD-------IVFNEAVSGLSQ 53

Query: 55  DSSVRFNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIEL 114
            S+V+++GI VG ++ L LD++ P+   A+  +   TP+   T A +   G+ G++ I+ 
Sbjct: 54  GSTVQYSGIRVGEVIQLRLDKDNPSKVWARVRVSASTPIRQDTQARLTVAGITGMSNIQF 113

Query: 115 STLRKEKKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIE-NIE 173
           S+  ++      +  E ++  +I ATPS ++  ++N EN     ++    + +++  + +
Sbjct: 114 SSGSQDSPL---LEGEDDEIPVIVATPSPMSQLLANGENFMSNANEVLVRLNQLLAPDNQ 170

Query: 174 KPLTTTIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKA 233
           + L  T+ N+E ++  +A+    +  M+   Q+   S  + +T      L+ + + +++ 
Sbjct: 171 QRLIKTLENLELVTQTVADQREDLRTMLQ--QLAQASKQANDTLAQTDRLLRNANGLMEG 228

Query: 234 IDLQKVNQI------LENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHL 284
              Q V+        L+N  V  N  V  +   +N         Q   E+G  +D L
Sbjct: 229 QGKQLVSDAAKTMVSLQNTSVILNKLVNENKTSLNN------GMQGMNELGPAVDEL 279



 Score = 43.5 bits (101), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 28/122 (22%), Positives = 58/122 (47%), Gaps = 2/122 (1%)

Query: 321 ITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNISALKENNSLFKDAQRAMHTFR 380
           + DQR+ + + +  +   +   ND+  +   L+   N +    +   L  DA + M + +
Sbjct: 187 VADQREDLRTMLQQLAQASKQANDTLAQTDRLLRNANGLME-GQGKQLVSDAAKTMVSLQ 245

Query: 381 DTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFERNPQDIVWGR 440
           +TS  +N+ +     +L N  Q G+N++   V +L+ T+      +   E NP  ++ GR
Sbjct: 246 NTSVILNKLVNENKTSLNNGMQ-GMNELGPAVDELRRTLATLRAAVTRLEENPAALLRGR 304

Query: 441 EK 442
           E+
Sbjct: 305 ER 306


>gi|54297973|ref|YP_124342.1| hypothetical protein lpp2028 [Legionella pneumophila str. Paris]
 gi|148359619|ref|YP_001250826.1| ABC transport system periplasmic substrate binding protein
           [Legionella pneumophila str. Corby]
 gi|296107661|ref|YP_003619362.1| ABC transport system periplasmic substrate binding protein
           [Legionella pneumophila 2300/99 Alcoy]
 gi|53751758|emb|CAH13180.1| hypothetical protein lpp2028 [Legionella pneumophila str. Paris]
 gi|148281392|gb|ABQ55480.1| ABC transport system periplasmic substrate binding protein
           [Legionella pneumophila str. Corby]
 gi|295649563|gb|ADG25410.1| ABC transport system periplasmic substrate binding protein
           [Legionella pneumophila 2300/99 Alcoy]
          Length = 307

 Score = 76.6 bits (187), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 70/237 (29%), Positives = 113/237 (47%), Gaps = 16/237 (6%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRS-NQYDGPMAEVIIRIPGSVDGLSTDSSVR 59
           MESK  YT VGL V+ +      +  WLS   NQ +       + +  SV GLS +S V+
Sbjct: 1   MESKTNYTIVGLIVLILTAGLLSAGLWLSVGFNQKE--YTSYTVYLKESVSGLSVESPVK 58

Query: 60  FNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRK 119
           FNG+ VG +  + L++  P        I   TP+  ST+AT+ +QG+ G+TY+ LS    
Sbjct: 59  FNGVQVGYVKEIKLNKNDPRQVELLLNIEKSTPITTSTSATLISQGITGVTYVGLSAGSS 118

Query: 120 EKKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKII-----ENIEK 174
           E   + ++  E     +I + PS +N   +  +  ++ +   S   Q I      +N+ K
Sbjct: 119 ELTPLRKMPGE--PYPVIPSKPSLLNQLDAVLKEVAENVGAVSEKAQLIFNEENADNVRK 176

Query: 175 PLTTTIANIETISTVLANNISHIDKMMHTTQ--VTPHSSDSKNTFNTITDLITSLDK 229
               ++ANIE I+ ++A+    ID  ++     V   +  SK     I DL T + K
Sbjct: 177 ----SLANIERITEIIADKGQTIDSSLNNLDVFVANMAKTSKQFPQLIKDLKTGISK 229



 Score = 38.5 bits (88), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 37/164 (22%), Positives = 74/164 (45%), Gaps = 13/164 (7%)

Query: 280 KIDHLLSDFSSKMKSKETSAFLENIADSTSNMRSSISAIREIT----DQRQKIISTINTI 335
           ++D +L + +  + +    A L    ++  N+R S++ I  IT    D+ Q I S++N +
Sbjct: 143 QLDAVLKEVAENVGAVSEKAQLIFNEENADNVRKSLANIERITEIIADKGQTIDSSLNNL 202

Query: 336 ENITSNLNDSSQKFAELMSKINNISALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGN 395
           +   +N+  +S++F +L      I  LK   S FK     M       + +++ + +  N
Sbjct: 203 DVFVANMAKTSKQFPQL------IKDLKTGISKFKSLADNMSA---AGKDVSKTMIAGKN 253

Query: 396 NLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFERNPQDIVWG 439
            +   SQ  +     L+R+L     + +   N   +NP  I+ G
Sbjct: 254 TIDQISQQAIPPAVILLRRLNAISANLEKVSNEMRQNPSVIIRG 297


>gi|300312194|ref|YP_003776286.1| organic solvents resistance ABC transporter periplasmic protein
           [Herbaspirillum seropedicae SmR1]
 gi|300074979|gb|ADJ64378.1| ABC-type transport system involved in resistance to organic
           solvents, periplasmic component protein [Herbaspirillum
           seropedicae SmR1]
          Length = 305

 Score = 76.6 bits (187), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 61/292 (20%), Positives = 144/292 (49%), Gaps = 15/292 (5%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++ ++  +GLF + +   +     WL+++ Q D  +    +    +V GLS  S V++
Sbjct: 1   METRAHHVLIGLFTILVALGALGFCLWLTKAGQ-DRDVDYYTVIFNEAVSGLSRGSPVQY 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           +GI VG +VGL LD   P    A+  +    P+   T A +   G+ G   I+L+    +
Sbjct: 60  SGIKVGDVVGLSLDPADPRKVRARIRVVGRAPIKEDTGAKLALAGITGTALIQLTNGSPQ 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKII--ENIEKPLTT 178
                ++ ++     +I A+PS ++  +SN E+    +++   + ++ +  +N  + L  
Sbjct: 120 SP---RLESKDGSDPVIIASPSPLSALLSNGEDLLGNVNEVLINAKQFLAPDNARR-LNA 175

Query: 179 TIANIETISTVLA----NNISHIDKMMHTTQVTPHSSDSKNTFNTI--TDLITSLDKMIK 232
           T+A++E +++ LA    N  + + ++    +    +  S N   +    D +++L + ++
Sbjct: 176 TLAHLEELTSTLAAQRNNAGAAMQELAEAARQANLAMQSANQLLSTRGNDAMSNLQQAMR 235

Query: 233 AIDL--QKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKID 282
           ++    Q+V ++++  Q + NN  +   ++   + ++R T  + + V +K++
Sbjct: 236 SLAASSQQVERLIQQNQAALNNGAQGVAEIGPAIAELRATLSSVRAVSRKLE 287


>gi|237808111|ref|YP_002892551.1| Mammalian cell entry related domain-containing protein [Tolumonas
           auensis DSM 9187]
 gi|237500372|gb|ACQ92965.1| Mammalian cell entry related domain protein [Tolumonas auensis DSM
           9187]
          Length = 312

 Score = 76.6 bits (187), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 76/328 (23%), Positives = 154/328 (46%), Gaps = 44/328 (13%)

Query: 1   MESKNYYTSVGLFVV----SILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDS 56
           ME++ ++  +GLF+V     IL F+     WL +S+   G +   ++     V GL+  S
Sbjct: 1   METRAHHVLIGLFIVIAFGGILLFTL----WLGKSSSERGFVYYDVL-FNEEVSGLTAGS 55

Query: 57  SVRFNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELST 116
           +V ++GI VG +  L LD + P    A   +  DTP+  +T A +    LA IT   L  
Sbjct: 56  AVEYSGIKVGEVESLQLDPQDPRKVWAHTRLSADTPVKKNTRARL---ALANITGSALIR 112

Query: 117 LRKEKKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKII--ENIEK 174
           L     T   +     +  +I A PS I+ F++N EN    I++ + ++ ++   ENI  
Sbjct: 113 LFDGSPTSPLLQGIDGRVPVIIADPSPISRFLANGENLMGNINNLAGNLNQLFSKENILS 172

Query: 175 PLTTTIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAI 234
            L+ T+ ++E ++ VLA   S + + +   Q+   S ++    + I+ L  + DK+I   
Sbjct: 173 -LSKTLNHVEQVTEVLATQRSDLAETIR--QINTLSKEANIAMHDISRLARNTDKLI--- 226

Query: 235 DLQKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKS 294
                                  DQ    +++  ++  T ++  ++ID L+S+  + +++
Sbjct: 227 ----------------------GDQGQRVLNNAAQSMATLEQATRRIDQLISNNQAPLQN 264

Query: 295 KETSAFLENIADSTSNMRSSISAIREIT 322
              S  L ++  +   +R++++++  ++
Sbjct: 265 GLQS--LNDLGPAMQELRAALASLNRLS 290


>gi|27381174|ref|NP_772703.1| ABC transporter substrate-binding protein [Bradyrhizobium japonicum
           USDA 110]
 gi|30179810|sp|P29285|Y6063_BRAJA RecName: Full=Uncharacterized protein bll6063
 gi|27354341|dbj|BAC51328.1| ABC transporter substrate-binding protein [Bradyrhizobium japonicum
           USDA 110]
          Length = 367

 Score = 76.3 bits (186), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 56/201 (27%), Positives = 90/201 (44%), Gaps = 16/201 (7%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++  Y  +G FV++ +   F  IYWL+ +    GP     ++  G V GL   + V F
Sbjct: 1   METRAPYVLIGTFVLAAILAVFGFIYWLNNTGGI-GPRTNYHVQFQGPVPGLLVGAGVLF 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NGI VG +  L L  + P    A   +   TP+   T   +  QGL G+  + L     E
Sbjct: 60  NGIRVGEVAQLGLAPDNPRFVNATISVASATPVRADTRVGLDFQGLTGVPVVTL-----E 114

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
              I  +A       +I    +G        ++ ++   D+ R +  ++E+   PL  TI
Sbjct: 115 GGMI--VAKSGEPLTLIAEAGAG--------QSMTQAARDALRRVDSVLEDNSGPLKDTI 164

Query: 181 ANIETISTVLANNISHIDKMM 201
           AN +T S  LA N   +D ++
Sbjct: 165 ANFKTFSDGLARNTGKLDGIL 185


>gi|254512617|ref|ZP_05124683.1| mammalian cell entry related domain protein [Rhodobacteraceae
           bacterium KLH11]
 gi|221532616|gb|EEE35611.1| mammalian cell entry related domain protein [Rhodobacteraceae
           bacterium KLH11]
          Length = 438

 Score = 76.3 bits (186), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 99/464 (21%), Positives = 203/464 (43%), Gaps = 59/464 (12%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSR---SNQYDGPMAEVIIRIPGSVDGLSTDSS 57
           ME++  Y  +G F ++ +  +F    WL++   + QY     +V+     +V GLS    
Sbjct: 1   METRANYILIGAFTLAGILGAFGFFLWLAKFEVTRQY--AYYDVLFD---NVSGLSAAGG 55

Query: 58  VRFNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTL 117
           V +NG+PVG+++ L LD++ P+    +  +  D P+   T A +++ G+ G+ Y+ELS  
Sbjct: 56  VNYNGLPVGQVISLNLDEDDPSKVRVRLEVDADIPVTKQTIAQLQSLGVTGVAYVELSGG 115

Query: 118 RKEKKTIFQ---IATERNQ-RAMITATPSGINYFISNAENTSKKISDSSRH-IQKIIENI 172
               + + Q   I ++R+  ++++   P  +   ++  EN +  + D++R  +  I+ N+
Sbjct: 116 SPTAERLAQNSVIPSKRSSIQSLLEGAPEVLEQAVTLLENLNSVVDDNNRKAVSDILNNL 175

Query: 173 EKP---LTTTIANIETISTVL---ANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITS 226
                 L  T+A+ +++S+ L   A +I    K + T           +T  T     T 
Sbjct: 176 AGASGKLDKTLADFQSLSSDLGGAAKDIGAFTKRLDTL---------ADTAETTLTTGTD 226

Query: 227 LDKMIKAIDLQKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKI-DHL- 284
             K +K     + ++  +    ++N  ++++++ +    D+R     F E G K+ DHL 
Sbjct: 227 TLKSVK-----QASEAAKTALETANGTLQTAEETLQ--QDIR----PFVERGSKLADHLI 275

Query: 285 -LSDFSSKMKSKETSAF------LENIADSTSNMRSSISAIREITDQRQKII--STINTI 335
            LS+  S      T  F      L +I  +    ++++++     D   +++     +  
Sbjct: 276 VLSEQGSLALGTITETFTNANTTLASIDSAMEAAKATLASAESAFDAANRVMDQDIASVA 335

Query: 336 ENITSNLNDSSQKFAELMSKINNISALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGN 395
           E+I    N  +   A +  KI+ IS          D   A  +  D    I+  +     
Sbjct: 336 EDIRKAANQVAATVANVTEKIDKIS---------DDILSASQSASDLLGTIDGIVQDNRR 386

Query: 396 NLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFERNPQDIVWG 439
            + +F + GL+     + + Q  V   D  ++  ER+P   + G
Sbjct: 387 QVSDFLRVGLSQFVRFIEESQRLVISLDRLVDKVERDPARFLLG 430


>gi|238784664|ref|ZP_04628669.1| hypothetical protein yberc0001_28080 [Yersinia bercovieri ATCC
           43970]
 gi|238714436|gb|EEQ06443.1| hypothetical protein yberc0001_28080 [Yersinia bercovieri ATCC
           43970]
          Length = 313

 Score = 75.9 bits (185), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 65/304 (21%), Positives = 141/304 (46%), Gaps = 30/304 (9%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSN---QYDGPMAEVIIRIPGSVDGLSTDSS 57
           ME++ ++  +GLF + ++  +     WL+ +    Q+   + +++   P  V GLS  S+
Sbjct: 1   METRAHHVVIGLFTLIVVSAALLFCLWLTNAGANRQFK--LYDIVFNEP--VSGLSQGST 56

Query: 58  VRFNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTL 117
           V+++GI VG ++ L LD E PN   A+  +   TP+   T A +   G+ G + I+ S+ 
Sbjct: 57  VQYSGIRVGEVIQLRLDSENPNKVWARIRVSASTPIRQDTQARLTVAGITGTSNIQFSSS 116

Query: 118 RKEKKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIE-NIEKPL 176
            +       +  +  +  +I ATPS ++  ++N EN     ++    + +++E + ++ L
Sbjct: 117 NQSSPL---LEGQDGEIPIIIATPSPMSQLLANGENFMSNANEVLVRLNQLLEPDNQQRL 173

Query: 177 TTTIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKA--- 233
             T+ N+  I+  +A+    I  M+   Q+   S  +  T      L+ + + ++     
Sbjct: 174 IRTLDNLALITQTVADQRGDIRTMLQ--QLAQASKQANETLAQTNRLLRNANGLMDGQGK 231

Query: 234 ----------IDLQK----VNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQ 279
                       LQK    +NQ++   + S +N ++   ++   V ++R T  T +    
Sbjct: 232 QLVSDAAKTMASLQKTSTILNQLVSENKTSLSNGMQGMSELGPAVDELRRTLATLRAAVS 291

Query: 280 KIDH 283
           +++ 
Sbjct: 292 RLEE 295



 Score = 40.0 bits (92), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 27/122 (22%), Positives = 57/122 (46%), Gaps = 2/122 (1%)

Query: 321 ITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNISALKENNSLFKDAQRAMHTFR 380
           + DQR  I + +  +   +   N++  +   L+   N +    +   L  DA + M + +
Sbjct: 187 VADQRGDIRTMLQQLAQASKQANETLAQTNRLLRNANGLMD-GQGKQLVSDAAKTMASLQ 245

Query: 381 DTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFERNPQDIVWGR 440
            TS  +N+ +     +L N  Q G++++   V +L+ T+      ++  E NP  ++ GR
Sbjct: 246 KTSTILNQLVSENKTSLSNGMQ-GMSELGPAVDELRRTLATLRAAVSRLEENPAALLRGR 304

Query: 441 EK 442
           E+
Sbjct: 305 ER 306


>gi|238764191|ref|ZP_04625144.1| hypothetical protein ykris0001_6570 [Yersinia kristensenii ATCC
           33638]
 gi|238697604|gb|EEP90368.1| hypothetical protein ykris0001_6570 [Yersinia kristensenii ATCC
           33638]
          Length = 313

 Score = 75.9 bits (185), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 67/294 (22%), Positives = 133/294 (45%), Gaps = 25/294 (8%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSN---QYDGPMAEVIIRIPGSVDGLSTDSS 57
           ME++ ++  +GLF + ++  +     WL+ +    Q+   + +++   P  V GLS  S+
Sbjct: 1   METRAHHVVIGLFTLIVVSAALLFCLWLTNAGSNRQFK--LYDIVFNEP--VSGLSQGST 56

Query: 58  VRFNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTL 117
           V+++GI VG ++ L LD E PN   A+  +   TP+   T A +   G+ G + I+ S+ 
Sbjct: 57  VQYSGIRVGEVIQLRLDSEDPNKVWARIRVSASTPIREDTQARLTVAGITGTSNIQFSSS 116

Query: 118 RKEKKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIE-NIEKPL 176
                    +  +  +  +I ATPS ++  ++N EN     ++    + +++  + ++ L
Sbjct: 117 TPSSPL---LEGKDGEIPIIIATPSPMSQLLANGENFMSNANEVLMRLNQLLAPDNQQRL 173

Query: 177 TTTIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDL 236
            TT+ N+  ++  +A+    I  M+   Q+   S  +  T      L+ S + ++     
Sbjct: 174 ITTLDNLALVTQTVADQRQDIRTMLQ--QLAQASKQANETLAQTNRLLRSANGLMDGQGK 231

Query: 237 QKVNQI------LENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHL 284
           Q VN        L+N  +  N  V  +   +N         Q   E+G  +D L
Sbjct: 232 QLVNDAAKTMASLQNTSIILNKLVSENQTSLNN------GMQGMNELGPAVDEL 279



 Score = 44.3 bits (103), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 29/122 (23%), Positives = 59/122 (48%), Gaps = 2/122 (1%)

Query: 321 ITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNISALKENNSLFKDAQRAMHTFR 380
           + DQRQ I + +  +   +   N++  +   L+   N +    +   L  DA + M + +
Sbjct: 187 VADQRQDIRTMLQQLAQASKQANETLAQTNRLLRSANGLMD-GQGKQLVNDAAKTMASLQ 245

Query: 381 DTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFERNPQDIVWGR 440
           +TS  +N+ +     +L N  Q G+N++   V +L+ T+      ++  E NP  ++ GR
Sbjct: 246 NTSIILNKLVSENQTSLNNGMQ-GMNELGPAVDELRRTLATLRAAVSRLEENPAALLRGR 304

Query: 441 EK 442
           E+
Sbjct: 305 ER 306


>gi|119897563|ref|YP_932776.1| hypothetical protein azo1272 [Azoarcus sp. BH72]
 gi|119669976|emb|CAL93889.1| conserved hypothetical secreted protein [Azoarcus sp. BH72]
          Length = 313

 Score = 75.9 bits (185), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 72/335 (21%), Positives = 142/335 (42%), Gaps = 53/335 (15%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRS------NQYDGPMAEVIIRIPGSVDGLST 54
           ME++ ++  +GLF V ++  +     WL +       N YD    E       +V+GLS 
Sbjct: 1   METRAHHVLIGLFTVLVVGAALSFALWLGKVDSDTQFNLYDVVFEE-------AVNGLSK 53

Query: 55  DSSVRFNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIEL 114
            S+V FNGI +G +  L LD + P   LA+  +    P+   T A +  QG+ GI  I L
Sbjct: 54  GSTVEFNGIKIGEVSNLRLDPKDPRRVLARIRVDSAAPIRSDTRARLAPQGITGIYTIRL 113

Query: 115 STLRKEKKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKII--ENI 172
           S+         +    + +  +I A PS ++  ++N E+    +++     + +   EN 
Sbjct: 114 SSGNDPGSVALE--PRQGEVPVIIADPSPLSRLLANGEDVMVNVNELLMQARVLFSAENA 171

Query: 173 EKPLTTTIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIK 232
              L  T+ ++E  +  LA     + + +   ++   S  +       T ++++ +++I 
Sbjct: 172 AS-LGRTLGHLEQTTGALAAQREDMGRALR--ELARASEQANAALAEATKMMSATNRLID 228

Query: 233 AIDLQKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKM 292
                                     Q   T+   + +   F++  Q +D L++D   ++
Sbjct: 229 T-------------------------QGKETLQSAQRSMAAFEQAMQTVDKLVADNRGQL 263

Query: 293 KSKETSAFLENIAD---STSNMRSSISAIREITDQ 324
            S      +  IAD   + S +R +++++R IT Q
Sbjct: 264 DSG-----MRGIADLGPALSELRRTLASLRTITRQ 293


>gi|307610776|emb|CBX00388.1| hypothetical protein LPW_21091 [Legionella pneumophila 130b]
          Length = 307

 Score = 75.9 bits (185), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 70/237 (29%), Positives = 113/237 (47%), Gaps = 16/237 (6%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRS-NQYDGPMAEVIIRIPGSVDGLSTDSSVR 59
           MESK  YT VGL V+ +      +  WLS   NQ +       + +  SV GLS +S V+
Sbjct: 1   MESKTNYTIVGLAVLILTAGLLSAGLWLSVGFNQKE--YTSYTVYLKESVSGLSIESPVK 58

Query: 60  FNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRK 119
           FNG+ VG +  + L++  P        I   TP+  ST+AT+ +QG+ G+TY+ LS    
Sbjct: 59  FNGVQVGYVKEIKLNKNDPRQVELLLNIEKSTPITTSTSATLISQGITGVTYVGLSAGSS 118

Query: 120 EKKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKII-----ENIEK 174
           E   + ++  E     +I + PS +N   +  +  ++ +   S   Q I      +N+ K
Sbjct: 119 ELTPLRKMPGE--PYPVIPSKPSLLNQLDAVLKEVAENVGAVSEKAQLIFNEENADNVRK 176

Query: 175 PLTTTIANIETISTVLANNISHIDKMMHTTQ--VTPHSSDSKNTFNTITDLITSLDK 229
               ++ANIE I+ ++A+    ID  ++     V   +  SK     I DL T + K
Sbjct: 177 ----SLANIERITEIIADKGQTIDSSLNNLDVFVANMAKASKQFPQLIKDLKTGISK 229



 Score = 38.5 bits (88), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 37/164 (22%), Positives = 74/164 (45%), Gaps = 13/164 (7%)

Query: 280 KIDHLLSDFSSKMKSKETSAFLENIADSTSNMRSSISAIREIT----DQRQKIISTINTI 335
           ++D +L + +  + +    A L    ++  N+R S++ I  IT    D+ Q I S++N +
Sbjct: 143 QLDAVLKEVAENVGAVSEKAQLIFNEENADNVRKSLANIERITEIIADKGQTIDSSLNNL 202

Query: 336 ENITSNLNDSSQKFAELMSKINNISALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGN 395
           +   +N+  +S++F +L      I  LK   S FK     M       + +++ + +  N
Sbjct: 203 DVFVANMAKASKQFPQL------IKDLKTGISKFKSLADNMSA---AGKDVSKTMIAGKN 253

Query: 396 NLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFERNPQDIVWG 439
            +   SQ  +     L+R+L     + +   N   +NP  I+ G
Sbjct: 254 TIDQISQQAIPPAVILLRRLNAISANLEKVSNEMRQNPSVIIRG 297


>gi|54294944|ref|YP_127359.1| hypothetical protein lpl2023 [Legionella pneumophila str. Lens]
 gi|53754776|emb|CAH16263.1| hypothetical protein lpl2023 [Legionella pneumophila str. Lens]
          Length = 307

 Score = 75.9 bits (185), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 70/237 (29%), Positives = 113/237 (47%), Gaps = 16/237 (6%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRS-NQYDGPMAEVIIRIPGSVDGLSTDSSVR 59
           MESK  YT VGL V+ +      +  WLS   NQ +       + +  SV GLS +S V+
Sbjct: 1   MESKTNYTIVGLAVLILTAGLLSAGLWLSVGFNQKE--YTSYTVYLKESVSGLSIESPVK 58

Query: 60  FNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRK 119
           FNG+ VG +  + L++  P        I   TP+  ST+AT+ +QG+ G+TY+ LS    
Sbjct: 59  FNGVQVGYVKEIKLNKNDPRQVELLLNIEKSTPITTSTSATLISQGITGVTYVGLSAGSS 118

Query: 120 EKKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKII-----ENIEK 174
           E   + ++  E     +I + PS +N   +  +  ++ +   S   Q I      +N+ K
Sbjct: 119 ELTPLRKMPGE--PYPVIPSKPSLLNQLDAVLKEVAENVGAVSEKAQLIFNEENADNVRK 176

Query: 175 PLTTTIANIETISTVLANNISHIDKMMHTTQ--VTPHSSDSKNTFNTITDLITSLDK 229
               ++ANIE I+ ++A+    ID  ++     V   +  SK     I DL T + K
Sbjct: 177 ----SLANIERITEIIADKGQTIDSSLNNLDVFVANMAKASKQFPQLIKDLKTGISK 229



 Score = 38.1 bits (87), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 38/169 (22%), Positives = 78/169 (46%), Gaps = 23/169 (13%)

Query: 280 KIDHLLSDFSSKMKSKETSAFLENIADSTSNMRSSISAIREIT----DQRQKIISTINTI 335
           ++D +L + +  + +    A L    ++  N+R S++ I  IT    D+ Q I S++N +
Sbjct: 143 QLDAVLKEVAENVGAVSEKAQLIFNEENADNVRKSLANIERITEIIADKGQTIDSSLNNL 202

Query: 336 ENITSNLNDSSQKFAELM----SKINNISALKENNSLF-KDAQRAMHTFRDTSEKINRYI 390
           +   +N+  +S++F +L+    + I+   +L +N S   KD  + M   ++T ++I    
Sbjct: 203 DVFVANMAKASKQFPQLIKDLKTGISKFKSLADNMSAAGKDVSKTMIAGKNTIDQI---- 258

Query: 391 PSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFERNPQDIVWG 439
                     SQ  +     L+R+L     + +   N   +NP  I+ G
Sbjct: 259 ----------SQQAIPPAVILLRRLNAISANLEKISNEMRQNPSVIIRG 297


>gi|292490601|ref|YP_003526040.1| hypothetical protein Nhal_0467 [Nitrosococcus halophilus Nc4]
 gi|291579196|gb|ADE13653.1| Mammalian cell entry related domain protein [Nitrosococcus
           halophilus Nc4]
          Length = 334

 Score = 75.5 bits (184), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 78/312 (25%), Positives = 143/312 (45%), Gaps = 36/312 (11%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRS------NQYDGPMAEVIIRIPGSVDGLST 54
           M++K  Y  VGLF + +       I+WLS +        Y   M E       SV GL+ 
Sbjct: 1   MDTKVNYILVGLFTILLATALTAIIFWLSAAPATKNYQTYLAYMRE-------SVAGLNM 53

Query: 55  DSSVRFNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIEL 114
           +++V++ G+ VG++  + LD++ P        I   TP+   T A + + GL GI Y+EL
Sbjct: 54  NAAVKYRGVDVGQVEAIELDKQNPERVRLTLAIEQGTPIKEDTIAILASNGLTGIAYVEL 113

Query: 115 STLRKEKKTIFQIATERNQ-RAMITATPS-------GINYFISNAENTSKKISDSSRHIQ 166
           +   ++  T   +  E+ Q   +I   PS        +   ++     +  +S  ++ + 
Sbjct: 114 TGGTQDSPT---LQAEKGQSHPVIQTGPSLLMRLDTALTKLLTELTGVAGDLSRIAQSVN 170

Query: 167 KI-IENIEKPLTTTIANIETISTVLAN------NISHIDKMMHTTQ-VTPHSSDSKNTFN 218
            + IE  ++ L  T+ N E +S VLA+      N   + K +H T+ +T   +   +   
Sbjct: 171 TVLIEQNQQALAETLRNTERLSKVLADLAANQENQQALRKTLHNTEHLTARLAGHGSQLE 230

Query: 219 T-ITDLITSLDKMIKAIDLQKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTF-QE 276
           T + DL+T L+   KA   +++  ++E    S     K+++ +   + D  +  + F Q 
Sbjct: 231 TAVEDLVTILEAGAKAS--KQLPILVEQASRSLRPIEKTAEGLETLLRDGEQGFRLFTQS 288

Query: 277 VGQKIDHLLSDF 288
              +ID LL+DF
Sbjct: 289 TLPRIDQLLNDF 300


>gi|261855958|ref|YP_003263241.1| hypothetical protein Hneap_1360 [Halothiobacillus neapolitanus c2]
 gi|261836427|gb|ACX96194.1| Mammalian cell entry related domain protein [Halothiobacillus
           neapolitanus c2]
          Length = 334

 Score = 75.5 bits (184), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 79/299 (26%), Positives = 134/299 (44%), Gaps = 24/299 (8%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M+SK  YT+VGLFV+ ++F    ++YWL    +        +I    SV GL+ +S V +
Sbjct: 1   MDSKINYTAVGLFVLLLIFGLAGTVYWLVTGGKQQA-FTPYVIYATDSVAGLTVNSHVLY 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G+ VG++  + +D+  P        I  + P++  T A +R QG+ G++ + L+  +  
Sbjct: 60  RGVDVGQVKSIRIDRNNPGRIRILVDIDENVPIFSDTVAQLRPQGVTGLSVLNLTGGKSS 119

Query: 121 KKTIFQIATERNQRA--MITATPSGINYFISNAENTSKKISDSSRHIQKII--ENIEKPL 176
                   T+RN++   +I   PS  +        T  K S  S  +  ++  +NI   L
Sbjct: 120 VS-----LTQRNKQGELVIPYQPSIFSRLEGGLSETMVKFSRISNRLDMLLSEKNIAT-L 173

Query: 177 TTTIANIETISTVLANNISHIDKMM----HTTQVTPHSSDSKNTFNTITDLITSLDKMIK 232
             T+ NI T+STVLA +   I   +     T Q T  +S S N+      LI    ++I 
Sbjct: 174 DNTLQNINTLSTVLAEHKDDISAAIIAGRTTLQNTAEASQSANS------LIKQSQRLIA 227

Query: 233 AID--LQKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTF-QEVGQKIDHLLSDF 288
             D  +Q +   L     ++N    +S+  +       ET   F Q+    +D LL+  
Sbjct: 228 RFDKSIQGLKSTLTAANEAANKVSAASESTLTMSKTGNETLTNFNQQTLPVLDGLLTQL 286


>gi|312115047|ref|YP_004012643.1| hypothetical protein Rvan_2320 [Rhodomicrobium vannielii ATCC
           17100]
 gi|311220176|gb|ADP71544.1| Mammalian cell entry related domain protein [Rhodomicrobium
           vannielii ATCC 17100]
          Length = 311

 Score = 75.1 bits (183), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 56/192 (29%), Positives = 93/192 (48%), Gaps = 5/192 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSR-SNQYDGPMAEVIIRIPGSVDGLSTDSSVR 59
           ME++  Y  VG+FV+ ++      IYW+   S+  DG    VI+   GSV G++  S V 
Sbjct: 1   METRANYLIVGIFVLGLIAALLGFIYWMKHDSDGGDGKAYHVILD--GSVQGITVASPVM 58

Query: 60  FNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRK 119
           FNGI  G +  + L  E          +R DTP+  ++ A I  QGLAG   +E++    
Sbjct: 59  FNGIRFGAVRKIELLPEDTRKVRILISVRQDTPVRTNSHARISQQGLAGWVAMEITPGTP 118

Query: 120 EKKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTT 179
           +   +     E+   A+I+A P       +   + + + S  +  +  +I N E  L  T
Sbjct: 119 DMPMLEPKPGEKI--AVISADPGASGSLFAGVSDAAGQASALAVRLNNLIANNEDSLHRT 176

Query: 180 IANIETISTVLA 191
           +AN+ET + ++A
Sbjct: 177 VANLETFTGMMA 188


>gi|159044592|ref|YP_001533386.1| hypothetical protein Dshi_2048 [Dinoroseobacter shibae DFL 12]
 gi|157912352|gb|ABV93785.1| hypothetical protein Dshi_2048 [Dinoroseobacter shibae DFL 12]
          Length = 579

 Score = 75.1 bits (183), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 102/477 (21%), Positives = 199/477 (41%), Gaps = 81/477 (16%)

Query: 1   MESKNYYTSVGLF-VVSIL----FFSFFSIYWLSRS-NQYDGPMAEVIIRIPGSVDGLST 54
           ME++  Y  +GLF ++ IL    FF  F+   L R    YD       IR   SV GLS 
Sbjct: 1   METRANYILIGLFTLLGILGMMAFFLLFARVELDRQFAYYD-------IRFS-SVSGLSE 52

Query: 55  DSSVRFNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIEL 114
            S VRF+G+PVG++V + L  E     + +  +  DTP+   + ATI  QG+ G++++ +
Sbjct: 53  ASDVRFSGLPVGQVVDVRLAPEQDGSIVVRVEVNADTPVRTDSVATIEAQGVTGVSFVGI 112

Query: 115 STLRKEKKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKI----IE 170
           S    +   +   AT+    A +    +G +   + +E+  + I+++ + +Q++     +
Sbjct: 113 SGGTPDAP-LLVAATD----AQVPEIEAGRSVLQTLSEDAPELITEALQIVQEVSALLTD 167

Query: 171 NIEKPLTTTIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITS-LDK 229
           +    L   + N E  S   A+ + +   +  T       +D  + FN   D +T  ++ 
Sbjct: 168 DNRNLLRNILVNTEAASEEFASALENFSGVADTVN---AFADQISRFNATLDTLTGEIND 224

Query: 230 MIKAID--LQKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQE-----VGQKID 282
           ++   D  L  +  + E     +   V   ++V++T+ D     QT+ E       ++  
Sbjct: 225 VLSTADTTLASIGALSEE----TRRMVLDGEEVLSTLDDSLGAAQTYIEGDLAGATEEAR 280

Query: 283 HLLSDFSSKMKS--KETSAFLENIADSTSNMRSSISAIREITDQRQKIISTINTIENITS 340
            L++D  ++  +   E +A +E    +T ++          T +  +   T+  ++ + +
Sbjct: 281 ALMADLRAQADTLGTEAAALIEGFG-ATGDV---------ATARLTEFAGTLAAVDRLVA 330

Query: 341 NLNDSSQKFAELMSKINNISA------LKENNSLFKDAQRAMHT---------------F 379
           +L  +S +    + +I+ + A      L E  +L   AQ AM                  
Sbjct: 331 SLEATSGEVQVAVRRIDGLVAEEGAPLLSETRALVATAQAAMEAVNAVATVDMPAIVADI 390

Query: 380 RDTSEKINRYIPSIGNNLQNFS----------QSGLNDIQNLVRKLQETVNHFDDCL 426
           R  ++   R +  +G NL   S           S L D+    R   ET+   +  +
Sbjct: 391 RAATDTTTRVVAEVGENLSGASGRVEALIVSAHSTLADVTTTFRNANETLTAVNTAM 447


>gi|238751981|ref|ZP_04613466.1| hypothetical protein yrohd0001_23860 [Yersinia rohdei ATCC 43380]
 gi|238709815|gb|EEQ02048.1| hypothetical protein yrohd0001_23860 [Yersinia rohdei ATCC 43380]
          Length = 313

 Score = 75.1 bits (183), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 66/294 (22%), Positives = 134/294 (45%), Gaps = 25/294 (8%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSN---QYDGPMAEVIIRIPGSVDGLSTDSS 57
           ME++ ++  +GLF + ++  +     WL+ +    Q+   + +++   P  V GLS  S+
Sbjct: 1   METRAHHVVIGLFTLIVVSAALLFCLWLTGAGTDRQFR--LYDIVFNEP--VSGLSQGST 56

Query: 58  VRFNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTL 117
           V+++GI VG +  L LD + P    A+  +   TP+   T A +   G+ G + I+ S+ 
Sbjct: 57  VQYSGIRVGEVTQLRLDTDNPTQVWARVRVSASTPIREDTQARLTVAGITGTSNIQFSSS 116

Query: 118 RKEKKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIE-NIEKPL 176
            +       + ++  +  +I ATPS ++  ++N EN     ++    + +++E + ++ L
Sbjct: 117 SQASPL---LESKDGEIPVIIATPSPMSQLLANGENFMSNANEVLVRLNQLLEPDNQQRL 173

Query: 177 TTTIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDL 236
            TT+ N+  I+  +A+    I  ++   Q+   S  +  T      L+ + + ++     
Sbjct: 174 ITTLNNLALITQTVADQRQDIRTLLQ--QLAQASKQANETLTQTNRLLRNANGLMDGQGK 231

Query: 237 QKVNQI------LENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHL 284
           Q VN        L+N  V  N  V  +   +N         Q   E+G  +D L
Sbjct: 232 QLVNDAAKTMASLQNTSVILNKLVNENKTSLN------NGMQGMNELGPAVDEL 279



 Score = 45.8 bits (107), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 34/140 (24%), Positives = 65/140 (46%), Gaps = 21/140 (15%)

Query: 323 DQRQKIISTINTIENITSNLNDSSQKFAELMSKINNIS-----ALKENNSLFK------- 370
           D +Q++I+T+N +  IT  + D  Q    L+ ++   S      L + N L +       
Sbjct: 168 DNQQRLITTLNNLALITQTVADQRQDIRTLLQQLAQASKQANETLTQTNRLLRNANGLMD 227

Query: 371 --------DAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNHF 422
                   DA + M + ++TS  +N+ +     +L N  Q G+N++   V +L+ T+   
Sbjct: 228 GQGKQLVNDAAKTMASLQNTSVILNKLVNENKTSLNNGMQ-GMNELGPAVDELRRTLATL 286

Query: 423 DDCLNNFERNPQDIVWGREK 442
              ++  E NP  ++ GRE+
Sbjct: 287 RAAVSRLEENPSALLRGRER 306


>gi|330501344|ref|YP_004378213.1| hypothetical protein MDS_0430 [Pseudomonas mendocina NK-01]
 gi|328915630|gb|AEB56461.1| hypothetical protein MDS_0430 [Pseudomonas mendocina NK-01]
          Length = 305

 Score = 74.3 bits (181), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 64/295 (21%), Positives = 145/295 (49%), Gaps = 19/295 (6%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME K ++  +GLF V  +  +     WL+++   D    +  +    +V GLS  S+V++
Sbjct: 1   MEPKAHHVLIGLFTVLTVGAALLFGLWLNKAG-ADRAFTDYEVIFNEAVTGLSQGSAVQY 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           +GI VG +V L LD + P    A+  I  +TP+   T A +   G+ G+  I+L     E
Sbjct: 60  SGIKVGDVVSLGLDPDDPRTVRARIRIVGNTPIKQDTRARLAITGITGLAVIQLHGGSPE 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAE----NTSKKISDSSRHIQKIIENIEKPL 176
                 +  +  Q  +I A  S ++  ++N E    N ++ ++ ++R + +  EN E+ +
Sbjct: 120 SPP---LEGKDGQPGIIIADRSPLSRLMANGEDLVSNITRLLNRANRMLSR--ENAER-V 173

Query: 177 TTTIANIETISTVLANNISHIDKMM-HTTQVTPHSSDSKNTFNTITD-----LITSLDKM 230
           + T+ N+E  +  +A+    + + +  T+  T  ++      N + D     ++ S +++
Sbjct: 174 SRTLENLEQATAGIADQREELGEALRQTSAATREAAALMKNANQLLDSQGSQVLESAERL 233

Query: 231 IKAIDL--QKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDH 283
           + +++   Q + Q+L+N + + ++ ++    +  T+ ++RET    +   ++++ 
Sbjct: 234 MASLERSSQTIEQLLQNNRGALDSGMQGLSDLGPTISELRETLGALRGFSRRLEQ 288


>gi|115523492|ref|YP_780403.1| hypothetical protein RPE_1473 [Rhodopseudomonas palustris BisA53]
 gi|115517439|gb|ABJ05423.1| Mammalian cell entry related domain protein [Rhodopseudomonas
           palustris BisA53]
          Length = 293

 Score = 73.9 bits (180), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 65/290 (22%), Positives = 126/290 (43%), Gaps = 35/290 (12%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLS--RSNQYDGPMAEVIIRIPGSVDGLSTDSSV 58
           ME++  Y  +GLF V+++  +   + W     + +   P+    I   GS  GL    +V
Sbjct: 1   METRANYFLIGLFTVAVVASALGFVLWFQALHTTKLRSPLR---IVFEGSASGLRNGGNV 57

Query: 59  RFNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLR 118
            FNG+ +G ++ + LD   P   +A A++    P+   T   +  QGL G+  I   +L+
Sbjct: 58  NFNGVRIGEVITVKLDN--PRRVVALAMVENSAPIRKDTLVGLEFQGLTGVAAI---SLK 112

Query: 119 KEKKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTT 178
             ++T   +  + +   M+TA PS +       ++  + +  +  ++ +++ + E  L  
Sbjct: 113 GGQETAPPVPLDDDGVPMLTADPSLL-------QDIGEAVRATLTNVNRMVADNEDALKN 165

Query: 179 TIANIETISTVLANNISHIDKMMHTT--------------QVTPHSSDSKNTFNTIT--- 221
           ++ N+ T +  LAN+  HID +M  T                     D    F  +    
Sbjct: 166 SLQNVMTFTQSLANSSEHIDSIMRKTDKLISKTDNIMLGLDALAGGKDGGELFQAVKSFR 225

Query: 222 DLITSLDKMIKAIDLQKVNQILENIQVSSNNFVKSSDQVINTVHDVRETT 271
           +L  +LDK   A+ L    + L +I  + NN  K+  +++       +TT
Sbjct: 226 ELADNLDKRASALMLDG-RRTLSDISRAVNNLDKNPTRILFGPSGAADTT 274


>gi|330806717|ref|YP_004351179.1| hypothetical protein PSEBR_a55 [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
 gi|327374825|gb|AEA66175.1| Conserved hypothetical protein [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
          Length = 312

 Score = 73.9 bits (180), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 71/304 (23%), Positives = 135/304 (44%), Gaps = 32/304 (10%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++ ++  +GLF V ++  +     WL++SN  D       +    +V GLS  SSV +
Sbjct: 1   METRAHHVLIGLFTVIVVAGALLFGLWLAKSN-VDSEFKYYEVVFNEAVSGLSRGSSVEY 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           +GI VG +V L LD   P   LA+  +  +TP+   T A +   G+ G + I+LS    +
Sbjct: 60  SGIKVGDVVNLRLDPNDPRRVLARVRLSGETPVKQDTQAKLALTGITGTSIIQLSGGTPQ 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKI------------SDSSRHIQKI 168
                 +     +  +I A PS I   ++N+++    I            SD+ + + K 
Sbjct: 120 SPV---LTGHDGEPPVIIAAPSPIARLLNNSDDLMTSINLLLHNANEVFSSDNVQSLGKT 176

Query: 169 IENIEKPLTTTIANIETISTVLANNISHIDK-----MMHTTQVTPHSSD-----SKNTFN 218
           +E++E+  T  IA            ++ I K     +  TT +  +++       K  F 
Sbjct: 177 LEHLEQT-TGVIAEQRGDIRQAMQQLASIGKQASATLEQTTALMRNANGLLNDQGKQAFG 235

Query: 219 TITDLITSLDKMIKAIDLQKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVG 278
                + SL +    +D     ++L + + S NN ++  + +   V ++RET    + + 
Sbjct: 236 NAGQAMQSLARSTATLD-----KLLNDNRDSLNNGMQGLNALAPAVRELRETLSALRGIS 290

Query: 279 QKID 282
           +++D
Sbjct: 291 RRLD 294



 Score = 36.2 bits (82), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 27/122 (22%), Positives = 56/122 (45%), Gaps = 2/122 (1%)

Query: 321 ITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNISALKENNSLFKDAQRAMHTFR 380
           I +QR  I   +  + +I    + + ++   LM   N +    +    F +A +AM +  
Sbjct: 187 IAEQRGDIRQAMQQLASIGKQASATLEQTTALMRNANGLLN-DQGKQAFGNAGQAMQSLA 245

Query: 381 DTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFERNPQDIVWGR 440
            ++  +++ +    ++L N  Q GLN +   VR+L+ET++         + NP   + G 
Sbjct: 246 RSTATLDKLLNDNRDSLNNGMQ-GLNALAPAVRELRETLSALRGISRRLDANPSGYLLGN 304

Query: 441 EK 442
           +K
Sbjct: 305 DK 306


>gi|70733610|ref|YP_257250.1| MCE-like family protein [Pseudomonas fluorescens Pf-5]
 gi|68347909|gb|AAY95515.1| mce related protein family [Pseudomonas fluorescens Pf-5]
          Length = 312

 Score = 73.6 bits (179), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 66/301 (21%), Positives = 143/301 (47%), Gaps = 26/301 (8%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++ ++  +GLF V ++  +     WL++S+  D    +  I    +V GLS  SSV++
Sbjct: 1   METRAHHVLIGLFTVIVVAGALLFGLWLAKSS-VDSAFQDYQIVFNEAVSGLSKGSSVQY 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           +GI VG +V L LD + P   LA+  +  +TP+   T A +   G+ G + I+LS    +
Sbjct: 60  SGIKVGDVVNLRLDPKDPRRVLAQIRLGSETPIKEDTQAKLALTGITGTSIIQLSGGTPQ 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKII--ENIEKPLTT 178
             T   +  +  +   I A+PS I   ++N+ +    ++    +  ++   +N+ + +++
Sbjct: 120 SPT---LKGKDGELPTIIASPSPIARLLNNSNDLMTGVNLLLHNANRMFSPDNVAR-VSS 175

Query: 179 TIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQ- 237
           T+ N++  S  +A     + ++M   Q+   S  +       T L+ + + ++     Q 
Sbjct: 176 TLDNLQKTSASIAEQRDDLRQLMQ--QLGSISKQTGAMLEQTTALMRNANGLLNDQGKQM 233

Query: 238 ----------------KVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKI 281
                            +N++L + Q S NN ++  + +   V ++RET  + + + +++
Sbjct: 234 FGSAEHAMRSLEQSSATLNKLLSDNQDSLNNGMQGLNGLAPAVRELRETLSSLRAITRRL 293

Query: 282 D 282
           +
Sbjct: 294 E 294



 Score = 44.7 bits (104), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 33/140 (23%), Positives = 63/140 (45%), Gaps = 21/140 (15%)

Query: 323 DQRQKIISTINTIENITSNLNDSSQKFAELMSKINNIS-----------ALKEN------ 365
           D   ++ ST++ ++  ++++ +      +LM ++ +IS           AL  N      
Sbjct: 168 DNVARVSSTLDNLQKTSASIAEQRDDLRQLMQQLGSISKQTGAMLEQTTALMRNANGLLN 227

Query: 366 ---NSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNHF 422
                +F  A+ AM +   +S  +N+ +    ++L N  Q GLN +   VR+L+ET++  
Sbjct: 228 DQGKQMFGSAEHAMRSLEQSSATLNKLLSDNQDSLNNGMQ-GLNGLAPAVRELRETLSSL 286

Query: 423 DDCLNNFERNPQDIVWGREK 442
                  E NP   + G EK
Sbjct: 287 RAITRRLEANPGGYLLGNEK 306


>gi|146342152|ref|YP_001207200.1| ABC transporter substrate-binding protein [Bradyrhizobium sp.
           ORS278]
 gi|146194958|emb|CAL78983.1| Putative ABC transporter (substrate binding protein)
           [Bradyrhizobium sp. ORS278]
          Length = 366

 Score = 73.6 bits (179), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 53/201 (26%), Positives = 91/201 (45%), Gaps = 17/201 (8%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++  +  +G FV++ +   F  +YWL+ +    GP     ++  GSV GL   ++V F
Sbjct: 1   METRAPFAVIGGFVLAAIVAIFGFVYWLNNTGGL-GPRTTYHVQFEGSVPGLLVGAAVLF 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NGI VG +  L L  + P    A   +   TP+   T   +  QGL G+  + L     E
Sbjct: 60  NGIRVGEVTELGLAPDNPRRVNATISVASSTPVRTDTKVGLEFQGLTGVPVVAL-----E 114

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
             ++    T     + + A P          ++ ++   D+ R +  ++     PL  TI
Sbjct: 115 AGSL----TAAAPGSTLMAEPGA-------GQSMTQAARDALRRVDAVLAENAGPLKDTI 163

Query: 181 ANIETISTVLANNISHIDKMM 201
           AN++T S  LA N   +D ++
Sbjct: 164 ANLKTFSDGLARNTGKLDGIV 184


>gi|254419715|ref|ZP_05033439.1| mce related protein [Brevundimonas sp. BAL3]
 gi|196185892|gb|EDX80868.1| mce related protein [Brevundimonas sp. BAL3]
          Length = 312

 Score = 73.2 bits (178), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 73/316 (23%), Positives = 149/316 (47%), Gaps = 29/316 (9%)

Query: 1   MESKNYYTSVGLFVVSILF-FSFFSIYWLSR---SNQYDGPMAEVIIRIPGSVDGLSTDS 56
           ME   +Y +VG+  V ++   + F+I WL+R   ++ YD  + +++    G V+GLS   
Sbjct: 1   MERDAHYAAVGIATVCLMAALAVFTI-WLARLQFNSDYD--LYDIVFY--GPVNGLSEGG 55

Query: 57  SVRFNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELST 116
            V FNGI VG +  L +D +  +  +A+  +   TP+  ++ A +  QG+ G+ YI++ T
Sbjct: 56  EVHFNGIRVGEVTDLNIDTKRGDQVIARVRVDGTTPVRVTSRAQLEPQGITGLNYIQI-T 114

Query: 117 LRKEKKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKII--ENIEK 174
                  + +     N   ++ + PS I   +S +     +  D+   I +++  +NI +
Sbjct: 115 AGSPNSALLKDQYPDNVVPVLQSQPSPIAELLSGSGTVLAQTVDALNRINRVMSDDNI-R 173

Query: 175 PLTTTIANIETISTVLANN---ISHIDKMMHTTQVT-----PHSSDSKNTFNT-----IT 221
             +T++ N+E ++T L       + ++  +     T       ++D +   NT     I 
Sbjct: 174 SFSTSVKNVEALTTELEARKAIFAELEAAVKNANATILEYQGLAADMRAVVNTDGREAIA 233

Query: 222 DLITSLDKMIKAIDLQKVNQILENIQVSSNNFVKSS-DQVINTVHDVRETTQTFQEVGQK 280
           ++  +  +   AI     N+ +  ++    +F  SS  Q+  T+ +++E T++ Q +   
Sbjct: 234 NINQATAEARTAI--ASANRSITGLERPLGDFATSSLPQLSGTIEELQEATRSLQALIDD 291

Query: 281 IDHLLSDFSSKMKSKE 296
           +     DF  K +SKE
Sbjct: 292 VRASPRDFIGKPQSKE 307


>gi|148257021|ref|YP_001241606.1| ABC transporter substrate-binding protein [Bradyrhizobium sp.
           BTAi1]
 gi|146409194|gb|ABQ37700.1| Putative ABC transporter (substrate binding protein)
           [Bradyrhizobium sp. BTAi1]
          Length = 367

 Score = 72.8 bits (177), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 53/204 (25%), Positives = 89/204 (43%), Gaps = 22/204 (10%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++  +  +G FV++ +   F  +YWL+ +    GP     ++  GSV GL   ++V F
Sbjct: 1   METRAPFAVIGGFVLAAIVAIFGFVYWLNNTGGL-GPRTSYHVQFEGSVPGLLVGAAVLF 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NGI VG +  L L  + P    A   +    P+   T   +  QGL G+  I L      
Sbjct: 60  NGIRVGEVTDLVLAPDNPRRVNATISVATSVPVRSDTKVGLEFQGLTGVPVIAL------ 113

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISN---AENTSKKISDSSRHIQKIIENIEKPLT 177
                       +    TAT   ++  I+     ++ ++   D+ R +  ++     PL 
Sbjct: 114 ------------EGGSSTATSGPVSILIAEPGAGQSMTQAARDALRRVDAVLAENAGPLK 161

Query: 178 TTIANIETISTVLANNISHIDKMM 201
            TIAN+ T S  LA N   +D ++
Sbjct: 162 DTIANLRTFSDGLARNTGKLDSIV 185


>gi|300917989|ref|ZP_07134615.1| virulence factor Mce family protein [Escherichia coli MS 115-1]
 gi|300414815|gb|EFJ98125.1| virulence factor Mce family protein [Escherichia coli MS 115-1]
          Length = 312

 Score = 72.8 bits (177), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 64/304 (21%), Positives = 141/304 (46%), Gaps = 30/304 (9%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSN---QYDGPMAEVIIRIPGSVDGLSTDSS 57
           ME++ ++  +GLF + ++  +     WL+ S    Q+   + +++   P  V GLS  S+
Sbjct: 1   METRAHHVVIGLFTLIVVSAALLFCLWLTNSGSDRQFR--LYDIVFNEP--VSGLSQGST 56

Query: 58  VRFNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTL 117
           V+++GI VG +  L LD++ PN   A+  +   TP+   T A +   G+ G + I+ S+ 
Sbjct: 57  VQYSGIRVGEVTQLRLDRDNPNKVWARIRVSASTPIREDTQARLTVAGITGTSNIQFSS- 115

Query: 118 RKEKKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDS-SRHIQKIIENIEKPL 176
               +T   +  + ++  +I ATPS ++  ++N EN     ++   R  Q +  + ++ L
Sbjct: 116 --GSQTSPLLEGKDDEVPIIIATPSPMSQLLANGENFMTNANEVLVRLNQLLAPDNQQRL 173

Query: 177 TTTIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDL 236
            TT+ N+  ++  +A+    +  ++   Q+   S  +  T      L+ + + ++     
Sbjct: 174 VTTLDNLALVTQTVADQRGDLRTLLQ--QLAQASKQANETLTQTNRLLRNANGLMDGQGK 231

Query: 237 QKV-----------------NQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQ 279
           Q V                 N+++   + S NN ++  +++   V ++R T  T +    
Sbjct: 232 QLVSDAAKTMASLQNTSTILNKLVSENKTSLNNGMQGMNELGPAVDELRRTLATLRAAVS 291

Query: 280 KIDH 283
           +++ 
Sbjct: 292 RLEE 295



 Score = 42.4 bits (98), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 30/140 (21%), Positives = 64/140 (45%), Gaps = 21/140 (15%)

Query: 323 DQRQKIISTINTIENITSNLNDSSQKFAELMSKINNIS-----ALKENNSLFK------- 370
           D +Q++++T++ +  +T  + D       L+ ++   S      L + N L +       
Sbjct: 168 DNQQRLVTTLDNLALVTQTVADQRGDLRTLLQQLAQASKQANETLTQTNRLLRNANGLMD 227

Query: 371 --------DAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNHF 422
                   DA + M + ++TS  +N+ +     +L N  Q G+N++   V +L+ T+   
Sbjct: 228 GQGKQLVSDAAKTMASLQNTSTILNKLVSENKTSLNNGMQ-GMNELGPAVDELRRTLATL 286

Query: 423 DDCLNNFERNPQDIVWGREK 442
              ++  E NP  ++ GRE+
Sbjct: 287 RAAVSRLEENPAALLRGRER 306


>gi|146280486|ref|YP_001170639.1| ABC transporter permease [Pseudomonas stutzeri A1501]
 gi|145568691|gb|ABP77797.1| ABC transporter permease [Pseudomonas stutzeri A1501]
          Length = 312

 Score = 72.8 bits (177), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 68/312 (21%), Positives = 141/312 (45%), Gaps = 36/312 (11%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRS------NQYDGPMAEVIIRIPGSVDGLST 54
           ME++ ++  +GLF V  +  +     WL +S      N Y+       I    +V GLS 
Sbjct: 1   METRAHHVLIGLFTVLAVGGALLFALWLGKSSMDREYNYYE-------ISFNRAVSGLSN 53

Query: 55  DSSVRFNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIEL 114
            S+V ++GI VG +  L+L+ + P    A+  I   TP+   T A +    + G   I+L
Sbjct: 54  GSAVEYSGIKVGDVEALWLEPDDPRKVRARIRIYSGTPIKQDTRARLALANITGSMIIQL 113

Query: 115 STLRKEKKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKII-ENIE 173
            +   +      +  +R +  +I A PS ++  + N E+    I++  R    ++ E+  
Sbjct: 114 HSGTPQSPP---LEGKRGEPPLIIADPSPLSALLENGEDLMTNINNLLRSANLMLSEDNA 170

Query: 174 KPLTTTIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTIT------------ 221
             +  T+AN+E  ++VLA     + + +  TQ++     +      IT            
Sbjct: 171 GRIGRTLANLEQATSVLAEQRGDLSEAL--TQLSQLGQQTNTALAEITRLTQNANGLIDD 228

Query: 222 ---DLITSLDKMIKAID--LQKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQE 276
               L++S  + + A++    +++++L + Q + NN ++   ++   ++++R T    + 
Sbjct: 229 EGRQLLSSAGESMAALERATSRLDELLSSNQGALNNGLQGFSELGPAINELRGTLGALRR 288

Query: 277 VGQKIDHLLSDF 288
           V Q+++   S F
Sbjct: 289 VTQRLEDNPSGF 300


>gi|304319771|ref|YP_003853414.1| hypothetical protein PB2503_00962 [Parvularcula bermudensis
           HTCC2503]
 gi|303298674|gb|ADM08273.1| hypothetical protein PB2503_00962 [Parvularcula bermudensis
           HTCC2503]
          Length = 310

 Score = 72.8 bits (177), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 71/297 (23%), Positives = 134/297 (45%), Gaps = 31/297 (10%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWL-SRSNQYDGPMAEVIIRIPGSVDGLSTDSSVR 59
           ME++ +Y  +G F++  +  +     WL S  ++YD    E  I     + GL   ++V 
Sbjct: 1   METRAHYVLIGAFMLGGIVLTVLFTLWLGSARSEYD----EYRIIFTQKISGLQEGANVL 56

Query: 60  FNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRK 119
           FNGIPVG +  L LDQE PN SLA   +   TP+   T   +   G+ G+  I+ +    
Sbjct: 57  FNGIPVGEVASLELDQENPNRSLALVRVDQGTPVKTDTGVELELAGVTGLAVIQFTGGSP 116

Query: 120 EKKTIFQIATERNQRAMITATPSGINYFISN----AENTSKKISD-SSRHIQKIIENIEK 174
           E   +  ++ ER     I A   G+   + +    A N  + IS  ++  + +++ ++E 
Sbjct: 117 EAPLLQNVSPERIP--TIDANLGGVAAVLESSGELALNLQRLISQRNAEAVGRVLADVES 174

Query: 175 PLTTTIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIK-- 232
            LT   A+ E    ++ +N + +   M        S+ S      + D+ T +D  ++  
Sbjct: 175 -LTDIFADRENEIGLIIDNAAAVSTEMRVA-AENISAASARLDAVLADVETVVDGDVRQA 232

Query: 233 -------AIDLQKV----NQILENIQVSSNNFVK----SSDQVINTVHDVRETTQTF 274
                  A+DLQ++     ++LE  + +  +F +    ++  ++N    + +TTQ  
Sbjct: 233 TEAFADAAVDLQELIVEMREVLEENRGAIRSFTREGLGAAVAMVNKASRLVDTTQAI 289


>gi|91776720|ref|YP_546476.1| hypothetical protein Mfla_2368 [Methylobacillus flagellatus KT]
 gi|91710707|gb|ABE50635.1| Mammalian cell entry related protein [Methylobacillus flagellatus
           KT]
          Length = 316

 Score = 72.8 bits (177), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 71/300 (23%), Positives = 144/300 (48%), Gaps = 55/300 (18%)

Query: 1   MESKNYYTSVG---LFVVSILFFSFFSIYWLSRSNQYDGPMAE--VIIRIPGSVDGLSTD 55
           ME++ +  +VG   L +V+IL F+F   +W+S S Q   P+ E  +I R P  V GL+ +
Sbjct: 1   MENRAHALAVGIATLILVAILAFAF---WWMSGSRQ---PLTEYKIISRQP--VTGLNQE 52

Query: 56  SSVRFNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLY--PSTTATIRTQGLAGITYIE 113
           +SV+F G+ VG++  + LD +  + S  +  IR D  L+      A +R+QG+ G+ YI+
Sbjct: 53  ASVKFRGVNVGKVSSIALDPD--SQSSIEITIRVDEKLHLTKDAYAELRSQGVTGLAYID 110

Query: 114 LSTLRKEKKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIE 173
           L+    + + +          ++IT  PS I+                S  + ++++ +E
Sbjct: 111 LNDPNDDGEQL-------PPGSLITMRPSLIDRI--------------SERVPRLVDKVE 149

Query: 174 KPLTTTIANIETISTVLAN-NISHIDKMMH-----TTQVTPHSSDSKNTFNTITDLITSL 227
             +   +  IE  +T++ + ++  +++ +      ++++ P    +   F   T L++  
Sbjct: 150 SFVNHGVETIEQANTMMQSIDVKRLNQTLSNLEEASSKLGPALVSANEAFGQATKLLSEQ 209

Query: 228 DKMIKAIDLQKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQE----VGQKIDH 283
           ++       Q+  Q L N+Q ++       +++  TVHDVR  T   +     +G  ++H
Sbjct: 210 NQ-------QQFTQTLNNLQAATQAATPLLNELTATVHDVRGMTGDIRNSASLIGDTLNH 262


>gi|238796786|ref|ZP_04640291.1| hypothetical protein ymoll0001_25880 [Yersinia mollaretii ATCC
           43969]
 gi|238719274|gb|EEQ11085.1| hypothetical protein ymoll0001_25880 [Yersinia mollaretii ATCC
           43969]
          Length = 313

 Score = 72.4 bits (176), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 70/329 (21%), Positives = 151/329 (45%), Gaps = 43/329 (13%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSN---QYDGPMAEVIIRIPGSVDGLSTDSS 57
           ME++ ++  +GLF + ++  +     WL+ +    Q+   + +++   P  V GLS  S+
Sbjct: 1   METRAHHVVIGLFTLIVVSAALLFCLWLTNAGSNRQFK--LYDIVFNEP--VSGLSQGST 56

Query: 58  VRFNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTL 117
           V+++GI VG ++ L LD E PN   A+  +   TP+   T A +   G+ G + I+ S+ 
Sbjct: 57  VQYSGIRVGEVIQLRLDNEDPNKVWARIRVSASTPIRQDTQARLTVAGITGTSNIQFSSS 116

Query: 118 RKEKKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIE-NIEKPL 176
            +       +  +  +  +I ATPS ++  ++N EN     ++    + +++E + ++ L
Sbjct: 117 SQSSPL---LEGKDGEIPIIIATPSPMSQLLANGENFMSNANEVLVRLNQLLEPDNQQRL 173

Query: 177 TTTIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDL 236
             T+ N+  I+  +A+    I  M+   Q+   S  +  T                   L
Sbjct: 174 IRTLDNLALITQTVADQRGDISTMLQ--QLAQASKQANET-------------------L 212

Query: 237 QKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSD----FSSKM 292
            + N++L N    +N  +    + +  V D  +T  + Q     ++ L+S+     S+ M
Sbjct: 213 AQTNRLLRN----ANGLMDGQGKQL--VSDAAKTMASLQNTSTILNKLVSENKTSLSNGM 266

Query: 293 KS-KETSAFLENIADSTSNMRSSISAIRE 320
           +   E    ++ +  + + +R+++S + E
Sbjct: 267 QGMNELGPAVDELRRTLATLRAAVSRLEE 295



 Score = 43.1 bits (100), Expect = 0.091,   Method: Compositional matrix adjust.
 Identities = 28/122 (22%), Positives = 58/122 (47%), Gaps = 2/122 (1%)

Query: 321 ITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNISALKENNSLFKDAQRAMHTFR 380
           + DQR  I + +  +   +   N++  +   L+   N +    +   L  DA + M + +
Sbjct: 187 VADQRGDISTMLQQLAQASKQANETLAQTNRLLRNANGLMD-GQGKQLVSDAAKTMASLQ 245

Query: 381 DTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFERNPQDIVWGR 440
           +TS  +N+ +     +L N  Q G+N++   V +L+ T+      ++  E NP  ++ GR
Sbjct: 246 NTSTILNKLVSENKTSLSNGMQ-GMNELGPAVDELRRTLATLRAAVSRLEENPSALLRGR 304

Query: 441 EK 442
           E+
Sbjct: 305 ER 306


>gi|238791988|ref|ZP_04635624.1| hypothetical protein yinte0001_8880 [Yersinia intermedia ATCC
           29909]
 gi|238728619|gb|EEQ20137.1| hypothetical protein yinte0001_8880 [Yersinia intermedia ATCC
           29909]
          Length = 312

 Score = 72.4 bits (176), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 64/304 (21%), Positives = 142/304 (46%), Gaps = 30/304 (9%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSN---QYDGPMAEVIIRIPGSVDGLSTDSS 57
           ME++ ++  +GLF + ++  +     WL+ S    Q+   + +++   P  V GLS  S+
Sbjct: 1   METRAHHVVIGLFTLIVVSAALLFCLWLTNSGSDRQFR--LYDIVFNEP--VSGLSQGST 56

Query: 58  VRFNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTL 117
           V+++GI VG +  L LD++ P+   A+  +   TP+   T A +   G+ G + I+ S+ 
Sbjct: 57  VQYSGIRVGEVTQLRLDRDNPSKVWARIRVSASTPIREDTQARLTVAGITGTSNIQFSS- 115

Query: 118 RKEKKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDS-SRHIQKIIENIEKPL 176
               +T   +  + ++  +I ATPS ++  ++N EN     ++   R  Q +  + ++ L
Sbjct: 116 --GSQTSPLLEGKDDEVPIIIATPSPMSQLLANGENFMTNANEVLVRLNQLLAPDNQQRL 173

Query: 177 TTTIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKA--- 233
            TT+ N+  ++  +A+    +  ++   Q+   S  +  T      L+ + + ++     
Sbjct: 174 VTTLDNLALVTQTVADQRGDLRTLLQ--QLAQASKQANETLTQTNRLLRNANGLMDGQGK 231

Query: 234 ----------IDLQKVNQILENI----QVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQ 279
                       LQ  + IL+ +    + S NN ++  +++   V ++R T  T +    
Sbjct: 232 QLVSDAAKTMASLQNTSAILDKLVSENKTSLNNGMRGMNELGPAVDELRRTLATLRAAVS 291

Query: 280 KIDH 283
           +++ 
Sbjct: 292 RLEE 295



 Score = 39.7 bits (91), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 28/140 (20%), Positives = 63/140 (45%), Gaps = 21/140 (15%)

Query: 323 DQRQKIISTINTIENITSNLNDSSQKFAELMSKINNIS-----ALKENNSLFK------- 370
           D +Q++++T++ +  +T  + D       L+ ++   S      L + N L +       
Sbjct: 168 DNQQRLVTTLDNLALVTQTVADQRGDLRTLLQQLAQASKQANETLTQTNRLLRNANGLMD 227

Query: 371 --------DAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNHF 422
                   DA + M + ++TS  +++ +     +L N    G+N++   V +L+ T+   
Sbjct: 228 GQGKQLVSDAAKTMASLQNTSAILDKLVSENKTSLNN-GMRGMNELGPAVDELRRTLATL 286

Query: 423 DDCLNNFERNPQDIVWGREK 442
              ++  E NP  ++ GRE+
Sbjct: 287 RAAVSRLEENPAALLRGRER 306


>gi|218461267|ref|ZP_03501358.1| putative ABC transporter, substrate-binding protein [Rhizobium etli
           Kim 5]
          Length = 110

 Score = 72.0 bits (175), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 34/109 (31%), Positives = 64/109 (58%), Gaps = 2/109 (1%)

Query: 343 NDSSQKFAELMSKINNISALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQ 402
           N +S +   ++ K++ +       S+F  A+  + +F+  ++ +N  I  I +NLQ FS 
Sbjct: 1   NSASTRIDGILIKVDALLGTDNTQSMFAQARETLESFKKVADNLNARIGPIADNLQKFSS 60

Query: 403 SGLNDIQNLVRKLQETVNHFDDCLNNFERNPQDIVWGREKGSVKIYKPK 451
            GL D+Q LV  ++ TVN+ ++ + NF+RNPQ +++G +  +VK Y  +
Sbjct: 61  GGLRDVQTLVNDMRGTVNNLNETITNFDRNPQRLIFGGD--TVKQYDGR 107


>gi|170724244|ref|YP_001751932.1| hypothetical protein PputW619_5087 [Pseudomonas putida W619]
 gi|169762247|gb|ACA75563.1| Mammalian cell entry related domain protein [Pseudomonas putida
           W619]
          Length = 312

 Score = 72.0 bits (175), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 63/301 (20%), Positives = 142/301 (47%), Gaps = 26/301 (8%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++ ++  +GL  V ++  +     WL++S+  D    +  +    +V GLS  S V++
Sbjct: 1   METRAHHVLIGLVTVLVVAGAMLFGLWLTKSS-VDDAFKDYEVIFNEAVSGLSRGSPVQY 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NGI VG +  L LD + P   LA+  +  DTP+   T A +   G+ G ++I+LS    +
Sbjct: 60  NGIKVGDVTSLRLDPKDPRRVLARVRLSGDTPVKEDTQAKLTLAGVTGNSFIQLSGGTPK 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIE--NIEKPLTT 178
                ++  +  +  +I A+PS I+  ++++ +    I+    +  ++    NI++ L+ 
Sbjct: 120 SP---ELKGKDGKLPVIIASPSPISQLLNDSSDLVTNINLLLHNANQMFSENNIDR-LSN 175

Query: 179 TIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIK------ 232
           T+AN+E  ++  AN+   I + +   Q+      +  T      L+ + + ++       
Sbjct: 176 TLANLEQTTSAFANHKGGISQAIE--QLAQVGKQANATLAETQALMRNANSLLGTQGKQA 233

Query: 233 -----------AIDLQKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKI 281
                      A     +N +L + + S ++  +  +Q+   + ++RET  + + + +++
Sbjct: 234 IGSAEQAMQSLAASTATINSLLNDNRQSIDDGAQGLNQLTPAIRELRETLNSLKGISRRL 293

Query: 282 D 282
           +
Sbjct: 294 E 294



 Score = 36.6 bits (83), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 29/150 (19%), Positives = 71/150 (47%), Gaps = 7/150 (4%)

Query: 301 LENIADSTSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNIS 360
           ++ ++++ +N+  + SA     + +  I   I  +  +    N +  +   LM   N++ 
Sbjct: 170 IDRLSNTLANLEQTTSAF---ANHKGGISQAIEQLAQVGKQANATLAETQALMRNANSLL 226

Query: 361 ALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVN 420
             +   ++   A++AM +   ++  IN  +     ++ + +Q GLN +   +R+L+ET+N
Sbjct: 227 GTQGKQAI-GSAEQAMQSLAASTATINSLLNDNRQSIDDGAQ-GLNQLTPAIRELRETLN 284

Query: 421 HFDDCLNNFERNPQDIVWGREKGSVKIYKP 450
                    E +P   + GR+  ++K ++P
Sbjct: 285 SLKGISRRLEADPSGYLLGRD--NIKEFQP 312


>gi|123441586|ref|YP_001005572.1| hypothetical protein YE1249 [Yersinia enterocolitica subsp.
           enterocolitica 8081]
 gi|332162488|ref|YP_004299065.1| hypothetical protein YE105_C2866 [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|122088547|emb|CAL11341.1| putative exported protein [Yersinia enterocolitica subsp.
           enterocolitica 8081]
 gi|318606568|emb|CBY28066.1| ABC-type transport system involved in resistance to organic
           solvents, periplasmic component USSDB6C [Yersinia
           enterocolitica subsp. palearctica Y11]
 gi|325666718|gb|ADZ43362.1| hypothetical protein YE105_C2866 [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|330861184|emb|CBX71441.1| hypothetical protein YEW_CA08660 [Yersinia enterocolitica W22703]
          Length = 313

 Score = 72.0 bits (175), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 66/294 (22%), Positives = 131/294 (44%), Gaps = 25/294 (8%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSN---QYDGPMAEVIIRIPGSVDGLSTDSS 57
           ME++ ++  +GLF + ++  +     WL+ +    Q+   + +++   P  V GLS  S 
Sbjct: 1   METRAHHVVIGLFTLIVVSAALLFCLWLTNAGSNRQFK--LYDIVFNEP--VSGLSQGSI 56

Query: 58  VRFNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTL 117
           V+++GI VG +  L LD E PN   A+  +   TP+   T A +   G+ G + I+ S+ 
Sbjct: 57  VQYSGIRVGEVTQLRLDSENPNKVWARIRVSASTPIRQDTQARLTVAGITGTSNIQFSSS 116

Query: 118 RKEKKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIE-NIEKPL 176
                    +  +  +  +I ATPS ++  ++N EN     ++    + +++  + ++ L
Sbjct: 117 TPSSPL---LEGKDGEIPIIIATPSPMSQLLANGENFMSNANEVLMRLNQLLAPDNQQRL 173

Query: 177 TTTIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDL 236
            TT+ N+  ++  +A+    I  M+   Q+   S  +  T      L+ + + ++     
Sbjct: 174 ITTLDNLALVTQTVADQRQDIRTMLQ--QLAQASKQANETLAQTNRLLRNANGLMDGQGK 231

Query: 237 QKVNQI------LENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHL 284
           Q VN        L+N  +  N  V  +   +N         Q   E+G  +D L
Sbjct: 232 QLVNDAAKTMASLQNTSIILNKLVSENQTSLNN------GMQGMNELGPAVDEL 279



 Score = 43.9 bits (102), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 29/122 (23%), Positives = 59/122 (48%), Gaps = 2/122 (1%)

Query: 321 ITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNISALKENNSLFKDAQRAMHTFR 380
           + DQRQ I + +  +   +   N++  +   L+   N +    +   L  DA + M + +
Sbjct: 187 VADQRQDIRTMLQQLAQASKQANETLAQTNRLLRNANGLMD-GQGKQLVNDAAKTMASLQ 245

Query: 381 DTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFERNPQDIVWGR 440
           +TS  +N+ +     +L N  Q G+N++   V +L+ T+      ++  E NP  ++ GR
Sbjct: 246 NTSIILNKLVSENQTSLNNGMQ-GMNELGPAVDELRRTLATLRAAVSRLEENPAALLRGR 304

Query: 441 EK 442
           E+
Sbjct: 305 ER 306


>gi|152992946|ref|YP_001358667.1| ABC transporter, substrate-binding protein [Sulfurovum sp. NBC37-1]
 gi|151424807|dbj|BAF72310.1| ABC transporter, substrate-binding protein [Sulfurovum sp. NBC37-1]
          Length = 303

 Score = 71.6 bits (174), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 74/281 (26%), Positives = 130/281 (46%), Gaps = 48/281 (17%)

Query: 1   MESKNYYTSVGLFVV----SILFFSFFSIYWLSR---SNQYDGPMAEVIIRIPGSVDGLS 53
           M S+  YT VG+FV+     ++ F+F    WL++    N+Y+       +++  SV GLS
Sbjct: 1   MYSRVNYTIVGIFVLLFGAGLVAFTF----WLAKYGIKNEYN----LYKLQMTESVSGLS 52

Query: 54  TDSSVRFNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIE 113
            DS+VR  G+ VGR+  + ++ +          IR D P+    TA     G+ G+  IE
Sbjct: 53  KDSTVRLRGVDVGRVSEIRINPDNIEQIEVFLKIRSDVPIKEDMTAHTEMLGITGLLAIE 112

Query: 114 LSTLRKEKKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIE 173
           +     + K    + +E  +  +I  TPS   +F    + TSK I   + ++  ++E  E
Sbjct: 113 IDGGTNKSKL---LKSENGEIPVIKTTPS---WF----DKTSKGIGSMAENLTDLLEKAE 162

Query: 174 KPLTTTIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKA 233
           K L+    NIET  ++L N          T ++T    D+ + FNT   +    D ++K 
Sbjct: 163 KLLSD--ENIETFDSILEN----------TDKMTARVVDTLDEFNTTMQVYR--DAVVKL 208

Query: 234 IDLQKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTF 274
            D         +I  +S+NF + +D  +  +  ++  T+ F
Sbjct: 209 ND---------DIHSASSNFARITDNTLPALKALQNATKNF 240


>gi|104779406|ref|YP_605904.1| hypothetical protein PSEEN0096 [Pseudomonas entomophila L48]
 gi|95108393|emb|CAK13087.1| conserved hypothetical protein [Pseudomonas entomophila L48]
          Length = 312

 Score = 71.6 bits (174), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 67/299 (22%), Positives = 142/299 (47%), Gaps = 22/299 (7%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++ ++  +GL  V ++  +     WL++S+  D    +  +    +V GLS  S V++
Sbjct: 1   METRAHHVLIGLVTVLVVAGAMLFGLWLTKSS-VDTAFKDYEVVFNEAVSGLSRGSPVQY 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NGI VG +  L LD + P   LA+  +  DTP+   T A +   G+ G  +I+LS     
Sbjct: 60  NGIKVGDVSSLRLDPKDPRRVLARVRLSGDTPVKEDTQAKLTLAGVTGNAFIQLSGGTPH 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIE--NIEKPLTT 178
                ++  +  +  +I A+PS I+  ++++ +    I+    +  ++    NIE+ L+ 
Sbjct: 120 SP---ELKGKDGKLPVIVASPSPISRLLNDSSDLVTNINLLLHNANQMFSEGNIER-LSN 175

Query: 179 TIANIETISTVLANNISHIDKMM-HTTQVTPHSSDS--------KNT----FNTITDLIT 225
           T+AN+E  +   AN    I   +    QV   ++ +        +N      N     I 
Sbjct: 176 TLANLEQTTGAFANQKGGISAAIEQLAQVGKQANATLAETQALMRNANGLLGNQGKQAIG 235

Query: 226 SLDKMIKAI--DLQKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKID 282
           S ++ ++A+      +N +L++ + S ++  +  +Q+   + ++RET    + + ++++
Sbjct: 236 SAEQAMQALAESAATLNSLLQDNRQSIDDGAQGLNQLSPAIRELRETLNALKGISRRLE 294



 Score = 39.3 bits (90), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 27/141 (19%), Positives = 63/141 (44%), Gaps = 5/141 (3%)

Query: 301 LENIADSTSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNIS 360
           +E ++++ +N+  +  A     +Q+  I + I  +  +    N +  +   LM   N + 
Sbjct: 170 IERLSNTLANLEQTTGAF---ANQKGGISAAIEQLAQVGKQANATLAETQALMRNANGLL 226

Query: 361 ALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVN 420
              +       A++AM    +++  +N  +     ++ + +Q GLN +   +R+L+ET+N
Sbjct: 227 G-NQGKQAIGSAEQAMQALAESAATLNSLLQDNRQSIDDGAQ-GLNQLSPAIRELRETLN 284

Query: 421 HFDDCLNNFERNPQDIVWGRE 441
                    E +P   + GR+
Sbjct: 285 ALKGISRRLEADPSGYLLGRD 305


>gi|94496556|ref|ZP_01303132.1| ABC-type transport system periplasmic component [Sphingomonas sp.
           SKA58]
 gi|94423916|gb|EAT08941.1| ABC-type transport system periplasmic component [Sphingomonas sp.
           SKA58]
          Length = 320

 Score = 71.6 bits (174), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 69/297 (23%), Positives = 126/297 (42%), Gaps = 50/297 (16%)

Query: 22  FFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRFNGIPVGRIVGLFLDQEYPNHS 81
             + +W SR +Q D    ++  +   SV GL+  S V + G+P G++  + L +  P+  
Sbjct: 22  MIAAFWFSRLSQGDNKEYDIFFKQ--SVSGLAKGSGVNYAGVPSGQVEKIELWKRDPSFV 79

Query: 82  LAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKEKKTIFQIATERNQRA------ 135
             +  +R  TP+   TTATI+  G  G++ I L    K    I Q   +    A      
Sbjct: 80  KVRISVRDGTPILQGTTATIQGVGFTGVSEIVLDGAVKGAPPI-QCPAQNAPAACPDGVP 138

Query: 136 MITATPSGINYFISNAENTSKKISDSSRHIQKIIENI-EKPLTTTIANIETISTVLANN- 193
           +I   P  +   ++NA    +++S  +  + +++++  ++ +   +AN+E IS  LA+  
Sbjct: 139 VIPTKPGALGELLNNAPQLLERLSTLTERLTELLDDKNQQSIAGILANVERISGSLADRS 198

Query: 194 --------------------ISHIDKMMHTT------QVTPHSSDSKNTFNTITDLITSL 227
                               +  I K+  TT      Q  P  +D + T  + T  I +L
Sbjct: 199 PEIAATLAEARIAVQRTGVAVEQIGKLAATTDSLLNEQGKPLMADLRKTVQSATRSIDTL 258

Query: 228 DKMIKAIDLQKVNQILENIQVSSNNF-VKSSDQVINTVHDVRETTQTFQEVGQKIDH 283
           DK I               Q    +F  ++  +V   V D+RE ++ F+ V +K+D 
Sbjct: 259 DKTIG------------EAQPGVKSFSTQTMPEVNQLVRDLREMSRAFRGVAEKLDQ 303


>gi|297538917|ref|YP_003674686.1| Mammalian cell entry related domain-containing protein
           [Methylotenera sp. 301]
 gi|297258264|gb|ADI30109.1| Mammalian cell entry related domain protein [Methylotenera sp. 301]
          Length = 322

 Score = 71.2 bits (173), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 67/248 (27%), Positives = 112/248 (45%), Gaps = 27/248 (10%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSN----QYDGPMA---EVIIRIPGSVDGLS 53
           +E+K  Y  VG FV+ +       I W++       +YD  +A   E       SV GLS
Sbjct: 7   IENKVNYALVGAFVLILGTILIAGILWIASGGINKQKYDTYLAIENE-------SVAGLS 59

Query: 54  TDSSVRFNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIE 113
           T++ V++NG+ VGR+  + LD   P     + LI   T +   T AT++TQGL GI YIE
Sbjct: 60  TNALVKYNGVDVGRVSNISLDPINPQRVRLELLIVRGTLIKQDTLATLKTQGLTGIAYIE 119

Query: 114 LSTLRKEKKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIE 173
           LS       +   +A+E      I   PS      +  E+    ++    H+    + I 
Sbjct: 120 LSG--GNTHSPLLVASEGEPYPEIKTIPS----LSTRLESLLSSVAAKLEHLSGSFDGIN 173

Query: 174 KP-----LTTTIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLD 228
            P      ++ +++I  +S  +A     +D  M +   T  ++D  +    +  LI +++
Sbjct: 174 SPENVKAFSSALSDIAAVSHTIAQRKDSLDAGMKSAASTFANTDQAS--KKLESLIVNVE 231

Query: 229 KMIKAIDL 236
           K  KA+ L
Sbjct: 232 KSAKAVQL 239


>gi|77456267|ref|YP_345772.1| hypothetical protein Pfl01_0039 [Pseudomonas fluorescens Pf0-1]
 gi|77380270|gb|ABA71783.1| conserved hypothetical protein [Pseudomonas fluorescens Pf0-1]
          Length = 312

 Score = 71.2 bits (173), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 73/323 (22%), Positives = 148/323 (45%), Gaps = 34/323 (10%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++ ++  +GLF V ++  +     WL++S+  D    +  +    +V GLS  S V++
Sbjct: 1   METRAHHVLIGLFTVIVVAGALLFGLWLAKSS-VDTEFKDYEVVFNEAVSGLSRGSPVQY 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           +GI VG +V L LD + P   LA+  +  DTP+   T A +   G+ G + I+LS    +
Sbjct: 60  SGIKVGDVVSLRLDPKDPRRVLARIRLAGDTPVKEDTEAKLALAGITGTSIIQLSGGTPQ 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
                ++         I A+PS I          S+ +SDS+        ++   +TT +
Sbjct: 120 SS---KLKGHDGNLPTIVASPSPI----------SRLLSDSN--------DLMSGVTTLL 158

Query: 181 ANIETISTVLANNISHIDKMM-HTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKV 239
           +N   + +  A+NI  + K + H  Q T   +D +         + ++ K    + L++ 
Sbjct: 159 SNANQMFS--ADNIERVSKTLEHLEQTTGSINDQRGDLRQAMQQLATVGKQAGNM-LEQT 215

Query: 240 NQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSA 299
           + ++ N    +N  +  +DQ    +    +  ++ ++    I+ LLS   + + S     
Sbjct: 216 SALMRN----ANGLL--NDQGKQALGSAEQAMKSLEQSSVTINGLLSKNQNSLDSGMQG- 268

Query: 300 FLENIADSTSNMRSSISAIREIT 322
            L  +A +   +R +++++R I+
Sbjct: 269 -LNGLAPAIRELRETLNSLRAIS 290



 Score = 43.9 bits (102), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 38/141 (26%), Positives = 64/141 (45%), Gaps = 21/141 (14%)

Query: 322 TDQRQKIISTINTIENITSNLND-------SSQKFAELMSKINNI----SALKEN-NSLF 369
            D  +++  T+  +E  T ++ND       + Q+ A +  +  N+    SAL  N N L 
Sbjct: 167 ADNIERVSKTLEHLEQTTGSINDQRGDLRQAMQQLATVGKQAGNMLEQTSALMRNANGLL 226

Query: 370 KD--------AQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNH 421
            D        A++AM +   +S  IN  +    N+L +  Q GLN +   +R+L+ET+N 
Sbjct: 227 NDQGKQALGSAEQAMKSLEQSSVTINGLLSKNQNSLDSGMQ-GLNGLAPAIRELRETLNS 285

Query: 422 FDDCLNNFERNPQDIVWGREK 442
                   E NP   + G +K
Sbjct: 286 LRAISQRLEANPSGYLLGSDK 306


>gi|92116873|ref|YP_576602.1| hypothetical protein Nham_1317 [Nitrobacter hamburgensis X14]
 gi|91799767|gb|ABE62142.1| Mammalian cell entry related protein [Nitrobacter hamburgensis X14]
          Length = 293

 Score = 71.2 bits (173), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 56/263 (21%), Positives = 122/263 (46%), Gaps = 19/263 (7%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLS--RSNQYDGPMAEVIIRIPGSVDGLSTDSSV 58
           ME++  +  +G F ++++  +F  + W     S++   P+    I   GS  GL    SV
Sbjct: 1   METRANFVLIGSFTLAVIAAAFGFVLWFQNLHSSKARSPLR---IVFEGSASGLRNGGSV 57

Query: 59  RFNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLR 118
            FNGI VG +V + LD   P   +A  ++    P+   T   +  QGL G+  I   +L+
Sbjct: 58  NFNGIRVGEVVSVKLDD--PRRVVALTMVENAAPIRKDTRVGLEFQGLTGVAAI---SLK 112

Query: 119 KEKKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTT 178
             +     +  + +    +TA P+G+        + ++ I  + +++ +++   E  +  
Sbjct: 113 GGEVAASPVPLDGDGVPTLTADPAGL-------RDVTESIRATLQNVNRVVAENETAVKN 165

Query: 179 TIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQK 238
           T+ N+ET +  LA+N   ID ++   +     S +        +L+  L+ +    D  +
Sbjct: 166 TLRNVETFTASLAHNAGKIDDLVQ--KFNEVMSKADGVMTKTDELMLGLNAIAGGKDGGE 223

Query: 239 VNQILENIQVSSNNFVKSSDQVI 261
           + + +++++  +++F K S  ++
Sbjct: 224 LLKTVKSVREFADDFNKRSGALM 246


>gi|39937022|ref|NP_949298.1| hypothetical protein RPA3961 [Rhodopseudomonas palustris CGA009]
 gi|192292849|ref|YP_001993454.1| mammalian cell entry related domain protein [Rhodopseudomonas
           palustris TIE-1]
 gi|39650879|emb|CAE29402.1| putative periplasmic binding protein for ABC transporter
           [Rhodopseudomonas palustris CGA009]
 gi|192286598|gb|ACF02979.1| Mammalian cell entry related domain protein [Rhodopseudomonas
           palustris TIE-1]
          Length = 297

 Score = 71.2 bits (173), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 60/280 (21%), Positives = 127/280 (45%), Gaps = 30/280 (10%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLS--RSNQYDGPMAEVIIRIPGSVDGLSTDSSV 58
           ME++  Y  +G F ++++  +F  + W     + +   P+  V     G+  GL    SV
Sbjct: 1   METRANYFLIGTFTLAVIAAAFGFVLWFQSLHTTKARSPLRVV---FEGAASGLRNGGSV 57

Query: 59  RFNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLR 118
            FNG+ VG +V + LD   P   +A A++    P+   T   +  QGL G+  I   +L+
Sbjct: 58  NFNGVRVGEVVSVKLDN--PRRVVALAMVENTAPIRKDTQVGLEFQGLTGVAAI---SLK 112

Query: 119 KEKKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTT 178
              +T   +  + +   ++TA P  +       ++ S+ I  + R++ +++   ++ + T
Sbjct: 113 GGSETAPPVPLDDDGTPVLTADPELL-------QDISESIKATLRNVNRLVSENQESVKT 165

Query: 179 TIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQK 238
           ++ N++T ++ LA +   ID +M         +DS         ++  +D +    D  +
Sbjct: 166 SLENLQTFTSSLARSSDKIDSIMSRVDGVIAKTDS---------VMQGIDALAGGKDGGE 216

Query: 239 VNQILENIQVSSNNFVKSSDQVI----NTVHDVRETTQTF 274
           + Q +++ +  ++N  K S  +I     T+ D+      F
Sbjct: 217 LFQAVKSFRELADNLDKRSATLILDGRRTLADISRAVNNF 256


>gi|238789961|ref|ZP_04633740.1| hypothetical protein yfred0001_37280 [Yersinia frederiksenii ATCC
           33641]
 gi|238721909|gb|EEQ13570.1| hypothetical protein yfred0001_37280 [Yersinia frederiksenii ATCC
           33641]
          Length = 313

 Score = 71.2 bits (173), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 63/291 (21%), Positives = 129/291 (44%), Gaps = 19/291 (6%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQ------YDGPMAEVIIRIPGSVDGLST 54
           ME++ ++  +GLF + ++  +     WL+ +        YD     ++   P  V GLS 
Sbjct: 1   METRAHHVVIGLFTLIVVSAALLFCLWLTGAGSDRQFRFYD-----IVFNEP--VSGLSQ 53

Query: 55  DSSVRFNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIEL 114
            S+V+++GI VG +  L LD++ PN   A+  +   TP+   T A +   G+ G + I+ 
Sbjct: 54  GSTVQYSGIRVGEVTQLRLDRDNPNKVWARIRVSASTPIREDTQARLTVAGITGTSNIQF 113

Query: 115 STLRKEKKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIE-NIE 173
           S+  +       + +   +  +I ATPS ++  ++N EN     ++    + +++  + +
Sbjct: 114 SSSSQSSPL---LESHDGEVPVIVATPSPMSQLLANGENFMSNANEVLVRLNQLLAPDNQ 170

Query: 174 KPLTTTIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKA 233
           + L TT+ N+  ++  +A+    I  M+   Q+   S  +  T      L+ + + ++  
Sbjct: 171 QRLITTLDNLALVTQTVADQRQDIRTMLQ--QLAQASKQANETLTQTNRLLRNANGLMDG 228

Query: 234 IDLQKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHL 284
              Q +N   + +    N     S  V      +    Q   E+G  +D L
Sbjct: 229 QGKQLMNDAAKTMASLQNTSTILSKLVSENKTSLNNGMQGMNELGPAVDEL 279



 Score = 43.5 bits (101), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 28/122 (22%), Positives = 59/122 (48%), Gaps = 2/122 (1%)

Query: 321 ITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNISALKENNSLFKDAQRAMHTFR 380
           + DQRQ I + +  +   +   N++  +   L+   N +    +   L  DA + M + +
Sbjct: 187 VADQRQDIRTMLQQLAQASKQANETLTQTNRLLRNANGLMD-GQGKQLMNDAAKTMASLQ 245

Query: 381 DTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFERNPQDIVWGR 440
           +TS  +++ +     +L N  Q G+N++   V +L+ T+      ++  E NP  ++ GR
Sbjct: 246 NTSTILSKLVSENKTSLNNGMQ-GMNELGPAVDELRRTLMTLRAAVSRLEENPAALLRGR 304

Query: 441 EK 442
           E+
Sbjct: 305 ER 306


>gi|316935756|ref|YP_004110738.1| mammalian cell entry related domain-containing protein
           [Rhodopseudomonas palustris DX-1]
 gi|315603470|gb|ADU46005.1| Mammalian cell entry related domain protein [Rhodopseudomonas
           palustris DX-1]
          Length = 399

 Score = 71.2 bits (173), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 49/205 (23%), Positives = 89/205 (43%), Gaps = 16/205 (7%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++  +  VG FV++ +F  F  ++WL  ++   G      ++    V GL   ++V F
Sbjct: 1   METRAPFAIVGAFVLAAIFAVFGFVFWLHNTSGV-GARTTYQLQFRDPVPGLLVGAAVLF 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NGI VG +  L L  + P    A   + P TP+ P T   +  QGL G+  + L   +  
Sbjct: 60  NGIRVGEVTALALAPDDPRRVDATIAVAPSTPVRPDTKVGLDFQGLTGVPVVALEGGK-- 117

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
                Q+        ++    +G++         ++   ++ R +  ++     PL  TI
Sbjct: 118 -----QLTGSAAATTLVAEPGAGMSM--------TQAAREALRKVDSVLGENSGPLKDTI 164

Query: 181 ANIETISTVLANNISHIDKMMHTTQ 205
           AN +T S  LA     +D ++   +
Sbjct: 165 ANFKTFSEWLAGKTDKLDGILGGVE 189


>gi|221069467|ref|ZP_03545572.1| Mammalian cell entry related domain protein [Comamonas testosteroni
           KF-1]
 gi|220714490|gb|EED69858.1| Mammalian cell entry related domain protein [Comamonas testosteroni
           KF-1]
          Length = 315

 Score = 71.2 bits (173), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 62/266 (23%), Positives = 125/266 (46%), Gaps = 30/266 (11%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSN-QYDGPMAEVIIRIPGSVDGLSTDSSVR 59
           ME+K++  + G+FV+ +         WL+R N +Y   + E+  +    V GL   ++VR
Sbjct: 1   MENKSHAMAAGIFVLVVAALLAGLAVWLTRDNREYQ--LYEMSTK--DGVSGLQPQATVR 56

Query: 60  FNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRK 119
           + G+PVG++V +  D + P + L +  +  DTP+ P+T A +  QG+ G+ +I+L    +
Sbjct: 57  YKGVPVGKVVRIGFDPQIPGNVLIRIAVGEDTPVTPATYAQLGYQGVTGLAHIQLDDDSR 116

Query: 120 EKKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKII-ENIEKPLTT 178
             + + +       R  + ++P  +N          +++ + SR +  ++ E+ +K ++ 
Sbjct: 117 ASQPL-KPGPSGLPRLPMKSSP--LNMLADQGPVLLERVDEISRRLNAMLGEDNQKRVSA 173

Query: 179 TIANIETISTVLANNISHIDKMMHTT-----QVTPHSSDSKNTF-------NTITDLITS 226
            + NI   S      I  + + M+ T     Q+T   +D+  T        N  T + T 
Sbjct: 174 ALDNIAAAS----GGIKDLAETMNKTAKDFPQLT---ADAHQTLQSLTKAGNAATGVATD 226

Query: 227 LDKMIKAIDLQ--KVNQILENIQVSS 250
           L + ++ ++     + QI E  Q  S
Sbjct: 227 LQQTVRKVNAPDGPLQQIAEGTQALS 252


>gi|114330427|ref|YP_746649.1| hypothetical protein Neut_0406 [Nitrosomonas eutropha C91]
 gi|114307441|gb|ABI58684.1| Mammalian cell entry related domain protein [Nitrosomonas eutropha
           C91]
          Length = 301

 Score = 71.2 bits (173), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 66/306 (21%), Positives = 147/306 (48%), Gaps = 41/306 (13%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSN----QYDGPMAEVIIRIPGSVDGLSTDS 56
           ME++ +  + GLFV+ +   +  ++ WLSR N     Y       +I   GSV GL+ ++
Sbjct: 1   MENRAHAFAAGLFVLLLGVAAVMAVKWLSRDNINHNHY------FLISAGGSVSGLNPEA 54

Query: 57  SVRFNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELST 116
           SVR+ G+ +G++  ++ D+E   + + +  +     L  +  A + +QG+ G+TY+EL+ 
Sbjct: 55  SVRYRGVNIGKVEEIYFDKENIRNIIVRIAVSSHVTLPKNIYAQLASQGITGLTYVELND 114

Query: 117 LRKEKKTIFQIATERN---QRAMITATPSGINYFISNAENTSKKISD-----SSRHIQKI 168
              E    + +  E +   + ++I      +   + N+    K+I++     +  HI KI
Sbjct: 115 DVSEAGAGY-LENEAHIFLRSSLIKTLSDSLEEILKNSNTVIKQINNLLNKKNQAHIGKI 173

Query: 169 IENIEKPLTTTIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLD 228
           + ++E+    T+ + + ++  L N +  + ++         + +  +TF     ++ +  
Sbjct: 174 LSHLEQ----TVQHYDKLTEELQNGLQALPQL---------TGEFTSTFRQTRQVMENTS 220

Query: 229 KMIKAIDLQKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDF 288
           ++     LQK+NQ     Q   +N  + S ++ +T+  + ET Q   +  +K++ LL+  
Sbjct: 221 QV-----LQKLNQ----QQGLIDNLTQGSLEMAHTLDSLNETGQAVTQSTRKLNQLLNLL 271

Query: 289 SSKMKS 294
            +  +S
Sbjct: 272 EAHPQS 277


>gi|82702737|ref|YP_412303.1| hypothetical protein Nmul_A1610 [Nitrosospira multiformis ATCC
           25196]
 gi|82410802|gb|ABB74911.1| Mammalian cell entry related protein [Nitrosospira multiformis ATCC
           25196]
          Length = 313

 Score = 71.2 bits (173), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 66/300 (22%), Positives = 140/300 (46%), Gaps = 16/300 (5%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME + ++  +G F V  +  +     WLS++   D       +    +V GLS  S V++
Sbjct: 1   MEPRAHHVLIGFFTVMTVTAALLFTLWLSKA-PGDSVQRYYTVVFNEAVRGLSIGSPVQY 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           +GI VG +V L LD + P + +A+  ++  TP+   T A +   G+ G + IE S    +
Sbjct: 60  SGITVGDVVNLALDPQDPRNVIARVRVQGSTPIKEDTQARLALTGITGNSVIEFSGGSPD 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKII--ENIEKPLTT 178
              +  +A + ++  +I ATPS I   + +++N    ++      ++I+  EN ++ L+ 
Sbjct: 120 SPDL--VAKDDHKDPVIVATPSPIAKLLEHSDNMMADVTQLVMRAKEILSQENAKR-LSR 176

Query: 179 TIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQK 238
           T+ N+E  + V+A+    +  ++   ++   S+ + +     T L+ + + ++     +K
Sbjct: 177 TLENLEQTTAVIASQNDSVRGIVG--ELATASAQANSALREATQLMAATNTLVS----EK 230

Query: 239 VNQILENIQVSSNNFVKSSDQVINTVHDVRET----TQTFQEVGQKIDHLLSDFSSKMKS 294
               L N+  ++ +  K S  V   + + R       Q   E+G  +  L +  S+  ++
Sbjct: 231 GVPTLGNLDRATASLAKVSASVDQLLLENRAALSGGMQGMNELGPALQELRNTMSALART 290


>gi|327478708|gb|AEA82018.1| ABC transporter permease [Pseudomonas stutzeri DSM 4166]
          Length = 312

 Score = 70.9 bits (172), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 69/312 (22%), Positives = 138/312 (44%), Gaps = 36/312 (11%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRS------NQYDGPMAEVIIRIPGSVDGLST 54
           ME++ ++  +GLF V  +  +     WL +S      N Y+       I    +V GLS 
Sbjct: 1   METRAHHVLIGLFTVLAVGGALLFALWLGKSSMDREYNYYE-------ISFNRAVSGLSN 53

Query: 55  DSSVRFNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIEL 114
            SSV ++GI VG +  L+L+ + P    A+  +   TP+   T A +    + G   I+L
Sbjct: 54  GSSVEYSGIKVGDVEALWLEPDDPRKVRARIRVYAGTPIKQDTRARLALANITGSMIIQL 113

Query: 115 STLRKEKKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKII-ENIE 173
            +   +      +  +R +  +I A PS ++  + N E+    I++  R    ++ E+  
Sbjct: 114 HSGTPQSPP---LEGKRGEPPLIIADPSPLSALLENGEDLMTNINNLLRSANLMLSEDNA 170

Query: 174 KPLTTTIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMI-- 231
             +  T+AN+E  ++VLA     + + +  TQ+      + +    IT L  + + +I  
Sbjct: 171 GRIGRTLANLEQATSVLAEQRGDLSQAL--TQLGQLGQQTNSALAEITRLTQNANGLIDD 228

Query: 232 -------KAID--------LQKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQE 276
                  +A D          +++ +L + Q + NN ++    +   ++++R T    + 
Sbjct: 229 EGRQLLSRAGDSMAALERATSRLDTLLSDNQGALNNGLQGFSDLGPAINELRGTLGALRR 288

Query: 277 VGQKIDHLLSDF 288
           V Q+++   S F
Sbjct: 289 VTQRLEDNPSGF 300


>gi|254292868|ref|YP_003058891.1| hypothetical protein Hbal_0492 [Hirschia baltica ATCC 49814]
 gi|254041399|gb|ACT58194.1| Mammalian cell entry related domain protein [Hirschia baltica ATCC
           49814]
          Length = 314

 Score = 70.9 bits (172), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 71/313 (22%), Positives = 139/313 (44%), Gaps = 51/313 (16%)

Query: 1   MESKNYYTSVGLFVV-SILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVR 59
           ME++  Y  +G FV+ +++ F  F++ W+S+  Q+    +   +   G+V+GLS    VR
Sbjct: 1   METRANYGLIGAFVLMAMVAFVLFAV-WISKV-QFSKEFSVFDVVFEGAVNGLSEGGEVR 58

Query: 60  FNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRK 119
           FNGI VG +  L LD + PN+ +A+  +  +TP+   + A +   G+ G+T+I++     
Sbjct: 59  FNGIKVGEVTDLGLDAQDPNNVIARIRVDANTPVKSDSRAELGLLGITGMTFIQIKAGSP 118

Query: 120 EKKTI--------FQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIEN 171
           ++  +         +I T++ Q   I +   G+       E+++  +   SR  +   EN
Sbjct: 119 DEPLLNKGIRPYPPRIKTDKTQLDKIFSGGEGL------IESSTDALDRVSRMFRD--EN 170

Query: 172 IEKPLTTTIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNT-----------FNTI 220
           + + ++  +ANIE ++ V               Q    +  + N            F+  
Sbjct: 171 VTR-ISNILANIEDLTDVANGQNGIAADAQRAIQALEGAGIAMNDAAVAVDAASVQFDAN 229

Query: 221 TDLITSLDKMIKAIDLQKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQK 280
             L+T  D M+   D+Q              N VKS+D  + +V  V        E+   
Sbjct: 230 VALMTK-DTMLLLKDMQ--------------NVVKSADHAVGSVEGV-----VMDELAPS 269

Query: 281 IDHLLSDFSSKMK 293
            + ++S+ S+ ++
Sbjct: 270 AEEVMSELSTTLQ 282


>gi|39937296|ref|NP_949572.1| hypothetical protein RPA4236 [Rhodopseudomonas palustris CGA009]
 gi|39651154|emb|CAE29677.1| Mce4/Rv3499c/MTV023.06c protein [Rhodopseudomonas palustris CGA009]
          Length = 398

 Score = 70.5 bits (171), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 54/205 (26%), Positives = 91/205 (44%), Gaps = 16/205 (7%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++  +  VG FV++ +F  F  ++WL  ++   G      ++    V GL   ++V F
Sbjct: 1   METRAPFVIVGAFVLAAIFAVFGFVFWLHNTSGV-GARTSYHVQFRDPVPGLLVGAAVLF 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NGI VG +  L L  + P    A   + P TP+ P T   +  QGL G+  + L   ++ 
Sbjct: 60  NGIRVGEVTALALAPDDPRRVDATIAVAPSTPVRPDTKVGLDFQGLTGVPVVALEGGKQL 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
             +   IAT       + A P G    ++ A        ++ R +  ++     PL  TI
Sbjct: 120 SGS--AIAT------TLVAEP-GAGMSMTQAAR------EALRKVDSVLGENSGPLKDTI 164

Query: 181 ANIETISTVLANNISHIDKMMHTTQ 205
           AN +T S  LA     +D ++   +
Sbjct: 165 ANFKTFSEWLAGKTEKLDGILGGVE 189


>gi|114764123|ref|ZP_01443362.1| Putative ABC transporter, periplasmic substrate-binding protein
           [Pelagibaca bermudensis HTCC2601]
 gi|114543481|gb|EAU46496.1| Putative ABC transporter, periplasmic substrate-binding protein
           [Roseovarius sp. HTCC2601]
          Length = 579

 Score = 70.1 bits (170), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 89/451 (19%), Positives = 184/451 (40%), Gaps = 55/451 (12%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++  Y  +G F ++       +  W + + Q D   A   I  P +V GLS  S VRF
Sbjct: 1   METRANYVLIGAFTLAGFLAMLAAFMWFA-NIQLDRQFAYYDIDFP-TVSGLSDASDVRF 58

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           +G+PVG++V + L  E       +  I  DTP+   + ATI  QG+ G++Y+ +S    E
Sbjct: 59  SGLPVGQVVDVRLSPERDGTVRVRIEIGADTPVRADSVATIEAQGVTGVSYVGISAGTPE 118

Query: 121 KKTIFQIA------TERNQRAMITAT---PSGINYFISNAENTSKKISDSSR-HIQKIIE 170
              + +++       E  Q  + + T   P  ++  +   ++  +   D ++  +Q I++
Sbjct: 119 APLLSEVSDDDVPNIEAGQSVLQSLTEDAPLLVSETLRAVQDVRQLFGDENQAKVQSILD 178

Query: 171 NIEK---PLTTTIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSL 227
           NIE         + +   +   +A     ID+  +T  +   S D+  T   + + + S+
Sbjct: 179 NIEDSSVAFAQALDDFSAVGGSVATFADQIDRFNNT--LDSVSRDASATLADVREAVVSV 236

Query: 228 DKMIKAIDLQKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSD 287
             +      ++   +LE         ++ +D  I +    R  T       +++   ++D
Sbjct: 237 RDLS-----EEARGVLEQ----GGGTLERADSAIGSAE--RYVTDQLGPATEQLQRSVAD 285

Query: 288 FSSKMKSKETSA--FLENIADSTSNMRSSISAIREITDQRQKIISTIN-TIENITSN--- 341
             ++  +   SA   +E   ++       ++  RE      ++I++I  T+E++      
Sbjct: 286 IETRFAALSDSAGGLVETFTETGETATQRLTEARETLTATNEMIASIGATMESVDGAAQS 345

Query: 342 -----LNDSSQKFAELMSK-------INNISALKENNSLFKDAQRAMHTFRDTSEKINRY 389
                + D +   AEL          I  + A+ E      D    +   R  ++  +  
Sbjct: 346 VDTLIVGDGTALVAELREATAQATRVIEEVGAVAET-----DLPAIIADIRSATDTASGV 400

Query: 390 IPSIGNNLQNFSQSGLNDIQNLVRKLQETVN 420
           +  +G +L + S      + +L R   ET++
Sbjct: 401 VSRVGEDLSSAS----GQLDDLARNAGETLD 427


>gi|146305411|ref|YP_001185876.1| hypothetical protein Pmen_0371 [Pseudomonas mendocina ymp]
 gi|145573612|gb|ABP83144.1| Mammalian cell entry related domain protein [Pseudomonas mendocina
           ymp]
          Length = 305

 Score = 70.1 bits (170), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 63/300 (21%), Positives = 142/300 (47%), Gaps = 29/300 (9%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME + ++  +GLF V  +  +     WL+++   D    +  +    +V GLS  S+V++
Sbjct: 1   MEPRAHHVLIGLFTVLTVGAALLFALWLNKAG-ADRAFTDYEVIFNEAVSGLSQGSAVQY 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           +GI VG ++ L LD E P    A+  I   TP+   T A +   G+ G+  I+L +   E
Sbjct: 60  SGIKVGDVISLGLDPEDPRTVRARIRIAGHTPIKQDTRARLSITGITGLAVIQLYSGSPE 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAE----NTSKKISDSSRHIQKIIENIEKPL 176
                 +  +  Q  +I A  S ++  ++N E    N ++ ++ ++R + +  EN E+ +
Sbjct: 120 SPP---LEGKDGQPGIIIADRSPLSRLMANGEDLVSNITRLLNRANRMLSR--ENAER-V 173

Query: 177 TTTIANIETISTVLANNISHIDKMM-HTTQVTPHSSDSKNTFNTITD------------L 223
           + T+ N+E  +  +A+    +   +      T  +++   T N + D            L
Sbjct: 174 SRTLENLEQATAGIASQRDELSAALQQAGAATREAAELMRTANRLLDGQGSQALDNAERL 233

Query: 224 ITSLDKMIKAIDLQKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDH 283
           + SL++  ++I+     Q+LE+ + + ++ ++   ++   + ++R+T    +   ++++ 
Sbjct: 234 MASLERSSRSIE-----QLLESNRSALDSGMQGLGELGPAIGELRDTLSALRGFSRRLEQ 288


>gi|27381003|ref|NP_772532.1| hypothetical protein bll5892 [Bradyrhizobium japonicum USDA 110]
 gi|27354169|dbj|BAC51157.1| bll5892 [Bradyrhizobium japonicum USDA 110]
          Length = 292

 Score = 70.1 bits (170), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 62/280 (22%), Positives = 129/280 (46%), Gaps = 30/280 (10%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLS--RSNQYDGPMAEVIIRIPGSVDGLSTDSSV 58
           ME++  Y  +G F ++++  +   + W     + +   P+  V+   P +  GL    SV
Sbjct: 1   METRANYVLIGSFTLAVIAAAIGFVLWFQSLHTTKQRSPL-RVVFEGPAA--GLRNGGSV 57

Query: 59  RFNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLR 118
            FNGI VG +V + LD   P   +A A++  + P+   T   +  QGL G+  I   +L+
Sbjct: 58  NFNGIRVGEVVSVKLDN--PRRVVALAMVENNAPIRKDTLVGLEFQGLTGVAAI---SLK 112

Query: 119 KEKKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTT 178
             ++       + +    +TA P+ +       ++ ++ I  + ++I KI+ + ++ +  
Sbjct: 113 GGEEAAPPPPLDEDGIPSLTADPNKL-------QDVTEAIRGTLQNINKIVADNQESVKN 165

Query: 179 TIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQK 238
           ++ N+ET +  LA N   ID +M         +D         +L+  L+ +    D  +
Sbjct: 166 SLKNLETFTNSLARNSEKIDGVMAKVDGVMLKAD---------NLMLGLNTLAGGKDGGE 216

Query: 239 VNQILENIQVSSNNFVKSSDQVIN----TVHDVRETTQTF 274
           + Q +++I+  +++F K S  +I+    T+ D+      F
Sbjct: 217 LFQAVKSIRELADDFDKRSGLLISDGRRTLGDISRAVNNF 256



 Score = 38.9 bits (89), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 33/138 (23%), Positives = 71/138 (51%), Gaps = 11/138 (7%)

Query: 304 IADSTSNMRSSISAIREI-TDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNISAL 362
           + D T  +R ++  I +I  D ++ + +++  +E  T++L  +S+K   +M+K++ +  L
Sbjct: 138 LQDVTEAIRGTLQNINKIVADNQESVKNSLKNLETFTNSLARNSEKIDGVMAKVDGV-ML 196

Query: 363 KENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQ-SGLNDIQNLVRKLQETVNH 421
           K +N +       +   +D  E + + + SI     +F + SGL     L+   + T+  
Sbjct: 197 KADNLML--GLNTLAGGKDGGE-LFQAVKSIRELADDFDKRSGL-----LISDGRRTLGD 248

Query: 422 FDDCLNNFERNPQDIVWG 439
               +NNF+RNP  +++G
Sbjct: 249 ISRAVNNFDRNPTRVLFG 266


>gi|300114237|ref|YP_003760812.1| mammalian cell entry related domain-containing protein
           [Nitrosococcus watsonii C-113]
 gi|299540174|gb|ADJ28491.1| Mammalian cell entry related domain protein [Nitrosococcus watsonii
           C-113]
          Length = 295

 Score = 70.1 bits (170), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 69/252 (27%), Positives = 123/252 (48%), Gaps = 43/252 (17%)

Query: 1   MESKNYYTSVGLFVV----SILFFSFFSIYWLSRSNQ---YDGPMAEVIIRIPGSVDGLS 53
           ME + ++  +GLF +     IL FS     WL +S+    YD       IR   +V GL+
Sbjct: 1   MEPRAHHVLIGLFALLTLGGILLFSL----WLGKSSAERDYD----YYEIRFDQAVSGLA 52

Query: 54  TDSSVRFNGIPVGRIVGLFLDQEYPNHSLAKALIR--PDTPLYPSTTATIRTQGLAGITY 111
             ++V +NGI VG ++ L+LD E P+    +ALIR   D P+   T A++    + G   
Sbjct: 53  VGNAVLYNGIKVGDVMDLYLDPEDPSQ--VRALIRVYSDVPVKQDTRASLMLANITGGMS 110

Query: 112 IEL--STLRKEKKTIFQIATERNQRAMITATPSGINYFISNAE----------NTSKKI- 158
           I+L   TL+  +     + ++ NQ A+I A PS +  F++  E          N++ ++ 
Sbjct: 111 IQLHGGTLQSPR-----LISDPNQPAVIVAEPSPLRSFLAGGETLMVSLDRLLNSTNRLL 165

Query: 159 -SDSSRHIQKIIENIEKPLTTTIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTF 217
             ++   I++I+ +IE+ +TTT+A        LA  +++ ++      V      SK  F
Sbjct: 166 SPENLGRIERILVDIEQ-ITTTLA---AQRDELAQAMTNFNRAGQQANVLLEQQGSK-AF 220

Query: 218 NTITDLITSLDK 229
           N+    + +L++
Sbjct: 221 NSAQHAMAALER 232


>gi|217978938|ref|YP_002363085.1| Mammalian cell entry related domain protein [Methylocella
           silvestris BL2]
 gi|217504314|gb|ACK51723.1| Mammalian cell entry related domain protein [Methylocella
           silvestris BL2]
          Length = 357

 Score = 69.7 bits (169), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 70/314 (22%), Positives = 132/314 (42%), Gaps = 30/314 (9%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++  Y  +G F ++++  +F  + W S   +  G     ++   GSV GL   ++V F
Sbjct: 1   METRANYALIGGFTLAVVAAAFAFVLWFSGGEKAGGQHVYRVV-FTGSVSGLLRGAAVLF 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NG+ VG +  +    + P    A   I    P+   T A + T GL G+  + LS   ++
Sbjct: 60  NGVRVGGVTKIDFVPDSPGKVYALIEIDARVPIRVDTKARLETTGLTGVANVALSGGSED 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
            KT+            I A  S     I +A   + + ++      K+++     +T ++
Sbjct: 120 AKTLEP--GPDGAPPTIIAERSDFQDLIESARKIAGQATEFLDRTNKVLDENSGSITASV 177

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
            NIE  S  LA N                 SD       + D + S+  + +AI  + + 
Sbjct: 178 KNIEKFSDALAAN-----------------SDG------LKDFLGSMADVGRAI--KPLT 212

Query: 241 QILENIQVSSNNFVKSSD--QVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETS 298
             LE +  ++NN +K+ D  QV   V D  + +        K+D +L++ +  + + +  
Sbjct: 213 AQLETLADNANNVIKAVDPAQVKTIVSDFAQMSGKLNSAADKVDSVLTNLNGFLATGDNK 272

Query: 299 AFLENIADSTSNMR 312
              + IA +  ++R
Sbjct: 273 GVFDEIAAAARSIR 286



 Score = 68.2 bits (165), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 65/297 (21%), Positives = 128/297 (43%), Gaps = 33/297 (11%)

Query: 158 ISDSSRHIQKIIE-NIEKPL-TTTIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKN 215
           + DS   +  +IE +   P+   T A +ET       N++          + P    +  
Sbjct: 73  VPDSPGKVYALIEIDARVPIRVDTKARLETTGLTGVANVALSGGSEDAKTLEPGPDGAPP 132

Query: 216 TF----NTITDLITSLDKMIKAID--LQKVNQILE----NIQVSSNNFVKSSDQVINTVH 265
           T     +   DLI S  K+       L + N++L+    +I  S  N  K SD +     
Sbjct: 133 TIIAERSDFQDLIESARKIAGQATEFLDRTNKVLDENSGSITASVKNIEKFSDALAANSD 192

Query: 266 DVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNMRSSISAIREITDQR 325
            +++   +  +VG+ I             K  +A LE +AD+ +N+      I+ +   +
Sbjct: 193 GLKDFLGSMADVGRAI-------------KPLTAQLETLADNANNV------IKAVDPAQ 233

Query: 326 QKIISTINTIENITSNLNDSSQKFAELMSKINNISALKENNSLFKDAQRAMHTFRDTSEK 385
            K I  ++    ++  LN ++ K   +++ +N   A  +N  +F +   A  + R  ++ 
Sbjct: 234 VKTI--VSDFAQMSGKLNSAADKVDSVLTNLNGFLATGDNKGVFDEIAAAARSIRKLADD 291

Query: 386 INRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFERNPQDIVWGREK 442
           +N     IG NL  FS SGL   + L    ++T++  +  + + E+NPQ  ++G+++
Sbjct: 292 VNARWKDIGGNLARFSGSGLRQYEALATDGRKTLDLLNQAIRSIEQNPQQFIFGKKQ 348


>gi|119945390|ref|YP_943070.1| hypothetical protein Ping_1679 [Psychromonas ingrahamii 37]
 gi|119863994|gb|ABM03471.1| Mammalian cell entry related domain protein [Psychromonas
           ingrahamii 37]
          Length = 298

 Score = 69.7 bits (169), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 47/124 (37%), Positives = 68/124 (54%), Gaps = 9/124 (7%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSI-YWLSRSN---QYDGPMAEVIIRIPGSVDGLSTDS 56
           MESK  YT VGLFVV IL  +  SI +WL+R +    YD       + +  SV GL+TD+
Sbjct: 1   MESKINYTIVGLFVV-ILMTALLSITFWLTRQHGQQSYD----TYFVHLLESVAGLNTDA 55

Query: 57  SVRFNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELST 116
           +V++ G+ VG +V + L  + P        I  +T +   TTA +   G+ G+ YIEL  
Sbjct: 56  TVKYRGVDVGSVVRIGLKVDNPEVVELLIKINQNTAIKTDTTAALNFYGITGLAYIELEG 115

Query: 117 LRKE 120
           + KE
Sbjct: 116 IDKE 119


>gi|313108530|ref|ZP_07794531.1| ABC-type transporter, periplasmic component [Pseudomonas aeruginosa
           39016]
 gi|310881033|gb|EFQ39627.1| ABC-type transporter, periplasmic component [Pseudomonas aeruginosa
           39016]
          Length = 312

 Score = 69.3 bits (168), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 68/296 (22%), Positives = 134/296 (45%), Gaps = 29/296 (9%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRS------NQYDGPMAEVIIRIPGSVDGLST 54
           ME++ ++  +GLF V ++  +     WL++S      N YD       I    +V GLS 
Sbjct: 1   METRAHHVLIGLFSVIVIGAALLFGLWLAKSGSEGKFNYYD-------IVFNEAVSGLSQ 53

Query: 55  DSSVRFNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIEL 114
            SSV+++GI VG +  L LD + P    A+  +    P+   TTA +   G+ G + I+L
Sbjct: 54  GSSVQYSGIKVGDVAFLRLDPQDPRKVWARIRVVASAPIKQDTTAKLALTGITGTSIIQL 113

Query: 115 STLRKEKKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKII--ENI 172
           S+          +  +  +  +I ATPS +   +SN E+    I+        ++  EN 
Sbjct: 114 SSGTPASP---MLEGKDGKIPVIVATPSPLTQLLSNGEDLMGNINQLIARFSNLLSEENT 170

Query: 173 EKPLTTTIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIK 232
            + ++ T+ +++  +  L+    ++  +M   Q+   S  +       ++L+ S + ++ 
Sbjct: 171 AR-ISRTLDHLDQATGALSAERENVSAVMQ--QLAQASRQANAALAQASELMRSANGLLN 227

Query: 233 AIDLQKVNQILENIQVSSNNFVKSS---DQVIN-TVHDVRETTQTFQEVGQKIDHL 284
               ++   +LEN   +  +  ++S   DQ+I+   H +    Q   E+G  +  L
Sbjct: 228 ----EQGKGMLENANKTMASLERTSATLDQLISENRHSLDGGIQGLAELGPAVSEL 279



 Score = 42.0 bits (97), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 35/162 (21%), Positives = 76/162 (46%), Gaps = 9/162 (5%)

Query: 281 IDHLLSDFSSKMKSKETSAFLENIADSTSNMRSSISAIREITDQRQKIISTINTIENITS 340
           I+ L++ FS+ + S+E +A +    D       ++SA      +R+ + + +  +   + 
Sbjct: 154 INQLIARFSNLL-SEENTARISRTLDHLDQATGALSA------ERENVSAVMQQLAQASR 206

Query: 341 NLNDSSQKFAELMSKINNISALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNF 400
             N +  + +ELM   N +   ++   + ++A + M +   TS  +++ I    ++L   
Sbjct: 207 QANAALAQASELMRSANGLLN-EQGKGMLENANKTMASLERTSATLDQLISENRHSLDGG 265

Query: 401 SQSGLNDIQNLVRKLQETVNHFDDCLNNFERNPQDIVWGREK 442
            Q GL ++   V +L++T+          E NP + + GREK
Sbjct: 266 IQ-GLAELGPAVSELRDTLAALRGISRRLEENPANYLLGREK 306


>gi|192293076|ref|YP_001993681.1| mammalian cell entry related domain protein [Rhodopseudomonas
           palustris TIE-1]
 gi|192286825|gb|ACF03206.1| Mammalian cell entry related domain protein [Rhodopseudomonas
           palustris TIE-1]
          Length = 398

 Score = 69.3 bits (168), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 49/205 (23%), Positives = 90/205 (43%), Gaps = 16/205 (7%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++  +  VG FV++ +F  F  ++WL  ++   G      ++    V GL   ++V F
Sbjct: 1   METRAPFVIVGAFVLAAIFAVFGFVFWLHNTSGV-GARTSYHVQFRDPVPGLLVGAAVLF 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NGI VG +  L L  + P    A   + P TP+ P T   +  QGL G+  + L   +  
Sbjct: 60  NGIRVGEVTALALAPDDPRRVDATIAVAPSTPVRPDTKVGLDFQGLTGVPVVALEGGK-- 117

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
                Q++       +I    +G++         ++   ++ R +  ++     PL  TI
Sbjct: 118 -----QLSGSAIATTLIAEPGAGMSM--------TQAAREALRKVDSVLGENSGPLKDTI 164

Query: 181 ANIETISTVLANNISHIDKMMHTTQ 205
           +N +T S  LA     +D ++   +
Sbjct: 165 SNFKTFSEWLAGKTEKLDGILGGVE 189


>gi|307297003|ref|ZP_07576819.1| Mammalian cell entry related domain protein [Sphingobium
           chlorophenolicum L-1]
 gi|306877529|gb|EFN08757.1| Mammalian cell entry related domain protein [Sphingobium
           chlorophenolicum L-1]
          Length = 320

 Score = 69.3 bits (168), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 64/295 (21%), Positives = 127/295 (43%), Gaps = 46/295 (15%)

Query: 22  FFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRFNGIPVGRIVGLFLDQEYPNHS 81
             + +W SR +Q D    E  I    SV+GL+  SSV ++G+P G++  + L +  P+  
Sbjct: 22  MIAAFWFSRLSQGDN--MEYDIFFKQSVNGLAKGSSVNYSGVPSGQVEKIELWKRDPSFV 79

Query: 82  LAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKEKKTIF-----QIATERNQRAM 136
             +  ++  TP+   TTATI   G  G++ I L    K    I       +A+  +   +
Sbjct: 80  KVRISVKEGTPVLQGTTATIAGVGFTGVSEIVLDGAVKGAPPITCPAENPLASCPDGVPV 139

Query: 137 ITATPSGINYFISNAENTSKKISDSSRHIQKIIENI-EKPLTTTIANIETISTVLANNIS 195
           I   P  +   ++NA    +++S  +  + +++ +  ++ +   +AN+E +S  LA+   
Sbjct: 140 IPTKPGALGELLNNAPQLLERLSTLTERLTELLNDKNQQSIAGILANVERVSGALADRSP 199

Query: 196 HIDKMMHTTQVT---------------------------PHSSDSKNTFNTITDLITSLD 228
            I   +   ++                            P  +D + +  + T  I +LD
Sbjct: 200 EIAATLAEARIAVQRTGIAAEQIGKLAASTDAMVNDEGRPLLADLRKSIQSATRSIDTLD 259

Query: 229 KMIKAIDLQKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDH 283
           K I         +    ++  SN  +   +Q+   V D+RE +++F+ V +K+D 
Sbjct: 260 KTI--------GEAQPGVRAFSNQTMPEVNQL---VRDLREMSRSFRGVAEKLDQ 303


>gi|294010009|ref|YP_003543469.1| ABC-type transport system periplasmic component LinM [Sphingobium
           japonicum UT26S]
 gi|139001580|dbj|BAF51700.1| putative periplasmic protein [Sphingobium japonicum]
 gi|292673339|dbj|BAI94857.1| ABC-type transport system periplasmic component LinM [Sphingobium
           japonicum UT26S]
          Length = 320

 Score = 69.3 bits (168), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 65/295 (22%), Positives = 127/295 (43%), Gaps = 46/295 (15%)

Query: 22  FFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRFNGIPVGRIVGLFLDQEYPNHS 81
             + +W SR +Q D    E  I    SV+GL+  SSV ++G+P G++  + L +  P+  
Sbjct: 22  MIAAFWFSRLSQGDN--MEYDIFFKQSVNGLAKGSSVNYSGVPSGQVEKIELWKRDPSFV 79

Query: 82  LAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKEKKTIF-----QIATERNQRAM 136
             +  ++  TP+   TTATI   G  G++ I L    K    I       +A+  +   +
Sbjct: 80  KVRISVKEGTPVLQGTTATIAGVGFTGVSEIVLDGAVKGAPPIVCPAENPLASCPDGVPV 139

Query: 137 ITATPSGINYFISNAENTSKKISDSSRHIQKIIENI-EKPLTTTIANIETISTVLANNIS 195
           I   P  +   ++NA    +++S  +  + +++ +  ++ +   +AN+E IS  LA+   
Sbjct: 140 IPTKPGALGELLNNAPQLLERLSTLTERLTELLNDKNQQSIAGILANVERISGSLADRSP 199

Query: 196 HIDKMMHTTQVT---------------------------PHSSDSKNTFNTITDLITSLD 228
            I   +   ++                            P  +D + +  + T  I +LD
Sbjct: 200 EIAATLAEARIAVQRTGIAAEQIGKLAASTDAMVNDEGRPLLADLRKSIQSATRSIDTLD 259

Query: 229 KMIKAIDLQKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDH 283
           K I         +    ++  SN  +   +Q+   V D+RE +++F+ V +K+D 
Sbjct: 260 KTIA--------EAQPGVRAFSNQTMPEVNQL---VRDLREMSRSFRGVAEKLDQ 303


>gi|88810290|ref|ZP_01125547.1| hypothetical protein NB231_14458 [Nitrococcus mobilis Nb-231]
 gi|88791920|gb|EAR23030.1| hypothetical protein NB231_14458 [Nitrococcus mobilis Nb-231]
          Length = 304

 Score = 69.3 bits (168), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 71/324 (21%), Positives = 137/324 (42%), Gaps = 37/324 (11%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M SK  YT VGLFVV +      +  W +   ++ G   +  +   GSV GL+  + V +
Sbjct: 1   MGSKVSYTLVGLFVVLLTIGLVATGLWFAGGLKHTGQFRQYSVYTAGSVAGLTPGAQVTY 60

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            GI VG++V + +D   P+           TP+  +T A  + +GL G T +ELS     
Sbjct: 61  KGIGVGKVVRIAIDHRDPSRVHVVLAAARSTPINTATRAAFKPRGLTGATLVELSGYAAN 120

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTS-----KKISDSSRHIQKIIENIEKP 175
              +              + P G  Y +  ++N++     + +S+    + +I +  E+ 
Sbjct: 121 AAPL--------------SAPPGEPYPVIRSKNSALTQLDQALSEGIGTLNRIGKQFEEL 166

Query: 176 LT--------TTIANIETISTVLANNISHIDK-MMHTTQVTPHSSDSKNTFNTITDLITS 226
           L+        + +A+   +S+ LA N   I++ ++H  Q+T    +S      I   +  
Sbjct: 167 LSEHNRQAIASILADFARLSSTLATNSERIEQTLVHLDQIT---QNSAQITRHIPKTLGR 223

Query: 227 LDKMIKAIDLQKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLS 286
           LD+ ++ +D  ++++ L     +     +S +  + T   + E    F ++ +   HL  
Sbjct: 224 LDRSLQGLD--QLSRSLNQTATTLTGLGRSGETGLRTT--MPELKALFAQIRRTTSHL-- 277

Query: 287 DFSSKMKSKETSAFLENIADSTSN 310
           D   +   +E +A L       S 
Sbjct: 278 DRLIQKLEREPAALLRGTGRRPSG 301


>gi|26986885|ref|NP_742310.1| hypothetical protein PP_0140 [Pseudomonas putida KT2440]
 gi|24981488|gb|AAN65774.1|AE016203_7 conserved hypothetical protein [Pseudomonas putida KT2440]
 gi|313496511|gb|ADR57877.1| Hypothetical protein, conserved [Pseudomonas putida BIRD-1]
          Length = 312

 Score = 68.9 bits (167), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 63/304 (20%), Positives = 135/304 (44%), Gaps = 32/304 (10%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++ ++  +GL  V ++  +     WL++S+  D    +  +    +V GLS  S+V++
Sbjct: 1   METRAHHVLIGLVTVLVVTGAMLFGLWLAKSS-VDDAFKDYEVVFNEAVSGLSPGSTVQY 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NGI VG +  L LD + P   LA+  +  DTP+   T A +   G+ G ++I+LS    +
Sbjct: 60  NGIKVGDVSTLRLDPKDPRRVLARVRLSADTPVKEDTQAKLTLAGVTGNSFIQLSGGTPQ 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKIS------------DSSRHIQKI 168
                ++  +  +  +I A+PS I+  ++++ +    I+            D+  H+   
Sbjct: 120 SP---ELKGKDGKLPVIIASPSPISRLLNDSSDLVTNINMLLHNANQMFSEDNIGHLSNT 176

Query: 169 IENIEKPLTTTIANIETISTVLANNISHIDKMMHTTQVTPHS----------SDSKNTFN 218
           + N++K          +I+  +A  +  + K    T     +          S+ K    
Sbjct: 177 LANLDKTTGAFAGQHGSIAEAIA-QLVQVGKQASATLAETQALMRNANGLLDSEGKQAIG 235

Query: 219 TITDLITSLDKMIKAIDLQKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVG 278
           +    + SL +    I     N +L+N   +  +  +S +Q+   + ++RET    + + 
Sbjct: 236 SAEQAMQSLAQSTATI-----NNLLQNNSEAIGDGAQSLNQLAPAIRELRETLNALKGIS 290

Query: 279 QKID 282
           ++++
Sbjct: 291 RQLE 294



 Score = 36.6 bits (83), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 24/99 (24%), Positives = 46/99 (46%), Gaps = 3/99 (3%)

Query: 345 SSQKFAELMSKINNISAL--KENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQ 402
           +S   AE  + + N + L   E       A++AM +   ++  IN  + +    + + +Q
Sbjct: 208 ASATLAETQALMRNANGLLDSEGKQAIGSAEQAMQSLAQSTATINNLLQNNSEAIGDGAQ 267

Query: 403 SGLNDIQNLVRKLQETVNHFDDCLNNFERNPQDIVWGRE 441
           S LN +   +R+L+ET+N         E +P   + GR+
Sbjct: 268 S-LNQLAPAIRELRETLNALKGISRQLEADPSGYLLGRD 305


>gi|15598409|ref|NP_251903.1| hypothetical protein PA3213 [Pseudomonas aeruginosa PAO1]
 gi|107102743|ref|ZP_01366661.1| hypothetical protein PaerPA_01003810 [Pseudomonas aeruginosa PACS2]
 gi|116051203|ref|YP_789966.1| hypothetical protein PA14_22660 [Pseudomonas aeruginosa UCBPP-PA14]
 gi|218890594|ref|YP_002439458.1| ABC-type transporter, periplasmic component [Pseudomonas aeruginosa
           LESB58]
 gi|254236175|ref|ZP_04929498.1| hypothetical protein PACG_02140 [Pseudomonas aeruginosa C3719]
 gi|254241901|ref|ZP_04935223.1| hypothetical protein PA2G_02622 [Pseudomonas aeruginosa 2192]
 gi|9949333|gb|AAG06601.1|AE004744_16 hypothetical protein PA3213 [Pseudomonas aeruginosa PAO1]
 gi|115586424|gb|ABJ12439.1| ABC-type transporter, periplasmic component [Pseudomonas aeruginosa
           UCBPP-PA14]
 gi|126168106|gb|EAZ53617.1| hypothetical protein PACG_02140 [Pseudomonas aeruginosa C3719]
 gi|126195279|gb|EAZ59342.1| hypothetical protein PA2G_02622 [Pseudomonas aeruginosa 2192]
 gi|218770817|emb|CAW26582.1| ABC-type transporter, periplasmic component [Pseudomonas aeruginosa
           LESB58]
          Length = 312

 Score = 68.9 bits (167), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 68/296 (22%), Positives = 134/296 (45%), Gaps = 29/296 (9%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRS------NQYDGPMAEVIIRIPGSVDGLST 54
           ME++ ++  +GLF V ++  +     WL++S      N YD       I    +V GLS 
Sbjct: 1   METRAHHVLIGLFSVIVIGAALLFGLWLAKSGSEGKFNYYD-------IVFNEAVSGLSQ 53

Query: 55  DSSVRFNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIEL 114
            SSV+++GI VG +  L LD + P    A+  +    P+   TTA +   G+ G + I+L
Sbjct: 54  GSSVQYSGIKVGDVAFLRLDPKDPRKVWARIRVVASAPIKQDTTAKLALTGITGTSIIQL 113

Query: 115 STLRKEKKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKII--ENI 172
           S+          +  +  +  +I ATPS +   +SN E+    I+        ++  EN 
Sbjct: 114 SSGTPASP---MLEGKDGKIPVIVATPSPLTQLLSNGEDLMGNINQLIARFSNLLSEENT 170

Query: 173 EKPLTTTIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIK 232
            + ++ T+ +++  +  L+    ++  +M   Q+   S  +       ++L+ S + ++ 
Sbjct: 171 AR-ISRTLDHLDQATGALSAERENVSAVMQ--QLAQASRQANAALAQASELMRSANGLLN 227

Query: 233 AIDLQKVNQILENIQVSSNNFVKSS---DQVIN-TVHDVRETTQTFQEVGQKIDHL 284
               ++   +LEN   +  +  ++S   DQ+I+   H +    Q   E+G  +  L
Sbjct: 228 ----EQGKGMLENANKTMASLERTSATLDQLISENRHSLDGGIQGLAELGPAVSEL 279



 Score = 42.0 bits (97), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 35/162 (21%), Positives = 76/162 (46%), Gaps = 9/162 (5%)

Query: 281 IDHLLSDFSSKMKSKETSAFLENIADSTSNMRSSISAIREITDQRQKIISTINTIENITS 340
           I+ L++ FS+ + S+E +A +    D       ++SA      +R+ + + +  +   + 
Sbjct: 154 INQLIARFSNLL-SEENTARISRTLDHLDQATGALSA------ERENVSAVMQQLAQASR 206

Query: 341 NLNDSSQKFAELMSKINNISALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNF 400
             N +  + +ELM   N +   ++   + ++A + M +   TS  +++ I    ++L   
Sbjct: 207 QANAALAQASELMRSANGLLN-EQGKGMLENANKTMASLERTSATLDQLISENRHSLDGG 265

Query: 401 SQSGLNDIQNLVRKLQETVNHFDDCLNNFERNPQDIVWGREK 442
            Q GL ++   V +L++T+          E NP + + GREK
Sbjct: 266 IQ-GLAELGPAVSELRDTLAALRGISRRLEENPANYLLGREK 306


>gi|94309015|ref|YP_582225.1| hypothetical protein Rmet_0070 [Cupriavidus metallidurans CH34]
 gi|93352867|gb|ABF06956.1| ABC-type transporter, periplasmic component [Cupriavidus
           metallidurans CH34]
          Length = 313

 Score = 68.6 bits (166), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 69/306 (22%), Positives = 144/306 (47%), Gaps = 25/306 (8%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K+     G+F + +      S++W S  +    P  ++I R   +V+GL   + V++
Sbjct: 1   MENKSNAFLAGVFTIGLAILVSVSLFWFSSDHTVRVPY-DLITR--STVNGLGPQADVKY 57

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIEL-STLRK 119
            G+ VG+++ +  D + P   + +  I  DTP+  +T AT+  QG+ GI Y++L  + R 
Sbjct: 58  RGLEVGKVLSIKFDPQVPGQIIVRISINHDTPITRTTYATLGFQGVTGIAYVQLDDSERT 117

Query: 120 EKKTIF--QIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLT 177
           E  T    ++ T   + A I   P     F    E     +   +  +   ++++ +P  
Sbjct: 118 EGDTSSSPRLTTSAREPARIVMRPG----FFEELEKRGDSLLTQAETLMASLDSMFQPAN 173

Query: 178 --TTIANIETISTVLANNISHIDKMMH-TTQVTPHSSDSKN----TFNTITDLITSLDKM 230
               +A I  +    A++ SH+   +    +  P + D+ N    +   +TD I + D  
Sbjct: 174 RDELMAAIRAVHKT-ADDYSHLKSTLQPAAEKLPKAVDNLNAALVSTKRLTDEIGNPDGT 232

Query: 231 IKAIDLQKVNQILENIQVSSNNFVKSSDQVIN--TVHDVRETTQTFQEVGQKIDHLLSDF 288
           +    ++ VN++  ++QV++++ V+S+  ++N  T+  +    +  ++  + ID   S F
Sbjct: 233 V----MRTVNRVGNDLQVAADS-VQSTTTIVNQETLPQINGLARESRQAVRSIDRAASQF 287

Query: 289 SSKMKS 294
           + K  S
Sbjct: 288 NDKPSS 293


>gi|260425554|ref|ZP_05779534.1| ABC transporter substrate-binding protein [Citreicella sp. SE45]
 gi|260423494|gb|EEX16744.1| ABC transporter substrate-binding protein [Citreicella sp. SE45]
          Length = 301

 Score = 68.6 bits (166), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 60/234 (25%), Positives = 118/234 (50%), Gaps = 11/234 (4%)

Query: 1   MESKNYYTSVGLF-VVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVR 59
           ME++  Y  VG+F +V ++    F++ WL++  Q D   A+  I +  SV GL   S+VR
Sbjct: 1   METRARYLLVGVFTIVGLVAVMGFTL-WLAKV-QIDRTYAQYDI-VFDSVAGLGQASTVR 57

Query: 60  FNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRK 119
           +NG+ VG+++ + LD++ P     +  I   TP+   T AT+ +QG+ G++++ L+  R 
Sbjct: 58  YNGVEVGKVLSIALDRDDPALVRVRIEIYASTPVREDTLATLSSQGVTGVSFVALAGGRA 117

Query: 120 EKKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKII--ENIEKPLT 177
           + + I  +        +I + PS     +++A +   +     R I+     EN    +T
Sbjct: 118 DAEPIGVVPPA--DVPLIPSEPSAFQNLLTDAPDVLAEAILLMRDIRSFTTPEN-GAAIT 174

Query: 178 TTIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMI 231
             + N+ET +  +    +  + +M + +VT   +++  T   +  LI S D ++
Sbjct: 175 AILRNVETATARIDAMATRTESVMASAEVT--MANACATLVDLQALIASADGVL 226


>gi|152987511|ref|YP_001347294.1| hypothetical protein PSPA7_1913 [Pseudomonas aeruginosa PA7]
 gi|150962669|gb|ABR84694.1| hypothetical protein PSPA7_1913 [Pseudomonas aeruginosa PA7]
          Length = 312

 Score = 68.6 bits (166), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 74/331 (22%), Positives = 144/331 (43%), Gaps = 50/331 (15%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRS------NQYDGPMAEVIIRIPGSVDGLST 54
           ME++ ++  +GLF V ++  +     WL++S      N YD       I    +V GLS 
Sbjct: 1   METRAHHVLIGLFSVIVIGAALLFGLWLAKSGSEGKFNYYD-------IVFNEAVSGLSQ 53

Query: 55  DSSVRFNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIEL 114
            SSV+++GI VG +  L LD + P    A+  +    P+   TTA +   G+ G + I+L
Sbjct: 54  GSSVQYSGIKVGDVAFLRLDPQDPRKVWARIRVVASAPIKQDTTAKLALTGITGTSIIQL 113

Query: 115 STLRKEKKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEK 174
           S+          +  +  +  +I ATPS +   +SN E       D   +I ++I     
Sbjct: 114 SSGTPSSP---MLEGKDGKIPVIVATPSPLTQLLSNGE-------DLMGNINQLIARFSN 163

Query: 175 PLTTTIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAI 234
            L+      E  S  ++  + H+D      Q T   S  +   + +   +    K   A 
Sbjct: 164 LLS------EENSARISRTLDHLD------QATGALSAERENVSAVMQQLAQASKQANAA 211

Query: 235 DLQKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKS 294
            L + ++++ N    +N  +  ++Q    + +  +T  + +     +D L+S+    +  
Sbjct: 212 -LAQASELMRN----ANGLL--NEQGKGMLENASKTMASLERTSATLDQLISENRHSLDG 264

Query: 295 KETSAFLENIAD---STSNMRSSISAIREIT 322
                 ++ IA+   + S +R +++A+R I+
Sbjct: 265 G-----IQGIAELGPAVSELRDTLAALRGIS 290



 Score = 42.0 bits (97), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 35/162 (21%), Positives = 76/162 (46%), Gaps = 9/162 (5%)

Query: 281 IDHLLSDFSSKMKSKETSAFLENIADSTSNMRSSISAIREITDQRQKIISTINTIENITS 340
           I+ L++ FS+ + S+E SA +    D       ++SA      +R+ + + +  +   + 
Sbjct: 154 INQLIARFSNLL-SEENSARISRTLDHLDQATGALSA------ERENVSAVMQQLAQASK 206

Query: 341 NLNDSSQKFAELMSKINNISALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNF 400
             N +  + +ELM   N +   ++   + ++A + M +   TS  +++ I    ++L   
Sbjct: 207 QANAALAQASELMRNANGLLN-EQGKGMLENASKTMASLERTSATLDQLISENRHSLDGG 265

Query: 401 SQSGLNDIQNLVRKLQETVNHFDDCLNNFERNPQDIVWGREK 442
            Q G+ ++   V +L++T+          E NP + + GREK
Sbjct: 266 IQ-GIAELGPAVSELRDTLAALRGISRRLEENPANYLLGREK 306


>gi|86748753|ref|YP_485249.1| hypothetical protein RPB_1629 [Rhodopseudomonas palustris HaA2]
 gi|86571781|gb|ABD06338.1| Mammalian cell entry related [Rhodopseudomonas palustris HaA2]
          Length = 291

 Score = 68.6 bits (166), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 59/280 (21%), Positives = 125/280 (44%), Gaps = 30/280 (10%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLS--RSNQYDGPMAEVIIRIPGSVDGLSTDSSV 58
           ME++  Y  +G+F ++++  +F  + W     S +   P+  V     GS  GL    SV
Sbjct: 1   METRANYFLIGVFTLAVIAAAFGFVLWFQSLHSTKARSPLRVV---FEGSATGLRNGGSV 57

Query: 59  RFNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLR 118
            FNG+ VG ++ + LD   P   +A A++    P+   T   +  QGL G+  I   +L+
Sbjct: 58  NFNGVRVGEVISVKLDN--PKRVVALAMVENTAPIRKDTLVGLEFQGLTGVAAI---SLK 112

Query: 119 KEKKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTT 178
              +T   +  + +   ++TA P  +        + S+ +  + R++ K++    + +  
Sbjct: 113 GGMETAPPVPLDEDGVPVLTADPDLL-------MDISESVKATLRNVNKVVAENAETVKE 165

Query: 179 TIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQK 238
           +++N++  ++ LA +   ID +M         +DS         ++  +D +    D  +
Sbjct: 166 SLSNLQVFTSSLARSSDKIDSIMAKVDGVIGKTDS---------VMQGIDALAGGKDGGE 216

Query: 239 VNQILENIQVSSNNFVKSSDQVI----NTVHDVRETTQTF 274
           + Q +++ +  ++N  K S  +I     T+ D+      F
Sbjct: 217 LFQAVKSFRELADNLDKRSSALIIDGRRTLADISRAINNF 256


>gi|312958196|ref|ZP_07772719.1| ABC transport system substrate-binding protein [Pseudomonas
           fluorescens WH6]
 gi|311287627|gb|EFQ66185.1| ABC transport system substrate-binding protein [Pseudomonas
           fluorescens WH6]
          Length = 312

 Score = 68.6 bits (166), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 64/299 (21%), Positives = 145/299 (48%), Gaps = 22/299 (7%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++ ++  +GLF V ++  +     WL++S+  D    +  +    +V GLS  SSV++
Sbjct: 1   METRAHHVMIGLFSVIVVVGAMLFGLWLAKSS-VDSAFQDYEVIFNEAVSGLSQGSSVQY 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           +GI VG ++ L LD + P   LA+  +   TP+   T A +   G+ G + I+LS    +
Sbjct: 60  SGIKVGDVISLSLDPKDPRRVLARIRLAGQTPVKEDTQAKLALTGITGTSIIQLSGGTPQ 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKII--ENIEKPLTT 178
                 +  +      I A+PS I   ++++ +    I+    +   +   EN+++ ++ 
Sbjct: 120 SPA---LKGKDGNLPQIIASPSPIARLLNDSNDLMTGINLLLHNANAMFSSENVDR-ISK 175

Query: 179 TIANIETISTVLANNISHIDKMM-HTTQVTPHSSDS--------KNTFNTITD----LIT 225
           T+ N++  +  +A+    I  +M    QV+  +S +        +N    + D       
Sbjct: 176 TLDNLQQTTGAIADQRGDIKVVMQQLMQVSKQASAALEQTTLLMRNANGLLNDQGKQAFG 235

Query: 226 SLDKMIKAID--LQKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKID 282
           S ++ +K+++     +N +L + + S N+ ++  +++   V ++RET  + + + ++++
Sbjct: 236 SAEQAMKSLEHSTATLNTLLTDNKDSVNSGLQGLNELAPAVRELRETLGSLRAISRRLE 294



 Score = 38.5 bits (88), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 32/146 (21%), Positives = 65/146 (44%), Gaps = 13/146 (8%)

Query: 301 LENIADSTSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNIS 360
           ++ I+ +  N++ +  AI    DQR  I   +  +  ++   + + ++   LM   N + 
Sbjct: 170 VDRISKTLDNLQQTTGAI---ADQRGDIKVVMQQLMQVSKQASAALEQTTLLMRNANGLL 226

Query: 361 ALKENNSLFKDAQRAMHTFRDTSEKINRYIP----SIGNNLQNFSQSGLNDIQNLVRKLQ 416
              +    F  A++AM +   ++  +N  +     S+ + LQ     GLN++   VR+L+
Sbjct: 227 N-DQGKQAFGSAEQAMKSLEHSTATLNTLLTDNKDSVNSGLQ-----GLNELAPAVRELR 280

Query: 417 ETVNHFDDCLNNFERNPQDIVWGREK 442
           ET+          E NP   + G +K
Sbjct: 281 ETLGSLRAISRRLEANPSGYLLGSDK 306


>gi|296388300|ref|ZP_06877775.1| ABC-type transporter, periplasmic component [Pseudomonas aeruginosa
           PAb1]
          Length = 312

 Score = 68.6 bits (166), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 67/296 (22%), Positives = 134/296 (45%), Gaps = 29/296 (9%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRS------NQYDGPMAEVIIRIPGSVDGLST 54
           ME++ ++  +GLF V ++  +     WL++S      N YD       I    +V GLS 
Sbjct: 1   METRAHHVLIGLFSVIVIGAALLFGLWLAKSGSEGKFNYYD-------IVFNEAVSGLSQ 53

Query: 55  DSSVRFNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIEL 114
            SSV+++GI VG +  L LD + P    A+  +    P+   TTA +   G+ G + I+L
Sbjct: 54  GSSVQYSGIKVGDVAFLRLDPQDPRKVWARIRVVASAPIKQDTTAKLALTGITGTSIIQL 113

Query: 115 STLRKEKKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKII--ENI 172
           S+          +  +  +  +I ATPS +   +SN E+    I+        ++  EN 
Sbjct: 114 SSGTPASP---MLEGKDGKIPVIVATPSPLTQLLSNGEDLMGNINQLIARFSNLLSEENT 170

Query: 173 EKPLTTTIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIK 232
            + ++ T+ +++  +  L+    ++  +M   Q+   S  +       ++L+ S + ++ 
Sbjct: 171 AR-ISRTLDHLDQATGALSAERENVSAVMQ--QLAQASRQANAALAQASELMRSANGLLN 227

Query: 233 AIDLQKVNQILENIQVSSNNFVKSS---DQVIN-TVHDVRETTQTFQEVGQKIDHL 284
               ++   ++EN   +  +  ++S   DQ+I+   H +    Q   E+G  +  L
Sbjct: 228 ----EQGKGMMENANKTMASLERTSATLDQLISENRHSLDGGIQGLAELGPAVSEL 279



 Score = 41.6 bits (96), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 35/162 (21%), Positives = 76/162 (46%), Gaps = 9/162 (5%)

Query: 281 IDHLLSDFSSKMKSKETSAFLENIADSTSNMRSSISAIREITDQRQKIISTINTIENITS 340
           I+ L++ FS+ + S+E +A +    D       ++SA      +R+ + + +  +   + 
Sbjct: 154 INQLIARFSNLL-SEENTARISRTLDHLDQATGALSA------ERENVSAVMQQLAQASR 206

Query: 341 NLNDSSQKFAELMSKINNISALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNF 400
             N +  + +ELM   N +   ++   + ++A + M +   TS  +++ I    ++L   
Sbjct: 207 QANAALAQASELMRSANGLLN-EQGKGMMENANKTMASLERTSATLDQLISENRHSLDGG 265

Query: 401 SQSGLNDIQNLVRKLQETVNHFDDCLNNFERNPQDIVWGREK 442
            Q GL ++   V +L++T+          E NP + + GREK
Sbjct: 266 IQ-GLAELGPAVSELRDTLAALRGISRRLEENPANYLLGREK 306


>gi|94498320|ref|ZP_01304879.1| ABC transporter, periplasmic substrate-binding protein, putative
           [Sphingomonas sp. SKA58]
 gi|94422200|gb|EAT07242.1| ABC transporter, periplasmic substrate-binding protein, putative
           [Sphingomonas sp. SKA58]
          Length = 309

 Score = 68.6 bits (166), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 67/306 (21%), Positives = 124/306 (40%), Gaps = 41/306 (13%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME    Y  VG   +++L  +   + WL  S +  G  +  I+   G V GLS    V+F
Sbjct: 1   MERHANYALVGAASIALLIATLVFVVWLGGSAK--GSDSYQIV-FHGPVRGLSVGGEVQF 57

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NGI VG I G+ LDQ  PN  +    +   TP+   + A+  +QG++G++ +++S     
Sbjct: 58  NGIKVGEIGGIRLDQRDPNRVITDIELTRGTPVREDSVASSESQGISGVSIVQISAGTPS 117

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKI-----IENIEKP 175
           K  +     +  +R +I + P+ ++  +          +++   + K+     I NI   
Sbjct: 118 KPLLK--TNDHGKRPVIPSKPNAMSSLLQGGGQVVASATEALSRVNKVLSDRNIANIGGA 175

Query: 176 L------TTTIANIETISTVLANNISHIDKMMHTTQVTPHS------SDSKNTFNTITDL 223
           +      T  +A   T+     + ++ +D+     Q    S       D K  F  I+  
Sbjct: 176 IRDVRMTTAELAANRTMFAHAGSALAKLDRAADDIQGAASSVRQIADGDGKRAFADIS-- 233

Query: 224 ITSLDKMIKAIDLQKVNQILENIQVSSNNFVK----SSDQVINTVHDVRETTQTFQEVGQ 279
                        Q  N++   +  +     K    S+D    T+ ++  T  T QE  +
Sbjct: 234 -------------QAANELKSAVHEARGVIAKLDTQSADIGTTTIPNINATMLTLQETAE 280

Query: 280 KIDHLL 285
            +D L+
Sbjct: 281 SLDGLI 286


>gi|160872759|ref|ZP_02062891.1| ABC transport system periplasmic substrate binding protein
           [Rickettsiella grylli]
 gi|159121558|gb|EDP46896.1| ABC transport system periplasmic substrate binding protein
           [Rickettsiella grylli]
          Length = 265

 Score = 68.6 bits (166), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 71/268 (26%), Positives = 120/268 (44%), Gaps = 31/268 (11%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLS---RSNQYDGPMAEVIIRIPGSVDGLSTDSS 57
           M++K  YT VG FV+ +       I WLS    + +Y       ++ +  SV GL+ +S 
Sbjct: 1   MDTKVNYTLVGAFVLILTMTLVIFIVWLSTGISTKRYK----HFLVIMHESVSGLAVNSP 56

Query: 58  VRFNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTL 117
           V++NG+ VG +  ++L Q  P        I   TP+   TTAT+ +QGL GI Y+ L   
Sbjct: 57  VKYNGVVVGSVKKIYLTQNNPEQVRLLLQIEEHTPVTEGTTATLNSQGLTGIVYVALKGS 116

Query: 118 RKEKKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENI---EK 174
                 I ++  E+    +I +TPS    F    ++T + ++ +   I + I  I   E 
Sbjct: 117 DTHLNPIPRLHGEK--YPIIKSTPS----FFFRLDHTLRDLNHNMNQITEDINGILGGEN 170

Query: 175 P--LTTTIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIK 232
           P  L   + N+   S  LA      D ++  T      + S  +F        +L   + 
Sbjct: 171 PILLKKILNNLSITSQHLAAQSKCFDTILINT------ARSSRSF-------PALMNTLS 217

Query: 233 AIDLQKVNQILENIQVSSNNFVKSSDQV 260
              L   NQ+L N+ + ++N ++ SD +
Sbjct: 218 QQTLPSTNQVLNNLSLITDNLLELSDHL 245


>gi|33594881|ref|NP_882524.1| hypothetical protein BPP0163 [Bordetella parapertussis 12822]
 gi|33599156|ref|NP_886716.1| hypothetical protein BB0165 [Bordetella bronchiseptica RB50]
 gi|33564957|emb|CAE39904.1| putative exported protein [Bordetella parapertussis]
 gi|33575202|emb|CAE30665.1| putative exported protein [Bordetella bronchiseptica RB50]
          Length = 315

 Score = 68.6 bits (166), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 56/210 (26%), Positives = 96/210 (45%), Gaps = 11/210 (5%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++++    GLF +++L  +     W+ R      P    +I    SV GLS  S+VR+
Sbjct: 1   MENRSHALLAGLFTLALLVAAALVAIWVGRDRAALKPY---VIVSATSVSGLSAQSTVRY 57

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G+PVG++  L  + + P        + PDTP+  ST A +  QG+ G+  IE   LR +
Sbjct: 58  QGVPVGKVQSLGFNPDKPAQVRISIGVAPDTPITESTWAELGVQGVTGLGNIE---LRDD 114

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKII--ENIEKPLTT 178
             +  ++A+     A I   P     F          +   S  +++++  EN++   T 
Sbjct: 115 GTSTRRLASSAAMPATIPLRPGFFQRFEQRGGEILHNVEQVSARLERLLSNENVQA-TTA 173

Query: 179 TIANIETISTVLANNISHIDKMMHTTQVTP 208
           T+ NI  I+T L    + +   +   QV P
Sbjct: 174 TLQNIAAITTDLRQAATELRPAL--AQVPP 201


>gi|73539805|ref|YP_294325.1| hypothetical protein Reut_A0099 [Ralstonia eutropha JMP134]
 gi|72117218|gb|AAZ59481.1| Mammalian cell entry related [Ralstonia eutropha JMP134]
          Length = 313

 Score = 68.2 bits (165), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 34/121 (28%), Positives = 66/121 (54%), Gaps = 3/121 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K++    G+F + +     F+I+W S  +    P  +++ R   +V+GL   + V++
Sbjct: 2   MENKSHAFLAGVFTIGLAVLVLFAIFWFSSDHAVRVPY-DLVTR--STVNGLGPQADVKY 58

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G+ VG++V +  D + P   + +  +  DTP+  +T AT+  QG+ GI Y++L     E
Sbjct: 59  RGLEVGKVVSIRFDPQVPGQIIVRVNVNKDTPITRTTYATLGFQGVTGIAYVQLDDTAAE 118

Query: 121 K 121
           +
Sbjct: 119 E 119


>gi|299533749|ref|ZP_07047121.1| putative periplasmic protein [Comamonas testosteroni S44]
 gi|298718298|gb|EFI59283.1| putative periplasmic protein [Comamonas testosteroni S44]
          Length = 315

 Score = 68.2 bits (165), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 62/266 (23%), Positives = 124/266 (46%), Gaps = 30/266 (11%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSN-QYDGPMAEVIIRIPGSVDGLSTDSSVR 59
           ME+K++  + G+FV+ +         WL+R N +Y   + E+  +    V GL   ++VR
Sbjct: 1   MENKSHAMAAGIFVLVVATLLAGLAVWLTRDNREYQ--LYEMSTK--DGVSGLQPQATVR 56

Query: 60  FNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRK 119
           + G+PVG++V +  D +   + L +  +  DTP+ P+T A +  QG+ G+ +I+L    K
Sbjct: 57  YKGVPVGKVVRIGFDPQISGNVLIRIAVGEDTPVTPATYAQLGYQGVTGLAHIQLDDDSK 116

Query: 120 EKKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKII-ENIEKPLTT 178
             + + +       R  + ++P  +N          +++ + SR +  ++ E+ +K ++ 
Sbjct: 117 SSQPL-KPGPSGLPRLPMKSSP--LNMLADQGPVLLERVDEISRRLNSMLGEDNQKRVSV 173

Query: 179 TIANIETISTVLANNISHIDKMMHTT-----QVTPHSSDSKNTF-------NTITDLITS 226
            + NI   S      I  + + M+ T     Q+T   +D+  T        N  T + T 
Sbjct: 174 ALDNIAAAS----GGIKDLAETMNKTAKDFPQIT---ADAHQTLQSLTKAGNAATGVATD 226

Query: 227 LDKMIKAIDLQ--KVNQILENIQVSS 250
           L + ++ ++     + QI E  Q  S
Sbjct: 227 LQQTVRKVNAPDGPLQQIAEGTQALS 252


>gi|264676424|ref|YP_003276330.1| periplasmic protein [Comamonas testosteroni CNB-2]
 gi|262206936|gb|ACY31034.1| putative periplasmic protein [Comamonas testosteroni CNB-2]
          Length = 315

 Score = 68.2 bits (165), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 62/266 (23%), Positives = 124/266 (46%), Gaps = 30/266 (11%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSN-QYDGPMAEVIIRIPGSVDGLSTDSSVR 59
           ME+K++  + G+FV+ +         WL+R N +Y   + E+  +    V GL   ++VR
Sbjct: 1   MENKSHAMAAGIFVLVVATLLAGLAVWLTRDNREYQ--LYEMSTK--DGVSGLQPQATVR 56

Query: 60  FNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRK 119
           + G+PVG++V +  D +   + L +  +  DTP+ P+T A +  QG+ G+ +I+L    K
Sbjct: 57  YKGVPVGKVVRIGFDPQISGNVLIRIAVGEDTPVTPATYAQLGYQGVTGLAHIQLDDDSK 116

Query: 120 EKKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKII-ENIEKPLTT 178
             + + +       R  + ++P  +N          +++ + SR +  ++ E+ +K ++ 
Sbjct: 117 SSQPL-KPGPSGLPRLPMKSSP--LNMLADQGPVLLERVDEISRRLNSMLGEDNQKRVSV 173

Query: 179 TIANIETISTVLANNISHIDKMMHTT-----QVTPHSSDSKNTF-------NTITDLITS 226
            + NI   S      I  + + M+ T     Q+T   +D+  T        N  T + T 
Sbjct: 174 ALDNIAAAS----GGIKDLAETMNKTAKDFPQIT---ADAHQTLQSLTKAGNAATGVATD 226

Query: 227 LDKMIKAIDLQ--KVNQILENIQVSS 250
           L + ++ ++     + QI E  Q  S
Sbjct: 227 LQQTVRKVNAPDGPLQQIAEGTQALS 252


>gi|157164450|ref|YP_001466750.1| mce related protein [Campylobacter concisus 13826]
 gi|112799979|gb|EAT97323.1| putative ABC transport system periplasmic substrate-binding protein
           [Campylobacter concisus 13826]
          Length = 313

 Score = 67.8 bits (164), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 63/242 (26%), Positives = 115/242 (47%), Gaps = 20/242 (8%)

Query: 1   MESKNYYTSVGLFVVSIL-FFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVR 59
           ME++N YT VG+F ++ L  F+ F I+W++  N       E  I       GL  DS+V+
Sbjct: 1   MENRNSYTIVGMFFIACLTAFAIF-IWWMTSKNNTKVDFKEYYIHTTELPSGLKVDSTVK 59

Query: 60  FNGIPVGRIVGL-FLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLR 118
           F G+P G +  + F+D +    ++    IR D P+   + A+I  Q ++G+  I +S   
Sbjct: 60  FIGVPAGSVSDINFVDDKNALINITMK-IREDLPIKADSIASIEVQAISGVASINISRGT 118

Query: 119 KEKKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKII--ENIEKPL 176
           K+ K           + ++    S ++   +NAEN + KI+ +   +      ENI   +
Sbjct: 119 KDFKP--------GDKPILKLEESLLSKLGNNAENITLKINQTLDKVDGFFSAENISH-I 169

Query: 177 TTTIANIETISTVLA--NNISHIDKMMHTTQVTPHS---SDSKNTFNTITDLITSLDKMI 231
            + + NI+  + VL   N +S +D ++   +    S   +D+K     +  LI S + + 
Sbjct: 170 ESILRNIDKFTQVLTDENGLSEVDSIVKNVKNFTDSLNKTDTKELAKNLNTLIASANSVF 229

Query: 232 KA 233
           K+
Sbjct: 230 KS 231


>gi|254449438|ref|ZP_05062875.1| mammalian cell entry related domain protein [Octadecabacter
           antarcticus 238]
 gi|198263844|gb|EDY88114.1| mammalian cell entry related domain protein [Octadecabacter
           antarcticus 238]
          Length = 579

 Score = 67.8 bits (164), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 53/199 (26%), Positives = 97/199 (48%), Gaps = 12/199 (6%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++  +  +GLF ++ +  S   + W +R  + D   A   +R   SV GLS  S VRF
Sbjct: 1   METRANHILIGLFTLAGIVGSIALLLWFARV-ELDQQFAYYDVRF-SSVSGLSEASDVRF 58

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G+PVG++V + L  +     L +  +   TP+   + ATI +QG+ G++++ +S  R +
Sbjct: 59  AGLPVGQVVDVRLSPDRDGTVLVRLEVDASTPVRSDSIATIESQGVTGVSFVGISAGRPD 118

Query: 121 KKTIF--------QI-ATERNQRAMITATPSGINYFISNAENTSKKIS-DSSRHIQKIIE 170
              +         QI A +   +A+    P  IN  ++  E  S   + D+   ++ I++
Sbjct: 119 TGLLVPTSDTPVPQITAGQSVLQALSEDAPQLINEALTVIEGVSDLFAEDNQARVENILK 178

Query: 171 NIEKPLTTTIANIETISTV 189
           N E+   +  A +E  + V
Sbjct: 179 NAEEASESLAATLEAFAEV 197


>gi|154175509|ref|YP_001408230.1| hypothetical protein CCV52592_1435 [Campylobacter curvus 525.92]
 gi|112802187|gb|EAT99531.1| conserved domain protein [Campylobacter curvus 525.92]
          Length = 313

 Score = 67.8 bits (164), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 54/207 (26%), Positives = 103/207 (49%), Gaps = 16/207 (7%)

Query: 1   MESKNYYTSVGLFVVSIL-FFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVR 59
           ME++N YT VG+F +  +  F+ F I+W++  +          I       GL  DS V+
Sbjct: 1   MENRNSYTIVGMFFIFCMSAFAVF-IWWMTNHDDSKLQYKNYYIHTSELPSGLKVDSQVK 59

Query: 60  FNGIPVGRIVGLFLDQEYPNHSLAKAL-IRPDTPLYPSTTATIRTQGLAGITYIELSTLR 118
           F G+P G +  +   ++  N  +   + IR D P+   + A+I TQ ++G+  I +S  +
Sbjct: 60  FIGVPAGTVSKIDFVKDDKNALIEITMKIRDDVPIRKDSVASIETQAISGVASINISRGK 119

Query: 119 KEKKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKII--ENIEKPL 176
           +E          + +R ++    S ++   +NA+N ++K++ +   I      ENIE  L
Sbjct: 120 EE--------FAKGERPILRLEQSLLSKLGTNAQNITEKLNQTLTKIDGFFSPENIEH-L 170

Query: 177 TTTIANIETISTVLA--NNISHIDKMM 201
              +ANI+  + VL   + +S +D+++
Sbjct: 171 NMILANIDKFTGVLTDEDGLSKVDQIV 197


>gi|148545415|ref|YP_001265517.1| hypothetical protein Pput_0158 [Pseudomonas putida F1]
 gi|148509473|gb|ABQ76333.1| Mammalian cell entry related domain protein [Pseudomonas putida F1]
          Length = 312

 Score = 67.8 bits (164), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 64/305 (20%), Positives = 137/305 (44%), Gaps = 34/305 (11%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++ ++  +GL  V ++  +     WL++S+  D    +  +    +V GLS  S+V++
Sbjct: 1   METRAHHVLIGLVTVLVVAGAMLFGLWLAKSS-VDDAFKDYEVVFNEAVSGLSRGSTVQY 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NGI VG +  L LD + P   LA+  +  DTP+   T A +   G+ G ++I+LS    +
Sbjct: 60  NGIKVGDVSTLRLDPKDPRRVLARVRLSADTPVKEDTQAKLTLAGVTGNSFIQLSGGTPQ 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEK------ 174
                ++  +  +  +I A+PS I+  ++++       SD   +I  ++ N  +      
Sbjct: 120 SP---ELKGKDGKLPVIIASPSPISRLLNDS-------SDLVTNINMLLHNANQMFSEDN 169

Query: 175 --PLTTTIANIETISTVLANNISHIDKMMH-----TTQVTPHSSDSKNTFNTITDLITSL 227
              L+ T+AN++  +   A     I + +        Q +   ++++        L+ S 
Sbjct: 170 IGHLSNTLANLDKTTGAFAGQHGSIAEAIEQLVKVGNQASATLAETQALMRNANGLLGSE 229

Query: 228 DKMIKAIDLQK----------VNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEV 277
            K       Q           +N +L+N   +  +  +S +Q+   + ++RET    + +
Sbjct: 230 GKQAIGSAEQAMQSLAQSTATINNLLQNNSEAIGDGAQSLNQLAPAIRELRETLNALKGI 289

Query: 278 GQKID 282
            ++++
Sbjct: 290 SRQLE 294



 Score = 39.7 bits (91), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 28/114 (24%), Positives = 51/114 (44%), Gaps = 3/114 (2%)

Query: 330 STINTIENITSNLNDSSQKFAELMSKINNISAL--KENNSLFKDAQRAMHTFRDTSEKIN 387
           S    IE +    N +S   AE  + + N + L   E       A++AM +   ++  IN
Sbjct: 193 SIAEAIEQLVKVGNQASATLAETQALMRNANGLLGSEGKQAIGSAEQAMQSLAQSTATIN 252

Query: 388 RYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFERNPQDIVWGRE 441
             + +    + + +QS LN +   +R+L+ET+N         E +P   + GR+
Sbjct: 253 NLLQNNSEAIGDGAQS-LNQLAPAIRELRETLNALKGISRQLEADPSGYLLGRD 305


>gi|49085066|gb|AAT51249.1| PA3213 [synthetic construct]
          Length = 313

 Score = 67.4 bits (163), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 68/296 (22%), Positives = 134/296 (45%), Gaps = 29/296 (9%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRS------NQYDGPMAEVIIRIPGSVDGLST 54
           ME++ ++  +GLF V ++  +     WL++S      N YD       I    +V GLS 
Sbjct: 1   METRAHHVLIGLFSVIVIGAALLFGLWLAKSGSEGKFNYYD-------IVFNEAVSGLSQ 53

Query: 55  DSSVRFNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIEL 114
            SSV+++GI VG +  L LD + P    A+  +    P+   TTA +   G+ G + I+L
Sbjct: 54  GSSVQYSGIKVGDVAFLRLDPKDPRKVWARIRVVASAPIKQDTTAKLALTGITGTSIIQL 113

Query: 115 STLRKEKKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKII--ENI 172
           S+          +  +  +  +I ATPS +   +SN E+    I+        ++  EN 
Sbjct: 114 SSGTPASP---MLEGKDGKIPVIVATPSPLTQSLSNGEDLMGNINQLIARFSNLLSEENT 170

Query: 173 EKPLTTTIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIK 232
            + ++ T+ +++  +  L+    ++  +M   Q+   S  +       ++L+ S + ++ 
Sbjct: 171 AR-ISRTLDHLDQATGALSAERENVSAVMQ--QLAQASRQANAALAQASELMRSANGLLN 227

Query: 233 AIDLQKVNQILENIQVSSNNFVKSS---DQVIN-TVHDVRETTQTFQEVGQKIDHL 284
               ++   +LEN   +  +  ++S   DQ+I+   H +    Q   E+G  +  L
Sbjct: 228 ----EQGKGMLENANKTMASLERTSATLDQLISENRHSLDGGIQGLAELGPAVSEL 279



 Score = 42.0 bits (97), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 35/162 (21%), Positives = 76/162 (46%), Gaps = 9/162 (5%)

Query: 281 IDHLLSDFSSKMKSKETSAFLENIADSTSNMRSSISAIREITDQRQKIISTINTIENITS 340
           I+ L++ FS+ + S+E +A +    D       ++SA      +R+ + + +  +   + 
Sbjct: 154 INQLIARFSNLL-SEENTARISRTLDHLDQATGALSA------ERENVSAVMQQLAQASR 206

Query: 341 NLNDSSQKFAELMSKINNISALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNF 400
             N +  + +ELM   N +   ++   + ++A + M +   TS  +++ I    ++L   
Sbjct: 207 QANAALAQASELMRSANGLLN-EQGKGMLENANKTMASLERTSATLDQLISENRHSLDGG 265

Query: 401 SQSGLNDIQNLVRKLQETVNHFDDCLNNFERNPQDIVWGREK 442
            Q GL ++   V +L++T+          E NP + + GREK
Sbjct: 266 IQ-GLAELGPAVSELRDTLAALRGISRRLEENPANYLLGREK 306


>gi|285019445|ref|YP_003377156.1| ABC transporter substrate-binding protein [Xanthomonas albilineans
           GPE PC73]
 gi|283474663|emb|CBA17162.1| putative abc transporter substrate-binding protein [Xanthomonas
           albilineans]
          Length = 308

 Score = 67.4 bits (163), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 80/332 (24%), Positives = 139/332 (41%), Gaps = 47/332 (14%)

Query: 1   MESKNYYTSVGLF-VVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVR 59
           ME+K  Y  +G F +V+ +    F ++    S+        V+ R   +V GLS  S V+
Sbjct: 1   METKANYVLIGAFTIVTGIALLLFGLWAAKYSSDRTWQEYRVVFR--EAVTGLSVGSPVQ 58

Query: 60  FNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRK 119
           +NGI VG I  L L    P   +A+  +   TP+   T A +    L G T I+LS    
Sbjct: 59  YNGIAVGSITELTLAPNDPRQVVARIRVNSTTPIKSDTRANLGITSLTGPTIIQLSGGAP 118

Query: 120 EKKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEK----P 175
           E   +  I  + +   +I  TPS +     N  +T+ +I      ++++ E + K     
Sbjct: 119 EAPKLTAI--DNSDAPIIQTTPSALQ----NITDTANQI------VERLDELLSKSNVAS 166

Query: 176 LTTTIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAID 235
           +T T+ N+E IS  LA+  + +  ++ + +      D+  T NT    I  LD+      
Sbjct: 167 ITATLHNLEKISGALADRDNGVQSLILSARDATRHLDA--TLNTANGTIQHLDQ------ 218

Query: 236 LQKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSK 295
                           N VK    ++N + D   T           D +L +  S + S 
Sbjct: 219 ----------------NLVKQLPPLLNKLED---TLSKLDSAAGNADKILGENRSAINSF 259

Query: 296 ETSAFLENIADSTSNMRSSISAIREITDQRQK 327
                L  +  + + +RS I  +R+++D+ +K
Sbjct: 260 ANDG-LGQLGPTLTELRSLIRDLRQVSDRLEK 290


>gi|217970676|ref|YP_002355910.1| hypothetical protein Tmz1t_2275 [Thauera sp. MZ1T]
 gi|217508003|gb|ACK55014.1| Mammalian cell entry related domain protein [Thauera sp. MZ1T]
          Length = 305

 Score = 67.4 bits (163), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 34/114 (29%), Positives = 60/114 (52%), Gaps = 3/114 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++ +  + GLF + +     F+I+W S       PM E+++   G ++GL   S VR+
Sbjct: 1   MENRAHALAAGLFAILLGAGVVFAIWWFSGQRV---PMREIVLEARGDINGLGAQSRVRY 57

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIEL 114
            G+ VG +  + +D E     L +  +  D PL   TTA + T G+ G+ +++L
Sbjct: 58  RGMAVGSVRAVAIDPEDLRTLLVRIAVPADLPLTRGTTAALGTLGVTGLAFVQL 111


>gi|260219763|emb|CBA26619.1| hypothetical protein Csp_H39510 [Curvibacter putative symbiont of
           Hydra magnipapillata]
          Length = 335

 Score = 67.4 bits (163), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 74/337 (21%), Positives = 144/337 (42%), Gaps = 35/337 (10%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVI-IRIPGSVDGLSTDSSVR 59
           ME+K++  + G FV+ +L        WL+R    D     V  I  P  V GL + ++VR
Sbjct: 1   MENKSHAFAAGAFVLVLLALMTALAVWLTR----DTTEQRVFEISSPEGVTGLQSQAAVR 56

Query: 60  FNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRK 119
           + G+ VGR+  + LD     + L +  +    P+  ST A +  QG+ G+ +I+L    K
Sbjct: 57  YKGVLVGRVTEIALDPVQRGNVLLRIAVNETAPITKSTFAALGFQGVTGLAFIQLDD--K 114

Query: 120 EKKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIE-NIEKPLTT 178
           E+ +   +A + +    I   PS ++       N   ++  +S  +  ++  + +K L  
Sbjct: 115 EEGSAALVA-QGDAVPRIPMRPSMVSRLSEQGGNLLTQLEQASIRMNSLLATDNQKQLMG 173

Query: 179 TIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQK 238
            I N+       A NIS + +          + D+ N           L +M++  D+  
Sbjct: 174 AIGNLSQA----AANISALTQRAGAVLGAEGAPDAVN-----------LPRMVQQADV-- 216

Query: 239 VNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHL------LSDFSSKM 292
               L+++Q ++     S++ V N+  + R T +   E G  +D +      L+  S ++
Sbjct: 217 ---TLKSMQSTAERLSTSAEAVRNSADEFRRTNRRLNEPGGTLDKIAQSTEALATTSRQV 273

Query: 293 KSKETSAFLENIADSTSNMRSSISAIREITDQRQKII 329
           +S+        + D+   +R    A   + D  Q ++
Sbjct: 274 QSQLLPRLNRTVEDTGRTVRQVGRAAETLGDNPQSVL 310


>gi|30249903|ref|NP_841973.1| mce related protein [Nitrosomonas europaea ATCC 19718]
 gi|30180940|emb|CAD85866.1| mce related protein [Nitrosomonas europaea ATCC 19718]
          Length = 301

 Score = 67.4 bits (163), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 64/296 (21%), Positives = 137/296 (46%), Gaps = 39/296 (13%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRS----NQYDGPMAEVIIRIPGSVDGLSTDS 56
           ME++ +  + GLF++ +   +  ++ W SR     N Y       ++   G+V GL+ ++
Sbjct: 1   MENRAHALAAGLFILLLGVATVMAVKWFSRDSVSYNHY------FLVSAGGAVSGLNPEA 54

Query: 57  SVRFNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELS- 115
           SVR+ G+ VG++  ++ D+E   + + +  +  +  L     A + +QG+ G+TYIEL+ 
Sbjct: 55  SVRYRGVNVGKVEEIYFDRENIRNIIVRIAVNHNVVLPGDIYAQLASQGITGLTYIELND 114

Query: 116 -TLRKEKKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISD-----SSRHIQKII 169
                E K +   A    + ++I      +   + N+    ++IS+     +  HI  I+
Sbjct: 115 DVADAETKPLQNEARIPLRSSLIKTLSDSLEEILKNSNMAIRQISNLLNEQNQTHISSIL 174

Query: 170 ENIEKPLTTTIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDK 229
            ++E+     + + +T++  L   +  + ++         SS+  +TF     ++ +  +
Sbjct: 175 SHLEQ----AVQHYDTLTGQLQKGLQTLPQL---------SSELTSTFKQTRQVMENTSQ 221

Query: 230 MIKAIDLQKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLL 285
           +     LQK+NQ     Q   +N  + S ++  T+  + ET     +   K+D LL
Sbjct: 222 V-----LQKLNQ----QQGLVDNLTQGSLEMTRTLTSLNETGVAITQSAHKLDQLL 268


>gi|325273984|ref|ZP_08140143.1| hypothetical protein G1E_12677 [Pseudomonas sp. TJI-51]
 gi|324100873|gb|EGB98560.1| hypothetical protein G1E_12677 [Pseudomonas sp. TJI-51]
          Length = 312

 Score = 67.0 bits (162), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 79/358 (22%), Positives = 153/358 (42%), Gaps = 51/358 (14%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++ ++  +GL  V ++  +     WL++S+  D    +  +    +V GLS  S V++
Sbjct: 1   METRAHHVLIGLVTVLVVAGAMLFGLWLTKSS-VDDAFKDYEVVFNEAVSGLSRGSPVQY 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NGI VG +  L LD + P   LA+  +  DTP+   T A +   G+ G ++I+LS    +
Sbjct: 60  NGIKVGDVSTLRLDPKDPRRVLARVRLSGDTPVKEDTQAKLTLAGVTGNSFIQLSGGTPQ 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
                ++  +  +  +I A+PS I+  ++++       SD   +I  ++ N  +  +   
Sbjct: 120 SP---ELKGKDGKLPVIIASPSPISRLLNDS-------SDLVTNINLLLHNANQMFSE-- 167

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
            NI+ +S  LAN    +DK       T   +    + +   + +  + K   A  L +  
Sbjct: 168 GNIDHLSNTLAN----LDK------TTGAFAGEHGSISQAIEQLVQVGKQASAT-LAETQ 216

Query: 241 QILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAF 300
            ++ N    +N  + +  +    +    +  Q+  +    I+ LL D S           
Sbjct: 217 VLMRN----ANGLLGTEGK--QAIGSAEQAMQSLAQSTATINSLLKDNS----------- 259

Query: 301 LENIADSTSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINN 358
            E I D    +     AIRE+ +       T+N ++ I+  L      +  L+ + NN
Sbjct: 260 -EAIGDGAQGLNQLTPAIRELRE-------TLNALKGISRQLEADPSGY--LLGRDNN 307



 Score = 37.7 bits (86), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 28/114 (24%), Positives = 48/114 (42%), Gaps = 11/114 (9%)

Query: 334 TIENITSNLNDSSQKFAELMSKINNISAL--KENNSLFKDAQRAMHTFRDTSEKINRYIP 391
            IE +      +S   AE    + N + L   E       A++AM +   ++  IN  + 
Sbjct: 197 AIEQLVQVGKQASATLAETQVLMRNANGLLGTEGKQAIGSAEQAMQSLAQSTATINSLLK 256

Query: 392 ----SIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFERNPQDIVWGRE 441
               +IG+  Q     GLN +   +R+L+ET+N         E +P   + GR+
Sbjct: 257 DNSEAIGDGAQ-----GLNQLTPAIRELRETLNALKGISRQLEADPSGYLLGRD 305


>gi|299131821|ref|ZP_07025016.1| Mammalian cell entry related domain protein [Afipia sp. 1NLS2]
 gi|298591958|gb|EFI52158.1| Mammalian cell entry related domain protein [Afipia sp. 1NLS2]
          Length = 289

 Score = 66.6 bits (161), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 61/275 (22%), Positives = 119/275 (43%), Gaps = 30/275 (10%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAE---VIIRIPGSVDGLSTDSS 57
           ME++  Y  +G F ++++  +F  ++W     Q  G +A+   + I   G+  GL T  +
Sbjct: 1   METRANYLLIGAFTLAVIAAAFGFVFWF----QNLGSVAQRSPIRIVFEGAASGLRTGGN 56

Query: 58  VRFNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTL 117
           V FNGI +G +  + LD   P   +  A +    P+   T   +   GL G++ + L   
Sbjct: 57  VNFNGIKIGEVTSIKLDD--PKRVVVIASVDKSAPIRADTLVGLEFAGLTGVSAVSLKGG 114

Query: 118 RKEKKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLT 177
             E      I    +    +TA P+ I        +  + +  + +++ K++ + +  L 
Sbjct: 115 SLEAG---GIPVADDGVPTLTADPNAI-------MDIGEAVRATLQNVNKLVTDNQAALH 164

Query: 178 TTIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKN-----TFNTITDLITSLDKMIK 232
            ++ N++T S  LA+N S ID +M          D +         +  +L  +LDK   
Sbjct: 165 DSMENLKTFSKALADNSSRIDSIMVGVDSLMGGKDGEGGELQKAARSFRELADNLDKRTA 224

Query: 233 AID------LQKVNQILENIQVSSNNFVKSSDQVI 261
           A+       +    + L +I  + NNF ++  +V+
Sbjct: 225 ALTSDGRALISDSRRTLGDISRAVNNFDRNPTRVL 259



 Score = 39.3 bits (90), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 21/119 (17%), Positives = 58/119 (48%), Gaps = 13/119 (10%)

Query: 321 ITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNISALKENNSLFKDAQRAMHTFR 380
           +TD +  +  ++  ++  +  L D+S +   +M  ++++   K+      + Q+A  +FR
Sbjct: 156 VTDNQAALHDSMENLKTFSKALADNSSRIDSIMVGVDSLMGGKDGEG--GELQKAARSFR 213

Query: 381 DTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFERNPQDIVWG 439
           + ++ +++   ++            +D + L+   + T+      +NNF+RNP  +++G
Sbjct: 214 ELADNLDKRTAAL-----------TSDGRALISDSRRTLGDISRAVNNFDRNPTRVLFG 261


>gi|311109429|ref|YP_003982282.1| Mce related family protein 4 [Achromobacter xylosoxidans A8]
 gi|310764118|gb|ADP19567.1| Mce related family protein 4 [Achromobacter xylosoxidans A8]
          Length = 318

 Score = 66.6 bits (161), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 57/235 (24%), Positives = 111/235 (47%), Gaps = 21/235 (8%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++++    G+F + +L  +     W+ R      P  E+I     +V GL+  S+VR+
Sbjct: 1   MENRSHALMAGIFTLVLLAAAALVAIWIGRDRTQLQPY-EIISAT--AVSGLNPQSTVRY 57

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G+PVG++  L L+ + P     +  + P+TP+  ST A +  QG+ G++ +E   LR +
Sbjct: 58  QGVPVGKVQSLALNPDKPGQVRIRIGVAPNTPITESTWAELGVQGVTGMSNVE---LRDD 114

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
             ++ ++A+     A I   P     F+   E    K+     +++++ E + + L+   
Sbjct: 115 GTSMKRLASSAAHPAAIPLRPG----FLDRIEQRGGKLIS---NVEEVTEQLRRVLSEQ- 166

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAID 235
            N++ ++  L  N + I + +        S D   T   +  L+ SLDK  +  D
Sbjct: 167 -NVQALTASL-QNATDITQSLRAA-----SQDLGPTMAKLGPLMDSLDKTSRQAD 214


>gi|297569475|ref|YP_003690819.1| Mammalian cell entry related domain protein [Desulfurivibrio
           alkaliphilus AHT2]
 gi|296925390|gb|ADH86200.1| Mammalian cell entry related domain protein [Desulfurivibrio
           alkaliphilus AHT2]
          Length = 316

 Score = 66.6 bits (161), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 61/309 (19%), Positives = 124/309 (40%), Gaps = 47/309 (15%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+++Y  + G+FV+ +      +I+W +   +  G   E I+   G++  L+  + VRF
Sbjct: 1   MENRSYALAAGIFVLVLGTAMVLAIWWFAGERELAG---EYILVTEGNIGNLNVGADVRF 57

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            GI  G++  + LD E P   L    I    P+   T A + TQG+ G+ Y++L     +
Sbjct: 58  RGIAAGKVTDIRLDAEDPRQILVTIRIDDQLPVTRGTVAVLDTQGVTGVAYVQLEDDGSD 117

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
            + +     E      +   PS +      A    + +   S ++ K +           
Sbjct: 118 PRPLV---AEPGYPPRLPLKPSMLTRIAEAALEAMQGLELMSNNLAKFLS---------- 164

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
                     A N    D+M+   Q+T            +   + ++ +++   + Q++ 
Sbjct: 165 ----------AENQVRFDEMV--VQLTSAGESIDQGLEGLPATLEAMQELLGPDNQQRLA 212

Query: 241 QILENIQVSSNNFVKSSDQV------INTVHDVRET--TQTFQEVGQ-----------KI 281
            +LEN++      + + D +      ++ +    ET  ++  +E+GQ           KI
Sbjct: 213 AVLENLEQLGGEALPAVDDLRTLLVSLDGMSARLETAASELGRELGQAGQRLQAETLPKI 272

Query: 282 DHLLSDFSS 290
           D +L D  +
Sbjct: 273 DRMLEDIGA 281


>gi|157736377|ref|YP_001489060.1| ABC transporter, periplasmic substrate-binding protein, putative
           [Arcobacter butzleri RM4018]
 gi|157698231|gb|ABV66391.1| ABC transporter, periplasmic substrate-binding protein, putative
           [Arcobacter butzleri RM4018]
          Length = 302

 Score = 66.6 bits (161), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 56/223 (25%), Positives = 100/223 (44%), Gaps = 15/223 (6%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M++K  +  +GLFV S+       I+WL +    D    +  I    SV GL+  SS++F
Sbjct: 1   MDTKINFFKIGLFVSSLFTLLVIFIFWLGKYGLEDKKYDDYSIFFSESVSGLNIGSSIKF 60

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G  VG +  + ++            I+  TP+     A +   G+ G+ YIEL      
Sbjct: 61  MGFEVGTVKDIKINPYNSEEIQIDIQIQKGTPIKEDNFAILGNLGITGLKYIELKGGSNN 120

Query: 121 KKTIFQIATERNQRAM--ITATPSGINYFISNAENTSKKISDSSRHIQKII--ENIE--- 173
            K +       NQ  M  I +  S +  F+ + E+ +K+I+     ++K++  ENI    
Sbjct: 121 SKLL-----GENQYGMKVIKSKTSALTTFVDSTEDITKEITILLGQMKKVLNDENISNFS 175

Query: 174 ---KPLTTTIANIETISTVLANNISHIDKMMHTTQVTPHSSDS 213
                   ++ANIE  S  L  N   ID+++++ +   ++ +S
Sbjct: 176 SLLSKSEKSMANIEQFSAYLVKNEKKIDELINSMKNFANTGNS 218


>gi|163793379|ref|ZP_02187354.1| hypothetical protein BAL199_02689 [alpha proteobacterium BAL199]
 gi|159181181|gb|EDP65696.1| hypothetical protein BAL199_02689 [alpha proteobacterium BAL199]
          Length = 335

 Score = 66.2 bits (160), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 54/238 (22%), Positives = 108/238 (45%), Gaps = 16/238 (6%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++  Y  VG FV+++         W   + + D  + + +I   GSV GLS  S VR+
Sbjct: 1   METRAGYAVVGAFVLALFLGGLGLAVWFG-NVRLDQDVRDYLIEFDGSVGGLSVGSRVRY 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           +G+PVG +  + +D +          +    P+  +  AT+ +QGL G+ +I++    ++
Sbjct: 60  HGVPVGSVTDIRIDPDNVEKVAVTVELDAAIPIKVNMYATLESQGLTGLGFIQIQGGTRD 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKII-ENIEKPLTTT 179
              + Q+A E     +I +  S +     +A   + ++     H+Q  + ++ +K +   
Sbjct: 120 APNL-QVA-EAGTLPLIPSRASRLEKVFQSAPEIAGQLVTLIAHLQGFLSDDNQKSVRDI 177

Query: 180 IANIETISTVLANNISHIDKMM------------HTTQVTPHSSDSKNTFNTITDLIT 225
           + N+ T+S VLA     I+  +                +TP   + +  F TIT+ ++
Sbjct: 178 LRNLATVSAVLAQRTDEIETAVVDGAAAATEVRAAMADLTPLIKELRGNFKTITEEVS 235


>gi|167031177|ref|YP_001666408.1| hypothetical protein PputGB1_0156 [Pseudomonas putida GB-1]
 gi|166857665|gb|ABY96072.1| Mammalian cell entry related domain protein [Pseudomonas putida
           GB-1]
          Length = 312

 Score = 66.2 bits (160), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 63/299 (21%), Positives = 140/299 (46%), Gaps = 22/299 (7%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++ ++  +GL  V ++  +     WL++S+  D    +  +    +V GLS  S V++
Sbjct: 1   METRAHHVLIGLVTVLVVAGAMLFGLWLAKSS-VDDAFKDYEVVFNEAVSGLSRGSPVQY 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NGI VG +  L LD + P   LA+  +  DTP+   T A +   G+ G ++I+LS    +
Sbjct: 60  NGIKVGDVSTLRLDPKDPRRVLARVRLSGDTPVKEDTQAKLTLAGVTGNSFIQLSGGTPQ 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKII--ENIEKPLTT 178
                ++  +  +  +I A+PS I+  ++++ +    I+    +  ++   +NI   L+ 
Sbjct: 120 SP---ELKGKDGKLPVIIASPSPISRLLNDSSDLVTNINLLLHNANQMFSEDNIGH-LSN 175

Query: 179 TIANIETISTVLANNISHI-DKMMHTTQVTPHSSDSKNTFNTIT------------DLIT 225
           T+AN++  +   A     I + +    QV   +S +     T+               I 
Sbjct: 176 TLANLDKTTGAFAGQHGSIAEAIEQLVQVGKQASATLAETQTLMRNANGLLGSEGKQAIG 235

Query: 226 SLDKMIKAI--DLQKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKID 282
           S ++ ++++      +N +L+N   +  +  +  +Q+   + ++RET    + + ++++
Sbjct: 236 SAERAMQSLAESTATINNLLKNNSEAIGDGAQGLNQLTPAIRELRETLNALKGISRQLE 294



 Score = 41.6 bits (96), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 30/118 (25%), Positives = 51/118 (43%), Gaps = 11/118 (9%)

Query: 330 STINTIENITSNLNDSSQKFAELMSKINNISAL--KENNSLFKDAQRAMHTFRDTSEKIN 387
           S    IE +      +S   AE  + + N + L   E       A+RAM +  +++  IN
Sbjct: 193 SIAEAIEQLVQVGKQASATLAETQTLMRNANGLLGSEGKQAIGSAERAMQSLAESTATIN 252

Query: 388 RYIP----SIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFERNPQDIVWGRE 441
             +     +IG+  Q     GLN +   +R+L+ET+N         E +P   + GR+
Sbjct: 253 NLLKNNSEAIGDGAQ-----GLNQLTPAIRELRETLNALKGISRQLEADPSGYLLGRD 305


>gi|221639255|ref|YP_002525517.1| Mammalian cell entry related domain-containing protein [Rhodobacter
           sphaeroides KD131]
 gi|221160036|gb|ACM01016.1| Mammalian cell entry related domain protein [Rhodobacter
           sphaeroides KD131]
          Length = 321

 Score = 66.2 bits (160), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 37/115 (32%), Positives = 64/115 (55%), Gaps = 2/115 (1%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++  Y  +G+F +S +  +   + WL++  Q D   AE  I    SV+GL   S VR+
Sbjct: 1   METRARYVLIGIFTLSSILATLGFLLWLAKV-QLDRTYAEYDILF-TSVEGLGRASPVRY 58

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELS 115
           NG+ VG ++ + +D E P+    +  +   TP+   T A + +QG+ G++Y+ LS
Sbjct: 59  NGVDVGEVLNIAVDAEDPSLVRVRIQLAATTPVRTDTKAQVASQGVTGVSYVSLS 113


>gi|241661799|ref|YP_002980159.1| Mammalian cell entry related domain-containing protein [Ralstonia
           pickettii 12D]
 gi|240863826|gb|ACS61487.1| Mammalian cell entry related domain protein [Ralstonia pickettii
           12D]
          Length = 322

 Score = 66.2 bits (160), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 32/114 (28%), Positives = 61/114 (53%), Gaps = 3/114 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K +    GLF + +  F   ++ W +R      P  EV+ R   +V+GL+  +SV++
Sbjct: 1   MENKAHAFLAGLFTIGLAIFMGLAVMWFNRDQTVRVPY-EVVTR--STVNGLNPQASVKY 57

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIEL 114
            G+ VG++  +  D + P   + + L+  D P+  +T   +  QG+ G+ Y++L
Sbjct: 58  RGLDVGKVDSIRFDDKVPGQIVVRVLVDKDAPITTTTYGRLAYQGVTGLAYVQL 111


>gi|197105493|ref|YP_002130870.1| ABC transporter, periplasmic substrate-binding protein
           [Phenylobacterium zucineum HLK1]
 gi|196478913|gb|ACG78441.1| ABC transporter, periplasmic substrate-binding protein
           [Phenylobacterium zucineum HLK1]
          Length = 323

 Score = 66.2 bits (160), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 47/180 (26%), Positives = 79/180 (43%), Gaps = 13/180 (7%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSR------SNQYDGPMAEVIIRIPGSVDGLST 54
           ME    Y  VGL  + ++      I WL+R      ++ YD       I   G V GLS 
Sbjct: 1   MEKNANYALVGLSTLILVAALAIFIVWLARFQFAQANDTYD-------ILFQGPVRGLSE 53

Query: 55  DSSVRFNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIEL 114
              V+FNGI VG +  + LD+  P+  +A+  +  D P+   + AT+  QG+ G+ YI++
Sbjct: 54  GGEVQFNGIKVGEVTKIALDRTNPSRVIARVQVTSDVPIRVDSYATLEPQGITGVNYIQI 113

Query: 115 STLRKEKKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEK 174
           +     +  +   A +R +R  I      I    S     S  +      + + IE +++
Sbjct: 114 TAGTPSRPLLKDEAQKRCEREGIGIGRECIPVLRSQRSTLSDLLEGGGTVLTRTIEALDR 173


>gi|209964743|ref|YP_002297658.1| hypothetical protein RC1_1441 [Rhodospirillum centenum SW]
 gi|209958209|gb|ACI98845.1| conserved hypothetical protein [Rhodospirillum centenum SW]
          Length = 320

 Score = 66.2 bits (160), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 62/282 (21%), Positives = 126/282 (44%), Gaps = 18/282 (6%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++  YT VG FV++++   F  + WL++  Q +G      I   G+V GL   S VR+
Sbjct: 1   MENRASYTIVGAFVLALVAGLFVFVVWLAKV-QLEGATTPYRIYFTGTVTGLVEGSPVRY 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G+ VG +  + LD +          +  DTP+     A++   G+ G  Y+E++   ++
Sbjct: 60  RGVAVGTVSDIRLDPDNVERVQVTVEVPEDTPIKTDALASLEPVGVTGGVYVEIAGGSRD 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKII--ENIEKPLTT 178
                 +A E     +I + PS I   ++ A      +   S  +  ++  EN +K    
Sbjct: 120 APL---LAAEEGGIPVIPSRPSTIAEVLAQAPQLLGNLIAISEKVSTLLNDEN-QKAFAA 175

Query: 179 TIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAI--DL 236
            + N+   S      + + D+++   +     ++ K      T L+ + +K++  +  D+
Sbjct: 176 ILGNLAAASDGANTTMRNADQLVGELR-----TEVKAVSRQATQLLGNANKVVAGVGADV 230

Query: 237 QKVNQIL----ENIQVSSNNFVKSSDQVINTVHDVRETTQTF 274
           Q V   L     ++   +++   ++++V   VH+ RE  + F
Sbjct: 231 QTVAAELAKTSRDLTRLTSSLATTAEEVRAMVHENREPIRDF 272


>gi|167647528|ref|YP_001685191.1| hypothetical protein Caul_3566 [Caulobacter sp. K31]
 gi|167349958|gb|ABZ72693.1| Mammalian cell entry related domain protein [Caulobacter sp. K31]
          Length = 312

 Score = 66.2 bits (160), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 54/231 (23%), Positives = 111/231 (48%), Gaps = 22/231 (9%)

Query: 1   MESKNYYTSVGLFVVSILFFSF--FSIYWLSR---SNQYDGPMAEVIIRIPGSVDGLSTD 55
           ME    Y  VG   + +LF     F++ WL++   + +YD  + +V+    G V GLS  
Sbjct: 1   MERNANYALVGAMTL-VLFMGLLVFAV-WLAKLSFNQEYD--LYDVLFV--GPVRGLSDG 54

Query: 56  SSVRFNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELS 115
             V FNGI VG +  + LD+  PN  +A+  +  D P+   + AT+  QG+ G+ Y+++ 
Sbjct: 55  GEVHFNGIKVGEVTKIALDKSDPNRVIARVRVTSDVPIKTDSYATLEPQGITGVNYVQI- 113

Query: 116 TLRKEKKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKII--ENIE 173
           T     K + +   +++Q  +I +  S ++  +        +  ++   + +++  +N+ 
Sbjct: 114 TAGAPAKPLLKSTVKKDQVPVIRSQRSALSDLLEGGGTVLTRTIEALDRVNRVLSDDNV- 172

Query: 174 KPLTTTIANIETISTVLANN---ISHIDKMMHTTQVT----PHSSDSKNTF 217
           K ++  I+++++++  L      I+   K + + + T       SDS N  
Sbjct: 173 KTVSAAISDVQSVTAELRERKEIIADAQKALQSIEATSTRIGELSDSANGL 223


>gi|302039181|ref|YP_003799503.1| putative ABC transporter periplasmic-binding protein [Candidatus
           Nitrospira defluvii]
 gi|300607245|emb|CBK43578.1| putative ABC-type transport system, periplasmic binding component
           [Candidatus Nitrospira defluvii]
          Length = 320

 Score = 65.9 bits (159), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 71/317 (22%), Positives = 132/317 (41%), Gaps = 49/317 (15%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME K  Y  VG FVV +      +I+WL +++ Y G      +    SV GLS DS+V++
Sbjct: 1   MEPKVNYILVGAFVVLLGATILGAIFWLGKTD-YRGIYDRYYVYTRESVAGLSVDSTVKY 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G+ VGR+  + L+ E          I   TP+   T A + TQGL G+  + L+   +E
Sbjct: 60  RGVDVGRVKQVILNPENTEEVRVTLDIVGGTPVKTDTQAVLVTQGLTGLVTLNLTGGSRE 119

Query: 121 KKTIFQIATERNQRAMITATPS----------------GINYFISN----AENTSKKISD 160
              +  IA +     +I + PS                G++  ++N    A+N +  + +
Sbjct: 120 APFLTPIAGQ--DYPVIKSVPSLFGRLDGTLAKLLSDQGLSTLVANLNGLAQNAASALDE 177

Query: 161 SSRHIQKIIENIEKPLTTTIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTI 220
            +R + + I          + ++  ++ VLA     +D+ +   Q    +  S      +
Sbjct: 178 DNRTVLRQI----------LKDVSAVTKVLAERSGQMDRGVQ--QAVQAADQSARVTEQL 225

Query: 221 TDLITSLDKMI--KAIDLQKVNQILENIQVSSNNFVKSSDQVIN------------TVHD 266
           +  + +L + +   A  LQ++ + L     S    + +S   I              V +
Sbjct: 226 SKQLPALVERLSRSAAGLQQMTEDLSRTSRSVGEMIGASRPGIEQFSRQTLADTGLLVTE 285

Query: 267 VRETTQTFQEVGQKIDH 283
           +R+ T T   V Q+++ 
Sbjct: 286 LRQLTATLNRVAQQVER 302


>gi|315635509|ref|ZP_07890775.1| ABC superfamily ATP binding cassette transporter, substrate-binding
           protein [Arcobacter butzleri JV22]
 gi|315480267|gb|EFU70934.1| ABC superfamily ATP binding cassette transporter, substrate-binding
           protein [Arcobacter butzleri JV22]
          Length = 302

 Score = 65.9 bits (159), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 56/223 (25%), Positives = 99/223 (44%), Gaps = 15/223 (6%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M++K  +  +GLFV S+       I+WL +    D    +  I    SV GL+  SS++F
Sbjct: 1   MDTKINFFKIGLFVSSLFTLLVIFIFWLGKYGLEDKKYDDYSIFFSESVSGLNIGSSIKF 60

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G  VG +  + ++            I+  TP+     A +   G+ G+ YIEL      
Sbjct: 61  MGFEVGTVKDIKINPYNSEEIQIDIQIQKGTPIKEDNFAILGNLGITGLKYIELKGGSNN 120

Query: 121 KKTIFQIATERNQRAM--ITATPSGINYFISNAENTSKKISDSSRHIQKII--ENIE--- 173
            K +       NQ  M  I +  S +  F+ + E+ +K+I+     ++K++  ENI    
Sbjct: 121 SKLL-----GENQYGMKVIKSKTSALTTFVDSTEDITKEITILLGQMKKVLNDENISNFS 175

Query: 174 ---KPLTTTIANIETISTVLANNISHIDKMMHTTQVTPHSSDS 213
                   ++ANIE  S  L  N   ID ++++ +   ++ +S
Sbjct: 176 SLLSKSEKSMANIEQFSAYLVKNEKKIDDLINSMKNFANTGNS 218


>gi|329905879|ref|ZP_08274262.1| ABC-type transport system [Oxalobacteraceae bacterium IMCC9480]
 gi|327547450|gb|EGF32271.1| ABC-type transport system [Oxalobacteraceae bacterium IMCC9480]
          Length = 311

 Score = 65.9 bits (159), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 35/114 (30%), Positives = 59/114 (51%), Gaps = 3/114 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K++    G+F +++L        W +R      P  E+  ++  SV GL+  + VR+
Sbjct: 1   MENKSHALMAGIFTLALLVAGILLAMWFNRDRIERVPY-EMATKL--SVPGLNPQADVRY 57

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIEL 114
            G+ VG++  +  D   P   L    +RPDTP+  ST   +  QG+ GI Y++L
Sbjct: 58  RGLDVGKVDEIIFDPNVPGQILVHISVRPDTPMTQSTYGVLGYQGVTGIAYVQL 111


>gi|300692711|ref|YP_003753706.1| ABC-type transporter periplasmic component (resistance to organic
           solvents) [Ralstonia solanacearum PSI07]
 gi|299079771|emb|CBJ52448.1| putative ABC-type transporter, periplasmic component (resistance to
           organic solvents) [Ralstonia solanacearum PSI07]
          Length = 330

 Score = 65.5 bits (158), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 32/114 (28%), Positives = 62/114 (54%), Gaps = 3/114 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++ +    GLF + ++ F   ++ W +R      P  EV+ R   +V+GLS  +SV++
Sbjct: 1   MENRAHAFLAGLFTIGLVIFIALAVVWFNRDQTVRVPY-EVVTR--STVNGLSPQASVKY 57

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIEL 114
            G+ VG++  +  D + P   + + L+  D P+  +T   +  QG+ G+ Y++L
Sbjct: 58  RGLDVGKVDTIRFDDKVPGQIVVRVLVDKDAPITTTTYGRLAYQGVTGLAYVQL 111


>gi|134096150|ref|YP_001101225.1| putative signal peptide protein [Herminiimonas arsenicoxydans]
 gi|133740053|emb|CAL63104.1| putative ABC-type transporter [Herminiimonas arsenicoxydans]
          Length = 311

 Score = 65.5 bits (158), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 35/114 (30%), Positives = 60/114 (52%), Gaps = 3/114 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K +    G+F +++L  +     W +R      P  E+   +  SV GL+  + VR+
Sbjct: 1   MENKAHALLAGIFTIALLIAAVLIALWFNRDRVERVPY-EIATTL--SVPGLNPQAGVRY 57

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIEL 114
            G+ VGR+  +  D + P   L +  +  DTP+  ST AT+  QG+ G+ Y++L
Sbjct: 58  RGLDVGRVDAVLFDPQKPGQILIRFSVSKDTPITHSTFATLSYQGVTGLAYVQL 111


>gi|316935523|ref|YP_004110505.1| mammalian cell entry related domain-containing protein
           [Rhodopseudomonas palustris DX-1]
 gi|315603237|gb|ADU45772.1| Mammalian cell entry related domain protein [Rhodopseudomonas
           palustris DX-1]
          Length = 291

 Score = 65.5 bits (158), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 60/280 (21%), Positives = 125/280 (44%), Gaps = 35/280 (12%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLS--RSNQYDGPMAEVIIRIPGSVDGLSTDSSV 58
           ME++  Y  +G F ++++  +   + W     + +   P+  V     G+  GL    SV
Sbjct: 1   METRANYFLIGTFTLAVIAAALGFVLWFQSLHTTKARSPLRVVF---EGAASGLRNGGSV 57

Query: 59  RFNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLR 118
            FNG+ VG +V + LD   P   +A A++    P+   T   +  QGL G+  I   +L+
Sbjct: 58  NFNGVRVGEVVSVKLDN--PRRVVALAMVENTAPIRKDTQVGLEFQGLTGVAAI---SLK 112

Query: 119 KEKKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTT 178
              +T   +  + +   ++TA P  +       ++ S+ I  + R++ +++ + ++ + T
Sbjct: 113 GGSETAPPVPLDDDGTPVLTADPELL-------QDISESIKATLRNVNRLVADNQESVKT 165

Query: 179 TIANIETISTVLANN-------ISHIDK-------MMHTTQVTPHSSDSKNTFNTIT--- 221
           ++ N++T ++ LA +       +S +D        +M          D    F  +    
Sbjct: 166 SLENLQTFTSGLARSSDKIDSIVSRVDSVIAKTDSVMQGIDALAGGKDGGELFQAVKSFR 225

Query: 222 DLITSLDKMIKAIDLQKVNQILENIQVSSNNFVKSSDQVI 261
           +L  +LDK    + L    + L +I  + NNF ++  +V+
Sbjct: 226 ELADNLDKRSATLILDG-RRTLADISRAVNNFDRNPTRVL 264


>gi|126462255|ref|YP_001043369.1| hypothetical protein Rsph17029_1487 [Rhodobacter sphaeroides ATCC
           17029]
 gi|126103919|gb|ABN76597.1| Mammalian cell entry related domain protein [Rhodobacter
           sphaeroides ATCC 17029]
          Length = 321

 Score = 65.1 bits (157), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 36/115 (31%), Positives = 64/115 (55%), Gaps = 2/115 (1%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++  Y  +G+F ++ +  +   + WL++  Q D   AE  I    SV+GL   S VR+
Sbjct: 1   METRARYVLIGIFTLASILATLGFLLWLAKV-QLDRTYAEYDILFT-SVEGLGRASPVRY 58

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELS 115
           NG+ VG ++ + +D E P+    +  +   TP+   T A + +QG+ G++Y+ LS
Sbjct: 59  NGVDVGEVLNIAVDAEDPSLVRVRIQLAATTPVRTDTKAQVASQGVTGVSYVSLS 113


>gi|302382567|ref|YP_003818390.1| hypothetical protein Bresu_1455 [Brevundimonas subvibrioides ATCC
           15264]
 gi|302193195|gb|ADL00767.1| Mammalian cell entry related domain protein [Brevundimonas
           subvibrioides ATCC 15264]
          Length = 312

 Score = 65.1 bits (157), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 64/309 (20%), Positives = 131/309 (42%), Gaps = 45/309 (14%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSR---SNQYDGPMAEVIIRIPGSVDGLSTDSS 57
           ME   +Y +VG+  V++L        WL+R   ++ YD  + +++    G V+G+S    
Sbjct: 1   MERDAHYAAVGIATVALLAALAVFAIWLARLQFNDSYD--LYDIVFT--GPVNGVSEGGE 56

Query: 58  VRFNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTL 117
           V FNGI VG +  L LD    +  +A+  +   TP+  ++ A +  QG+ G+ ++++ T 
Sbjct: 57  VHFNGIRVGEVTDLNLDPNKGDQVIARVRLDATTPVRVTSRAQLEPQGITGLNFVQI-TA 115

Query: 118 RKEKKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKII--ENIEKP 175
             E   + +     +   +I +  S     +S +     +  D+   + +++  +NI + 
Sbjct: 116 GTEGSPLLKTQYADDVVPVIQSQASPFAELLSGSGTVLAQAVDALNRVNRVLSDDNI-RS 174

Query: 176 LTTTIANIETISTVL------------------------------ANNISHIDKMMHTTQ 205
            +TT+ N+E++S  L                              A  + + D       
Sbjct: 175 FSTTLKNVESLSNELEARKGMFKELEEALTKANAAVGEYEALGADARRLINTDGAEAVAS 234

Query: 206 VTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVNQILENIQVSSNNFVKSSDQVINTVH 265
           +   + D++    +I    T L+  +  +    + Q+LE IQ       +++D +   V 
Sbjct: 235 INAAAGDARTAIASINRTATGLEGPVGELTTTGIPQLLEAIQ----GLQEATDSLQGLVD 290

Query: 266 DVRETTQTF 274
           DVR + + F
Sbjct: 291 DVRASPRDF 299


>gi|114570552|ref|YP_757232.1| hypothetical protein Mmar10_2002 [Maricaulis maris MCS10]
 gi|114341014|gb|ABI66294.1| Mammalian cell entry related domain protein [Maricaulis maris
           MCS10]
          Length = 316

 Score = 64.7 bits (156), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 39/112 (34%), Positives = 59/112 (52%), Gaps = 3/112 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K ++  VGLF V +L    F   WL + + +D   A   I   G V GL     VRF
Sbjct: 1   METKAHHALVGLFAVLLLAAGGFFALWLGKVS-FDEDYAFYDIVFDGPVRGLRESGEVRF 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYI 112
           NGI VG +  L LD +  +  +A+  +   TP+  ++ A +  QGL G++Y+
Sbjct: 60  NGIQVGEVTELELDDQ--SRVIARIRVLAQTPVRTNSEAQLEPQGLTGLSYV 109


>gi|268678742|ref|YP_003303173.1| hypothetical protein Sdel_0100 [Sulfurospirillum deleyianum DSM
           6946]
 gi|268616773|gb|ACZ11138.1| Mammalian cell entry related domain protein [Sulfurospirillum
           deleyianum DSM 6946]
          Length = 316

 Score = 64.7 bits (156), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 69/300 (23%), Positives = 130/300 (43%), Gaps = 44/300 (14%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++  Y  VG FV  +L  S  SI WL R +  +G      +    SV GL+  + V+ 
Sbjct: 1   MENRLSYILVGAFVFVLLIGSVVSIVWLGRYSD-EGSFKFYQVATKESVSGLNEKAPVKL 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           +G+ +G +  + ++ +     L    ++ D P+  ST A I  QG+ G++YI+L      
Sbjct: 60  HGVQIGEVRDININPKNAEEVLVTIRVQEDAPIKESTYAIIEAQGITGLSYIQLQGSINH 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
            K + +    + +  +I + PS  +          K I+  S   ++I E  E  ++   
Sbjct: 120 SKEL-KTGDTKEEYGIIYSRPSTFSRL-------DKTITSLSTKAEQIFERAENIMSDK- 170

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
            N++    +L N+     K+  +T  T  + +++N                     +++N
Sbjct: 171 -NLKNFEAILENSA----KVSESTSKTMANLEAQN---------------------KEIN 204

Query: 241 QIL-------ENIQVSSNNFVKSSDQV-INTVHDVRETTQTFQEVGQKIDHLLSDFSSKM 292
           Q+L       + IQ  S++F  + D   I+T+ +VRE  ++   V   ++  L   S  M
Sbjct: 205 QLLKESIEAAKGIQAMSHSFTSAIDNTGIDTMDNVREAAKSVNTVMNGLNQKLEKGSFDM 264


>gi|115523757|ref|YP_780668.1| hypothetical protein RPE_1739 [Rhodopseudomonas palustris BisA53]
 gi|115517704|gb|ABJ05688.1| Mammalian cell entry related domain protein [Rhodopseudomonas
           palustris BisA53]
          Length = 384

 Score = 64.7 bits (156), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 56/228 (24%), Positives = 93/228 (40%), Gaps = 17/228 (7%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++  +  VG FV++ +   F  ++WL  S+   G      +   GSV GL   ++V F
Sbjct: 1   METRAPFILVGAFVLAAIGAVFGFVFWLHNSSGL-GARTSYQVHFNGSVPGLLVGAAVLF 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NGI VG +  L L  + P    A   +   TP+   T   +  QGL G+  I L    ++
Sbjct: 60  NGIRVGEVTALGLAPDDPRQVNASIAVDVATPVRADTKVGLDFQGLTGVPVIALEGGSQK 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
                   T       + A P          ++ ++   D+ R +  ++    +PL   I
Sbjct: 120 --------TASGPVPTLIADPGA-------GQSMTQAARDALRKVDSVLTENAEPLKAAI 164

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLD 228
           A+I   +  LA N   +D ++   +     +D       I DL T  D
Sbjct: 165 ADIRVFAESLARNSGKLDGIVAGIERM-TGADKPVVNKVIYDLATPTD 211


>gi|77463400|ref|YP_352904.1| ABC transporter periplasmic substrate-binding protein [Rhodobacter
           sphaeroides 2.4.1]
 gi|77387818|gb|ABA79003.1| Putative ABC transporter, periplasmic substrate-binding protein
           [Rhodobacter sphaeroides 2.4.1]
          Length = 321

 Score = 64.7 bits (156), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 36/115 (31%), Positives = 64/115 (55%), Gaps = 2/115 (1%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++  Y  +G+F ++ +  +   + WL++  Q D   AE  I    SV+GL   S VR+
Sbjct: 1   METRARYVLIGIFTLASILATLGFLLWLAKV-QLDRTYAEYDILFT-SVEGLGRASPVRY 58

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELS 115
           NG+ VG ++ + +D E P+    +  +   TP+   T A + +QG+ G++Y+ LS
Sbjct: 59  NGVDVGEVLNIAVDAEDPSLVRVRIQLAATTPVRTDTKAQVASQGVTGVSYVSLS 113


>gi|299068159|emb|CBJ39378.1| putative ABC-type transporter, periplasmic component (resistance to
           organic solvents) [Ralstonia solanacearum CMR15]
          Length = 330

 Score = 64.7 bits (156), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 31/114 (27%), Positives = 62/114 (54%), Gaps = 3/114 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++ +    GLF + ++ F   ++ W +R      P  EV+ R   +V+GLS  ++V++
Sbjct: 1   MENRAHAFLAGLFTIGLVIFIALAVVWFNRDQTVRLPY-EVVTR--STVNGLSPQAAVKY 57

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIEL 114
            G+ VG++  +  D + P   + + L+  D P+  +T   +  QG+ G+ Y++L
Sbjct: 58  RGLDVGKVDSIRFDDKVPGQIIVRVLVDKDAPITTTTYGRLAYQGVTGLAYVQL 111


>gi|319956952|ref|YP_004168215.1| mammalian cell entry related domain protein [Nitratifractor
           salsuginis DSM 16511]
 gi|319419356|gb|ADV46466.1| Mammalian cell entry related domain protein [Nitratifractor
           salsuginis DSM 16511]
          Length = 310

 Score = 64.7 bits (156), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 66/300 (22%), Positives = 121/300 (40%), Gaps = 45/300 (15%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSR---SNQYDGPMAEVIIRIPGSVDGLSTDSS 57
           M SK  YT VGLFV+     +F   +WL++     +YD       +     VDGL+ DS+
Sbjct: 1   MYSKINYTLVGLFVLLFTILAFAFAFWLAKYGFEEKYD----YYYLYFTEPVDGLTMDST 56

Query: 58  VRFNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTL 117
           V+  G+ VG++  + +D         K  ++  TP+     A ++ QG+ G++Y+++   
Sbjct: 57  VKLKGVDVGKVSRIEIDPTNVERIRVKIRLKAGTPIVKGMYALLKLQGITGLSYVQIEG- 115

Query: 118 RKEKKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLT 177
              KK   ++     Q  +I   PS ++    +A     K+  ++  + K+         
Sbjct: 116 --GKKGAPRLTAPEGQIPVIPTHPSLLHRLSESAPKFLDKLQHTADGLNKLFSQ------ 167

Query: 178 TTIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQ 237
               N + ++ +L N          T + T  +   +N   T++D               
Sbjct: 168 ---HNQQQLTKILNN----------TAEATGKAVAVENRLITLSD--------------- 199

Query: 238 KVNQILENIQVSSNNFVKSSDQVINTVH-DVRETTQTFQEVGQKIDHLLSDFSSKMKSKE 296
           + N+ L +    S   V S DQV +T+   +        E G+ I  L      ++K  E
Sbjct: 200 EFNRTLAHFDRRSAQLVDSVDQVTDTLQKKLPPLMDHVDEAGRNIADLARGIDRRLKRGE 259


>gi|113866163|ref|YP_724652.1| ABC-type transporter, periplasmic component [Ralstonia eutropha
           H16]
 gi|113524939|emb|CAJ91284.1| ABC-type transporter, periplasmic component [Ralstonia eutropha
           H16]
          Length = 313

 Score = 64.3 bits (155), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 32/114 (28%), Positives = 61/114 (53%), Gaps = 3/114 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K++    G+F + +     F+I+W S  +    P  ++I R   +V+GL     V++
Sbjct: 2   MENKSHAFLAGVFTIGLAVLVLFAIFWFSTDHAVRVPY-DLITR--STVNGLQPQGDVKY 58

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIEL 114
            G+ VG++  +  D + P   + +  +  DTP+  +T  T+  QG+ GI Y++L
Sbjct: 59  RGLAVGKVESIKFDPQVPGQIIVRVNVNKDTPITRTTYGTLGFQGVTGIAYVQL 112


>gi|152981828|ref|YP_001354933.1| ABC-type transport system involved in resistance to organic
           solvents, periplasmic component [Janthinobacterium sp.
           Marseille]
 gi|151281905|gb|ABR90315.1| ABC-type transport system involved in resistance to organic
           solvents, periplasmic component [Janthinobacterium sp.
           Marseille]
          Length = 304

 Score = 64.3 bits (155), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 35/114 (30%), Positives = 59/114 (51%), Gaps = 3/114 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K +    G+F + +L  +     W +R      P  E+   +  SV GL+  + VR+
Sbjct: 1   MENKAHALMAGIFTIVLLIAAVLIALWFNRDRVERVPY-EIATTL--SVPGLNPQAGVRY 57

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIEL 114
            G+ VGR+  +  D + P   L +  +  DTP+  ST AT+  QG+ G+ Y++L
Sbjct: 58  RGLDVGRVDAVLFDPQKPGQILIRFSVSKDTPITHSTFATLSYQGVTGLAYVQL 111


>gi|209884493|ref|YP_002288350.1| putative ABC transporter [Oligotropha carboxidovorans OM5]
 gi|209872689|gb|ACI92485.1| putative ABC transporter [Oligotropha carboxidovorans OM5]
          Length = 288

 Score = 63.9 bits (154), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 48/208 (23%), Positives = 95/208 (45%), Gaps = 19/208 (9%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAE-VIIRI--PGSVDGLSTDSS 57
           ME++  Y  +G F ++++  +F  ++W     Q  G +A+   IRI   G+  GL T  +
Sbjct: 1   METRANYLLIGAFTIAVIAAAFGFVFWF----QNLGAVAQRTPIRIIFEGAASGLRTGGN 56

Query: 58  VRFNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTL 117
           V FNGI +G +  + LD   P   +  A +    P+   T   +   GL G++ +   +L
Sbjct: 57  VNFNGIKIGEVTSIKLDD--PKRVVVIAAVDKSAPIRADTLVGLEFAGLTGVSSV---SL 111

Query: 118 RKEKKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLT 177
           +        I    +    + A P+ I        +  + +  + +++ K++ + +  L 
Sbjct: 112 KGGSLDAGGIPVADDGVPTLNADPNAI-------MDIGEAVRATLQNVNKLVTDNKDALH 164

Query: 178 TTIANIETISTVLANNISHIDKMMHTTQ 205
            ++AN++  S  LA+N   ID +M   +
Sbjct: 165 DSMANLKAFSKALADNSGRIDNIMAGVE 192



 Score = 40.8 bits (94), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 25/125 (20%), Positives = 59/125 (47%), Gaps = 13/125 (10%)

Query: 321 ITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNISALKENNSLFKDAQRAMHTFR 380
           +TD +  +  ++  ++  +  L D+S +   +M+ + ++   KE      D Q+A  +FR
Sbjct: 156 VTDNKDALHDSMANLKAFSKALADNSGRIDNIMAGVESLMGNKEGQE--GDLQQAARSFR 213

Query: 381 DTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFERNPQDIVWGR 440
           + ++ +++    +           L+D + L+   + T+      +NNF+RNP  +++G 
Sbjct: 214 ELADNLDKRTAVL-----------LSDGRALITDSRRTLADISRAVNNFDRNPTRVLFGA 262

Query: 441 EKGSV 445
               V
Sbjct: 263 SNADV 267


>gi|237749354|ref|ZP_04579834.1| predicted protein [Oxalobacter formigenes OXCC13]
 gi|229380716|gb|EEO30807.1| predicted protein [Oxalobacter formigenes OXCC13]
          Length = 293

 Score = 63.9 bits (154), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 35/114 (30%), Positives = 62/114 (54%), Gaps = 3/114 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K++    GLF V ++  +   +++L+       P    +I    S+ GL+  ++VRF
Sbjct: 2   MENKSHAFIAGLFTVCLVAAALLIVWFLNMDRTVKQPY---MIATNLSIPGLNPQATVRF 58

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIEL 114
            G+ VG++  +  +++ P   L    ++ DTP+  ST AT+  QG+ GI  IEL
Sbjct: 59  RGLDVGKVTNIGFNKDDPGEILIYFEVKEDTPMTESTFATLSYQGVTGIASIEL 112


>gi|187927278|ref|YP_001897765.1| Mammalian cell entry related domain-containing protein [Ralstonia
           pickettii 12J]
 gi|309780022|ref|ZP_07674775.1| signal peptide protein [Ralstonia sp. 5_7_47FAA]
 gi|187724168|gb|ACD25333.1| Mammalian cell entry related domain protein [Ralstonia pickettii
           12J]
 gi|308921192|gb|EFP66836.1| signal peptide protein [Ralstonia sp. 5_7_47FAA]
          Length = 322

 Score = 63.9 bits (154), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 31/114 (27%), Positives = 62/114 (54%), Gaps = 3/114 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K +    GLF + ++ F   ++ W +R      P  +V+ R   +V+GL+  +SV++
Sbjct: 1   MENKAHAFLAGLFTIGLIIFIGLAVMWFNRDQTVRLPY-DVVTR--STVNGLNPQASVKY 57

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIEL 114
            G+ VG++  +  D + P   + + L+  D P+  +T   +  QG+ G+ Y++L
Sbjct: 58  RGLDVGKVDSIRFDDKVPGQIVVRVLVDKDAPITTTTYGRLAYQGVTGLAYVQL 111


>gi|146341948|ref|YP_001206996.1| ABC transporter periplasmic-binding protein [Bradyrhizobium sp.
           ORS278]
 gi|146194754|emb|CAL78779.1| Putative ABC transporter (periplasmic binding protein)
           [Bradyrhizobium sp. ORS278]
          Length = 293

 Score = 63.5 bits (153), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 61/280 (21%), Positives = 125/280 (44%), Gaps = 35/280 (12%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLS--RSNQYDGPMAEVIIRIPGSVDGLSTDSSV 58
           ME++  Y  +G F +++L  +   + W     + +   P+  V+   P +  GL    SV
Sbjct: 1   METRANYVLIGSFTLAVLAAAVGFVLWFQSLHTTKQRSPL-RVVFEGPAA--GLRNGGSV 57

Query: 59  RFNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLR 118
            FNGI VG ++ + LD   P   +A A++  + P+   T   +  QGL G+  I   +L+
Sbjct: 58  NFNGIRVGEVISVKLDN--PRRVVALAMVENNAPIRKDTLVGLEFQGLTGVAAI---SLK 112

Query: 119 KEKKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTT 178
             ++       + +   ++ A P+ +       ++ ++ I  + ++I K++ + ++ +  
Sbjct: 113 GGEEAAPPPPLDEDGVPLLRADPTRL-------QDVTEAIRATLQNINKVVADNQEAVKN 165

Query: 179 TIANIETISTVLANNISHIDKMMHTTQVTPHSSDS-----------KN------TFNTIT 221
           +I N+E  +  LA N   ID +M         +D+           K+      T  +I 
Sbjct: 166 SIKNLEVFTQSLARNSERIDGVMSRVDGIMGKADTLMLGLNTLAGGKDGGELFLTVKSIR 225

Query: 222 DLITSLDKMIKAIDLQKVNQILENIQVSSNNFVKSSDQVI 261
           +L    DK   A+ +    + L +I  + NNF ++  +V+
Sbjct: 226 ELAEDFDKRSGAL-MADGRRTLSDISRAVNNFDRNPTRVL 264


>gi|91976117|ref|YP_568776.1| hypothetical protein RPD_1638 [Rhodopseudomonas palustris BisB5]
 gi|91682573|gb|ABE38875.1| Mammalian cell entry related [Rhodopseudomonas palustris BisB5]
          Length = 317

 Score = 63.5 bits (153), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 55/263 (20%), Positives = 119/263 (45%), Gaps = 26/263 (9%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLS--RSNQYDGPMAEVIIRIPGSVDGLSTDSSV 58
           ME++  Y  +G F ++++  +F  + W     S +   P+  V     G+  GL    SV
Sbjct: 15  METRANYFLIGTFTLAVIAAAFGFVLWFQSLHSTKARSPLRVV---FEGAASGLRNGGSV 71

Query: 59  RFNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLR 118
            FNG+ VG ++ + LD   P   +A A++    P+   T   +  QGL G+  I   +L+
Sbjct: 72  NFNGVRVGEVISVKLDN--PKRVVALAMVENTAPIRKDTLVGLEFQGLTGVAAI---SLK 126

Query: 119 KEKKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTT 178
               +   +  + +   ++TA P  +        + S+ +  + R++ K++    + +  
Sbjct: 127 GGLDSAPPVPLDEDGVPVLTADPELL-------MDISESVKATLRNLNKVVAENAETVKE 179

Query: 179 TIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQK 238
           +++N++T +  LA +   ID +M         +DS         ++  +D +    D  +
Sbjct: 180 SLSNLQTFTASLARSSDKIDSIMVKVDGVIGKTDS---------VMQGIDALAGGKDGGE 230

Query: 239 VNQILENIQVSSNNFVKSSDQVI 261
           + Q +++ +  ++N  K S+ +I
Sbjct: 231 LFQAVKSFRELADNLDKRSNALI 253


>gi|17545034|ref|NP_518436.1| signal peptide protein [Ralstonia solanacearum GMI1000]
 gi|17427324|emb|CAD13843.1| probable abc-type transport system involved in resistance to
           organic solvents, periplasmic component abc transporter
           protein [Ralstonia solanacearum GMI1000]
          Length = 330

 Score = 63.5 bits (153), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 31/114 (27%), Positives = 60/114 (52%), Gaps = 3/114 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++ +    GLF + +  F   ++ W +R      P  EV+ R   +V+GLS  ++V++
Sbjct: 1   MENRAHAFLAGLFTIGLAIFIALAVVWFNRDQTVRVPY-EVVTR--STVNGLSPQAAVKY 57

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIEL 114
            G+ VG++  +  D   P   + + L+  D P+  +T   +  QG+ G+ Y++L
Sbjct: 58  RGLDVGKVDSIRFDDRVPGQIIVRVLVDKDAPITTTTYGRLAYQGVTGLAYVQL 111



 Score = 37.7 bits (86), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 27/138 (19%), Positives = 61/138 (44%), Gaps = 14/138 (10%)

Query: 313 SSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNISALKENNSLFKDA 372
           SS+SA+ +  + RQ +++ + + +    + N  +++    M ++  I+     ++     
Sbjct: 164 SSLSALFD-DEHRQALMAAMQSFQGTMDSYNALARQAEPTMRRLPQIA--DNLDATLSAT 220

Query: 373 QRAMHTFRDTSEKINRYIPSIGNNLQNFSQS-----------GLNDIQNLVRKLQETVNH 421
           +R   +  D    +   + S GN+L + SQS            L  +    R+ ++ V  
Sbjct: 221 RRLSQSLSDPKGPLMGTLASAGNDLSSASQSMQAATNVLANETLPQLNGFAREARQAVRS 280

Query: 422 FDDCLNNFERNPQDIVWG 439
           FD  + +F   PQ +++G
Sbjct: 281 FDHAVTDFNTRPQSVLFG 298


>gi|121592686|ref|YP_984582.1| hypothetical protein Ajs_0252 [Acidovorax sp. JS42]
 gi|120604766|gb|ABM40506.1| Mammalian cell entry related domain protein [Acidovorax sp. JS42]
          Length = 325

 Score = 63.5 bits (153), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 65/317 (20%), Positives = 137/317 (43%), Gaps = 65/317 (20%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K++  + G+FV+++         WL+R +Q D  + E+  +   SV GL   ++VR+
Sbjct: 1   MENKSHALAAGIFVIAVAALLAGLGMWLTR-DQTDYQLYELSSK--DSVSGLQPQAAVRY 57

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIEL------ 114
            G+ VG+++ +  D +   + L +  +  D P+ P+T AT+  QG+ G+ +++L      
Sbjct: 58  KGVAVGKVMHIGFDPQVSGNVLIRIAVNADAPISPTTFATLGYQGVTGLAHVQLDDAEAP 117

Query: 115 ---------------------STLRKEKKTIFQIATERNQRAMITATPSGINYFISNAEN 153
                                S L ++   I     E  QR         IN  + + EN
Sbjct: 118 LPAPPPGASGLPRLPLHSSSFSQLAEQGPAILGQVQEATQR---------INTLLGD-EN 167

Query: 154 TS------KKISDSSRHIQKIIENIEKPLTTTIANIETISTVLANNISHIDKMMHTTQVT 207
                   K++ D++  I ++   ++           T++T L   ++ +  ++  TQ T
Sbjct: 168 QQRFSTALKQLGDAAGSIDQLARRLDN----------TVTTRLDPALAGVPPLVQDTQQT 217

Query: 208 PHS-----SDSKNTFNTITDLITSLDKMIKAIDLQKVNQILENIQVSSNNFVKSSDQVIN 262
             +     S +    N ++  I +L     A+D  ++    +++  +++ F + +   IN
Sbjct: 218 LQALRQAGSSAATAANDVSQAIRTLQAEGGALD--EIAAGAKSLAGAADRFGRVTLPRIN 275

Query: 263 TVHDVRETTQTFQEVGQ 279
             H   ET +  + +G+
Sbjct: 276 --HAADETARAARRLGR 290


>gi|56551912|ref|YP_162751.1| mammalian cell entry related domain-containing protein [Zymomonas
           mobilis subsp. mobilis ZM4]
 gi|56543486|gb|AAV89640.1| Mammalian cell entry related domain protein [Zymomonas mobilis
           subsp. mobilis ZM4]
          Length = 315

 Score = 63.2 bits (152), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 74/337 (21%), Positives = 146/337 (43%), Gaps = 54/337 (16%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSR-----SNQYDGPMAEVIIRIPGSVDGLSTD 55
           ME+++ Y  VG   + +L      + W+ R     ++QYD       I    SVDGL+  
Sbjct: 1   METRSNYILVGSITLILLALIATVLVWIGRVSGTETHQYD-------IFFHQSVDGLAKG 53

Query: 56  SSVRFNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELS 115
           SSV ++G+P G++  + L    P+    +  +  DTP+   TTATI + G +G++ I L+
Sbjct: 54  SSVSYSGVPSGQVKEIKLLPNNPDFVRVRISLNADTPVLEGTTATISSMGFSGVSQITLA 113

Query: 116 TLRKEKKTI-----FQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKII- 169
                 K I     F +        +I   P  +   +++A    ++I+  +  +  ++ 
Sbjct: 114 GGVSGAKPIENHGPFGV-------PVIPTKPGALGQLLNSAPQLLERITTLTERMSDLLN 166

Query: 170 ENIEKPLTTTIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDK 229
           ++ ++ +   + N+ T+S  LAN    I ++M          D+ +              
Sbjct: 167 DHNQRSIARILDNMNTLSGNLANQSPKIRQIM---------DDAHHAL------------ 205

Query: 230 MIKAIDLQKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFS 289
               ++L    Q +  +  ++NN VK  D    T H ++ET    ++  Q ++ +L D  
Sbjct: 206 ----VNLSDAGQQISELAQTTNNTVK-QDIHPATAH-LKETVMAARDSMQNLNDMLLDAR 259

Query: 290 SKMK--SKETSAFLENIADSTSNMRSSISAIREITDQ 324
             +   S ET    + +     +M  S+S++ +  +Q
Sbjct: 260 PGVHHFSNETMPQFDQLVHDLHDMIGSMSSLTDRLNQ 296


>gi|222109466|ref|YP_002551730.1| mammalian cell entry related domain-containing protein [Acidovorax
           ebreus TPSY]
 gi|221728910|gb|ACM31730.1| Mammalian cell entry related domain protein [Acidovorax ebreus
           TPSY]
          Length = 325

 Score = 63.2 bits (152), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 65/317 (20%), Positives = 136/317 (42%), Gaps = 65/317 (20%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K++  + G+FV+++         WL+R +Q D  + E+  +   SV GL   ++VR+
Sbjct: 1   MENKSHALAAGIFVIAVAALLAGLGMWLTR-DQTDYQLYELSSK--DSVSGLQPQAAVRY 57

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIEL------ 114
            G+ VG++  +  D +   + L +  +  D P+ P+T AT+  QG+ G+ +++L      
Sbjct: 58  KGVAVGKVTHIGFDPQVAGNVLIRIAVNADAPISPTTFATLGYQGVTGLAHVQLDDAEAP 117

Query: 115 ---------------------STLRKEKKTIFQIATERNQRAMITATPSGINYFISNAEN 153
                                S L ++   I     E  QR         IN  + + EN
Sbjct: 118 LPAPPPGASGLPRLPLHSSSFSQLAEQGPAILGQVQEATQR---------INTLLGD-EN 167

Query: 154 TS------KKISDSSRHIQKIIENIEKPLTTTIANIETISTVLANNISHIDKMMHTTQVT 207
                   K++ D++  I ++   ++           T++T L   ++ +  ++  TQ T
Sbjct: 168 QQRFSTALKQLGDAAGSIDQLARRLDN----------TVTTRLDPALAGVPPLVQDTQQT 217

Query: 208 PHS-----SDSKNTFNTITDLITSLDKMIKAIDLQKVNQILENIQVSSNNFVKSSDQVIN 262
             +     S +    N ++  I +L     A+D  ++    +++  +++ F + +   IN
Sbjct: 218 LQALRQAGSSAATAANDVSQAIRTLQAEGGALD--EIAAGAKSLAGAADRFGRVTLPRIN 275

Query: 263 TVHDVRETTQTFQEVGQ 279
             H   ET +  + +G+
Sbjct: 276 --HAADETARAARRLGR 290


>gi|288962791|ref|YP_003453085.1| ABC transport system substrate-binding protein [Azospirillum sp.
           B510]
 gi|288915057|dbj|BAI76541.1| ABC transport system substrate-binding protein [Azospirillum sp.
           B510]
          Length = 319

 Score = 63.2 bits (152), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 51/203 (25%), Positives = 95/203 (46%), Gaps = 6/203 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++  Y  VG FV++++        W+++  Q D       I   GSV GL   S VR+
Sbjct: 1   METRASYVLVGSFVLALVAGLLVFTAWIAKV-QLDETRETYRIYFTGSVTGLQQGSPVRY 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G+PVG +  + LD +          ++  TP+   + A++  QG+ G  Y+++S     
Sbjct: 60  RGVPVGTVADIRLDPDNVTRVRVTIQVQNGTPIMSDSIASLELQGITGGAYVQISGGTVG 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKII--ENIEKPLTT 178
            K +   AT+ +    I + PS +   + +A     +  +    + +++  EN +K +  
Sbjct: 120 GKHL--TATDADGVPTIPSRPSSLTAVVDSAPQLVNRSLEVVTRLGEMLNGEN-QKAVAD 176

Query: 179 TIANIETISTVLANNISHIDKMM 201
            +AN  TIS  LA   + +++ M
Sbjct: 177 ILANARTISAELAGASAGLEETM 199


>gi|148925787|ref|ZP_01809475.1| possible ABC transport system periplasmic substrate-binding protein
           [Campylobacter jejuni subsp. jejuni CG8486]
 gi|145845797|gb|EDK22888.1| possible ABC transport system periplasmic substrate-binding protein
           [Campylobacter jejuni subsp. jejuni CG8486]
          Length = 296

 Score = 63.2 bits (152), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 69/282 (24%), Positives = 127/282 (45%), Gaps = 41/282 (14%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++  Y  VGLFV  + F S   I WL   ++ +       I    SV GL   + VR 
Sbjct: 1   MENRANYFFVGLFVFGVFFASLGFILWLGGYSKEE-SFKYYEIHTQESVAGLGVKAPVRL 59

Query: 61  NGIPVGRI--VGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLR 118
            G+ VG +  +G++   E   +   K  ++ +TP+   T AT++ QG+ G+ +++L    
Sbjct: 60  LGVEVGSVEEIGIYNQDELGVNIRIK--VKNNTPIKEDTFATLQLQGITGLKFVQLQGGS 117

Query: 119 KEKKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIE---KP 175
           K  K +  I         +   P   ++  +        I   S HI  +++  +   K 
Sbjct: 118 KNSKDLVSI------HGKLPVIPFKESFLAT--------IDRQSEHIFSLVKTADDKSKE 163

Query: 176 LTT--TIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKA 233
           L +   + N+E    +L  N++ +   ++T        +SKN    +++    + KM   
Sbjct: 164 LLSEKNLKNLE----ILLQNLAELSANLNT--------NSKNLSLNLSNASLKIGKMADN 211

Query: 234 IDL--QKVNQILENIQVSS---NNFVKSSDQVINTVHDVRET 270
           I L  Q  N  L++I+ S+    NF+K +D+ +NT  D++ +
Sbjct: 212 ISLSAQNFNSSLKDIKESTMILKNFIKKADEKLNTYDDIKAS 253


>gi|188590869|ref|YP_001795469.1| ABC transporter periplasmic protein [Cupriavidus taiwanensis LMG
           19424]
 gi|170937763|emb|CAP62747.1| putative ABC-type transporter, periplasmic component [Cupriavidus
           taiwanensis LMG 19424]
          Length = 314

 Score = 62.8 bits (151), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 32/114 (28%), Positives = 63/114 (55%), Gaps = 3/114 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K++    G+F + +     F+I+W S  +    P  ++I R   +V+GL   + V++
Sbjct: 2   MENKSHAFLAGVFTIGLAVLVLFAIFWFSSDHAVRVPY-DLITR--STVNGLGPQADVKY 58

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIEL 114
            G+ VG++  +  D + P   + +  +  +TP+  +T AT+  QG+ GI Y++L
Sbjct: 59  RGLAVGKVESIKFDPQVPGQIIVRVNVNRETPITRTTYATLGFQGVTGIAYVQL 112


>gi|325294997|ref|YP_004281511.1| Mammalian cell entry related domain protein [Desulfurobacterium
           thermolithotrophum DSM 11699]
 gi|325065445|gb|ADY73452.1| Mammalian cell entry related domain protein [Desulfurobacterium
           thermolithotrophum DSM 11699]
          Length = 528

 Score = 62.8 bits (151), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 82/346 (23%), Positives = 150/346 (43%), Gaps = 71/346 (20%)

Query: 49  VDGLSTDSSVRFNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAG 108
           V GL  D+ VR  G+ VG+++G+ + +   N ++ + +      LY   +A I T GL G
Sbjct: 50  VAGLEKDAPVRVAGVTVGKVIGIKVKE---NSAIVEIIFLKPVKLYKDASARIETMGLMG 106

Query: 109 ITYIEL---STLRKEKKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHI 165
             Y+EL   S L  E  +      E+ Q      +PS I+  IS    T +K +++    
Sbjct: 107 EKYVELNPGSPLNPELPS--GAVIEKTQ-----DSPS-IDELISALYETIEKFNNAL--- 155

Query: 166 QKIIENIEKPLTTTIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLIT 225
             I  N E  L   +  I  ++       SHIDK ++   +     +++ T   + +   
Sbjct: 156 --ITPNGENRLAVIMDKISQLT-------SHIDKAVN--NLNGMMEENRKTIKEVLENAL 204

Query: 226 SLDKMIKAIDLQKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLL 285
            L   +K    +++ QI++N+   +      S+  +    D+RET  + +EV        
Sbjct: 205 VLSSTLK----EELPQIMDNVNSLTTQL---SEIAVENRQDIRETIVSLREV-------- 249

Query: 286 SDFSSKMKSKETSAFLENIADSTSNMRSSISAIREITDQRQKII--STINTIENITSNLN 343
           S+ + K+  K                      I ++T Q QK++    +  I+ IT NL 
Sbjct: 250 SERAPKIAEK----------------------IDKLTSQIQKLLNEENLQNIQEITKNLK 287

Query: 344 DSSQKFAELMSKINN----ISALKENNSLFKDAQRAMHTFRDTSEK 385
            +S++F EL++K+N     I  L  + +L+K+  +   T    ++K
Sbjct: 288 STSKEFKELLTKVNEGKGTIGKLFNDETLYKNLSKTTETLGKVADK 333


>gi|319788027|ref|YP_004147502.1| hypothetical protein Psesu_2439 [Pseudoxanthomonas suwonensis 11-1]
 gi|317466539|gb|ADV28271.1| Mammalian cell entry related domain protein [Pseudoxanthomonas
           suwonensis 11-1]
          Length = 308

 Score = 62.8 bits (151), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 76/301 (25%), Positives = 130/301 (43%), Gaps = 29/301 (9%)

Query: 1   MESKNYYTSVGLFV----VSILFFSFFSIYWLS-RSNQYDGPMAEVIIRIPGSVDGLSTD 55
           ME++  Y  +G F     V++L F  ++  + S RS Q        +I    +V GLS  
Sbjct: 1   METRANYVLIGAFTIVVSVALLLFGLWAAKYSSERSWQ------RYMIVFDEAVTGLSAG 54

Query: 56  SSVRFNGIPVGRIVGLFLDQEYPNHSLAKALIRPDT--PLYPSTTATIRTQGLAGITYIE 113
           S+V++NGI +G I  L LD + P   +  A+IR D   P+   T A +    L G   I+
Sbjct: 55  STVQYNGISIGSIDKLSLDPQDPRRVV--AIIRADASVPVKTDTRAKLAITSLTGPAIIQ 112

Query: 114 LSTLRKEKKTIFQIATERNQRAMITATPSGINYFISNA----ENTSKKISDSS-RHIQKI 168
           LS            A +      I   PS +      A    E   + +SD +  HI + 
Sbjct: 113 LSG--GSPGAPLLTAVDTRDTPQIQTAPSALQNIADTANRIVERLDQVLSDQNVAHIGRT 170

Query: 169 IENIEKPLTTTIANIETISTVLA---NNISHIDKMMHTTQVTPHSSDSKNTFNTITDLIT 225
           +ENIE+   +  A  E +  +LA   +    +D  +  T  T    D +N    +  LI+
Sbjct: 171 LENIEQISASLAAKDEGMQDLLATARDAARSLDVTLQNTNATVQRVD-QNLVQELPALIS 229

Query: 226 SLDKMIKAIDLQKVN--QILENIQVSSNNFVKSS-DQVINTVHDVRETTQTFQEVGQKID 282
            LD  +  +D    N   IL   + + N+F      Q+  T+ ++R   +  +++  +++
Sbjct: 230 RLDSTLARLDSAAGNADAILGENRAAINSFANDGLAQLGPTLTELRGLIRDLRQISDRLE 289

Query: 283 H 283
           +
Sbjct: 290 N 290


>gi|119385046|ref|YP_916102.1| hypothetical protein Pden_2315 [Paracoccus denitrificans PD1222]
 gi|119374813|gb|ABL70406.1| Mammalian cell entry related domain protein [Paracoccus
           denitrificans PD1222]
          Length = 433

 Score = 62.8 bits (151), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 66/304 (21%), Positives = 132/304 (43%), Gaps = 37/304 (12%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K  Y  +G F ++        + W ++  Q D   A   I  P  V GL   S V F
Sbjct: 1   METKANYVLIGAFTIAGFLGMLLFLMWFAKL-QLDRQFAYYDIYFP-EVSGLGVSSEVLF 58

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G+ VG++V + L          +  +  DTP+   + A+I  QG+ GI  + +++ R +
Sbjct: 59  AGLSVGKVVDMQLSPSVNGAVRVRVEVAEDTPVRTDSRASIEIQGVTGIANVAITSGRPD 118

Query: 121 KKTIFQIATE------RNQRAMITAT---PSGINYFISNAENTSKKISDSSR-HIQKIIE 170
              +  +  +       N+ A+ T +   P  ++   + AE  +K + D ++  ++ I++
Sbjct: 119 SPLLRDVDPDSIPVIAANRSALQTLSEQGPEMLSRLNTVAEQLTKLLGDENQDRVRNILD 178

Query: 171 NIEKP---LTTTIANIETISTVLANNISHI-------DKMMHTTQVTPHSSDSK-NTFN- 218
           N+E+    L   +A++ T +  +A+  S I       D +    + T  ++D+    FN 
Sbjct: 179 NVERSSANLDKALADVTTATDSIASAASDISAFGERLDGLSAAAETTLGNADTALAKFNE 238

Query: 219 TITDLITSLDKMIKAID-------------LQKVNQILENIQVSSNNFVKSSDQVINTVH 265
           +   + T+LD     +D              Q+++Q    +Q   N   + +DQ ++++ 
Sbjct: 239 SAAKVDTALDSGTATLDEVRAYVSGDLKTLTQRLDQTAATLQSDLNRLTERADQSLDSLD 298

Query: 266 DVRE 269
              E
Sbjct: 299 AALE 302


>gi|315498541|ref|YP_004087345.1| mammalian cell entry related domain protein [Asticcacaulis
           excentricus CB 48]
 gi|315416553|gb|ADU13194.1| Mammalian cell entry related domain protein [Asticcacaulis
           excentricus CB 48]
          Length = 320

 Score = 62.8 bits (151), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 47/190 (24%), Positives = 92/190 (48%), Gaps = 4/190 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME + +Y  VGL  + +   +F   +WL + + ++   +E  +    SV+GL+    V F
Sbjct: 1   MERQAHYAVVGLITLVLTAAAFVFAFWLIQGS-FNETYSEYDVVFNSSVNGLTEGGEVHF 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NGI VG +  L L +      +A   +   TP+   +TA +   G+ G+ YI++S   KE
Sbjct: 60  NGIKVGEVKELRLGKANTAQVIATVRVDSSTPVRVDSTAVLEPLGVTGLNYIQISPGSKE 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKII--ENIEKPLTT 178
              + +      +  +I AT S ++  ++ +    +   +S   I +++  +N+    + 
Sbjct: 120 AALLKREPGIGARNPIIRATESRLDKLLAGSGGVIESAYESLNRINRLMSDDNL-NAFSK 178

Query: 179 TIANIETIST 188
           T+ NIE I++
Sbjct: 179 TMKNIEDITS 188


>gi|237747196|ref|ZP_04577676.1| predicted protein [Oxalobacter formigenes HOxBLS]
 gi|229378547|gb|EEO28638.1| predicted protein [Oxalobacter formigenes HOxBLS]
          Length = 293

 Score = 62.4 bits (150), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 36/115 (31%), Positives = 62/115 (53%), Gaps = 3/115 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K++    GLF V ++  +   +++L+       P    +I    S+ GL+  ++VRF
Sbjct: 2   MENKSHAFIAGLFTVCLVAAALLIVWFLNMDRTVRVP---YMIATNQSIPGLNPQATVRF 58

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELS 115
            G+ VGR+  +  + + P   L    ++ DTP+  ST AT+  QG+ GI  +ELS
Sbjct: 59  RGLDVGRVTNIGFNPKEPGEILIHFEVKEDTPMTKSTFATLTYQGVTGIASVELS 113


>gi|329851288|ref|ZP_08266045.1| mce related family protein [Asticcacaulis biprosthecum C19]
 gi|328840134|gb|EGF89706.1| mce related family protein [Asticcacaulis biprosthecum C19]
          Length = 311

 Score = 62.4 bits (150), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 68/305 (22%), Positives = 135/305 (44%), Gaps = 49/305 (16%)

Query: 1   MESKNYYTSVGL--FVVSILFFSFFSIYWLSRS--NQYDGPMAEVIIRIPGSVDGLSTDS 56
           ME + +Y  VGL  FV++++  +F   +W  +   NQ  G + +V    P  VD L+  +
Sbjct: 1   MERQAHYAFVGLVTFVMALILLAF--TFWFIKFDFNQEFG-VYDVEFNQP--VDFLNKGA 55

Query: 57  SVRFNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELST 116
            V FNGI VG +  L L +       A+  +  +TP+   + AT++ QG+ G+ Y+    
Sbjct: 56  EVHFNGIKVGEVTSLRLGKANTAQVFARIKLDSETPIRVDSVATLQPQGITGLLYM---- 111

Query: 117 LRKEKKTIFQIATERNQRAMITATPSGINYFISNAENT-SKKISDSSRHIQKIIENIE-- 173
                    QI+       ++   P G    I + E+  +K +  S   ++K  E+++  
Sbjct: 112 ---------QISPGSASSPLLKRKPGGPPPVIRSEESALAKLLQGSGSVVEKTYESLDRV 162

Query: 174 ---------KPLTTTIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLI 224
                    K  + T+ N+++I+  + N    +D           ++D+      IT L 
Sbjct: 163 NRLLSDRNIKTFSDTLDNLQSITADIENRQQMLDDAHEAVISAGQAADA------ITKLA 216

Query: 225 TSLDKMIKAIDLQKVNQILENIQVSSNNFVKSSDQVINTVHDVRET-----TQTFQEVGQ 279
            S D ++     Q++ + LE I  +++    ++++V      V+       TQT  ++ +
Sbjct: 217 NSTDGVMA----QQLPETLEKINAATDKLATAAERVSVVADSVKGPADQINTQTLPQMQE 272

Query: 280 KIDHL 284
            +++L
Sbjct: 273 SLENL 277


>gi|241761772|ref|ZP_04759858.1| Mammalian cell entry related domain protein [Zymomonas mobilis
           subsp. mobilis ATCC 10988]
 gi|241373686|gb|EER63246.1| Mammalian cell entry related domain protein [Zymomonas mobilis
           subsp. mobilis ATCC 10988]
          Length = 315

 Score = 62.4 bits (150), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 73/337 (21%), Positives = 146/337 (43%), Gaps = 54/337 (16%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSR-----SNQYDGPMAEVIIRIPGSVDGLSTD 55
           ME+++ Y  VG   + +L      + W+ R     ++QYD       I    SVDGL+  
Sbjct: 1   METRSNYILVGSITLILLALIATVLVWIGRVSGTETHQYD-------IFFHQSVDGLAKG 53

Query: 56  SSVRFNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELS 115
           SSV ++G+P G++  + L    P+    +  +  DTP+   TTATI + G +G++ I L+
Sbjct: 54  SSVSYSGVPSGQVKEIKLLPNNPDFVRVRISLNADTPVLEGTTATISSMGFSGVSQITLA 113

Query: 116 TLRKEKKTI-----FQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKII- 169
                 K I     F +        +I   P  +   +++A    ++I+  +  +  ++ 
Sbjct: 114 GGVSGAKPIENHGPFGV-------PVIPTKPGALGQLLNSAPQLLERITTLTERMSDLLN 166

Query: 170 ENIEKPLTTTIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDK 229
           ++ ++ +   + N+ T+S  LAN    + ++M          D+ +              
Sbjct: 167 DHNQRSIARILDNMNTLSGNLANQSPKMRQIM---------DDAHHAL------------ 205

Query: 230 MIKAIDLQKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFS 289
               ++L    Q +  +  ++NN VK  D    T H ++ET    ++  Q ++ +L D  
Sbjct: 206 ----VNLSDAGQQISELAQTTNNTVK-QDIHPATAH-LKETVMAARDSMQNLNDMLLDAR 259

Query: 290 SKMK--SKETSAFLENIADSTSNMRSSISAIREITDQ 324
             +   S ET    + +     +M  S+S++ +  +Q
Sbjct: 260 PGVHHFSNETMPQFDQLVHDLHDMIGSMSSLTDRLNQ 296


>gi|225851011|ref|YP_002731245.1| mce related protein [Persephonella marina EX-H1]
 gi|225646722|gb|ACO04908.1| mce related protein [Persephonella marina EX-H1]
          Length = 514

 Score = 62.0 bits (149), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 90/365 (24%), Positives = 167/365 (45%), Gaps = 60/365 (16%)

Query: 10  VGLFVVSI-LFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRFNGIPVGRI 68
           VGLFV+ I   F++ +I +  R    D     +   +   V+GLS  + V+  G+ VGR+
Sbjct: 7   VGLFVLIISGIFAYLTIAFNDRGFGQDTQDYYIYFNM---VEGLSKGADVQVKGVKVGRV 63

Query: 69  VGLFLDQEYPNHSL-AKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKEKKTIFQI 127
                D  + N  +  K  IR D PLY +  A IRT GL G  Y+ +     +   + + 
Sbjct: 64  E----DIVFKNSIVEVKVSIRKDVPLYKNAVAYIRTLGLMGDKYVYIDPGTPDAGKLPEK 119

Query: 128 ATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTIANIETIS 187
           A  R  +   +A  +      S+A + +KK+     ++ K IE  E  LT  I  I  ++
Sbjct: 120 AIIRKGQVFTSAEEA-----FSSAADVAKKVEILVDNLNKAIE--EGNLTELIRRIRVLA 172

Query: 188 TVLANNISHIDKMMHTTQVTPHSSDSKNTFN---TITD-LITSLDKMIKAIDLQKVNQIL 243
                   H D++     V  +  D + T      ITD L T L ++I  +D  ++   L
Sbjct: 173 -------EHTDQL-----VQENRRDLRRTIENVRVITDNLRTHLPELIAKLD--RITTHL 218

Query: 244 ENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFS-SKMKSKETSAFLE 302
           E I  + +N     D +   V +++ET+   +E   K   +L D   + ++ ++T     
Sbjct: 219 EAI--TGDN----RDDIRELVKNLKETSVALKE---KTPKVLEDIDQAALQVRDT----- 264

Query: 303 NIADSTSNMRSSISAIREITDQRQKIISTIN----TI------ENITSNLNDSSQKFAEL 352
            + ++  ++RS++  I++ + +  +I++ I+    TI      +++ +N+N+  + FA+ 
Sbjct: 265 -VGENREDIRSAVEKIKDASLKLDRILAKIDEGKGTIGKLVNEDDLYNNVNEGVKSFAKP 323

Query: 353 MSKIN 357
              IN
Sbjct: 324 FKVIN 328


>gi|195953213|ref|YP_002121503.1| virulence factor Mce family protein [Hydrogenobaculum sp. Y04AAS1]
 gi|195932825|gb|ACG57525.1| virulence factor Mce family protein [Hydrogenobaculum sp. Y04AAS1]
          Length = 523

 Score = 62.0 bits (149), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 89/414 (21%), Positives = 176/414 (42%), Gaps = 76/414 (18%)

Query: 1   MESKNYYTSVGLFVV-SILFFSFFSI------YWLSRSNQYDGPMAEVIIRIPGSVDGLS 53
           M+SK  Y  +GLF++ S + F+F +I      Y+  +SN Y+  +         +V GLS
Sbjct: 1   MKSK--YFKLGLFLLLSAIAFAFMAISFSSIRYFFEKSNTYEALLD--------NVHGLS 50

Query: 54  TDSSVRFNGIPVGRIVGLFLDQEYPNHSLAKAL-IRPDTPLYPSTTATIRTQGLAGITYI 112
             + VR NG+  GR+  +     + N  +     ++ D P+Y     +I T GL G  Y+
Sbjct: 51  VGAEVRVNGVKAGRVEKI----SFRNGKVLVVFSVKKDIPIYKDAEVSIGTLGLMGDKYV 106

Query: 113 ELSTLRKEKKTIFQIATERNQRAMI--TATPSGINYFISNAENTSKKISDSSRHIQKIIE 170
            +    +E  +I+    E    +MI      S     I N  NT+K  S  + ++  II 
Sbjct: 107 SV----EEGHSIY---GELPPNSMIENIGVSSDTESLIKNLNNTAKNFSVVASNLASIIS 159

Query: 171 NIEKPLTTTIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKM 230
                +   I N+++++        +++ M+   Q            + +   I++LD +
Sbjct: 160 QNRDQIQGIIQNLDSLT-------KNLNTMVAQNQ------------DALRQTISNLDML 200

Query: 231 IKAIDLQKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSS 290
              ++L  + Q + +I  ++ N  + + Q      D+R   +            L   SS
Sbjct: 201 TYQLNL-TLPQTIADIDRTAKNLAQITGQ---NKEDIRTLVEN-----------LKVLSS 245

Query: 291 KMKSKETSAFLENIADSTSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFA 350
            +K  +T   + N+   + N+ + +       + +  + ++I     ++ +L  SS +  
Sbjct: 246 TLKD-QTPVLMANLNTLSQNLNNLV------VENQNGVHTSIKNFAELSKSLKQSSDELN 298

Query: 351 ELMSKINN----ISALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNF 400
           ++++KIN     +  L  + SL+ +A  A+ TF    + +NR    IG   + F
Sbjct: 299 QILAKINTGQGTLGKLVNDKSLYANANDALSTFSHFGKIVNRSNLYIGGRFELF 352


>gi|91786143|ref|YP_547095.1| hypothetical protein Bpro_0232 [Polaromonas sp. JS666]
 gi|91695368|gb|ABE42197.1| Mammalian cell entry related protein [Polaromonas sp. JS666]
          Length = 310

 Score = 62.0 bits (149), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 41/175 (23%), Positives = 80/175 (45%), Gaps = 14/175 (8%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQ----YDGPMAEVIIRIPGSVDGLSTDS 56
           ME+K +  + G FV+ +         WL+R N     Y+    E       SV GL   +
Sbjct: 1   MENKAHAMAAGAFVLVVTALLVMLAVWLTRDNTQRNLYEMSTGE-------SVSGLQPQA 53

Query: 57  SVRFNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELST 116
           +VRF G+PVG++  +  D +   + L +  I    P+  ST AT+ +QG+ G+ +I+L  
Sbjct: 54  AVRFRGVPVGKVELIGFDTKVKGNVLIRVSIDRSAPVTKSTFATVASQGVTGLGFIQLD- 112

Query: 117 LRKEKKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIEN 171
              +  +  ++         I   P G++  +  ++    ++  +S  + K++ +
Sbjct: 113 --DDGSSPERLVPNDEDPPRIPLKPGGLDKLLKQSDVIFDQVEQASTRLNKLLSD 165


>gi|187476647|ref|YP_784670.1| hypothetical protein BAV0132 [Bordetella avium 197N]
 gi|115421233|emb|CAJ47738.1| putative exported protein [Bordetella avium 197N]
          Length = 308

 Score = 62.0 bits (149), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 69/318 (21%), Positives = 128/318 (40%), Gaps = 38/318 (11%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQ----YDGPMAEVIIRIPGSVDGLSTDS 56
           ME++++    G+F + +L  +     W+ R       YD     ++   P  V GL+  S
Sbjct: 1   MENRSHALLAGVFTLVLLVAAALVAVWVGRDRTAFKFYD-----IVSSTP--VSGLTAQS 53

Query: 57  SVRFNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELST 116
           +VR+ G+PVG++  L L+   P     +  + P TP+  ST A I  QG+ G   IE   
Sbjct: 54  AVRYQGVPVGKVQSLVLNPHKPGEVRIRIGVAPTTPITASTWAEIGVQGVTGQANIE--- 110

Query: 117 LRKEKKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPL 176
           LR    +   +    +Q   I   P   +           K  D++  ++K++ +     
Sbjct: 111 LRDNGSSKELLVARGDQLPDIPLRPGFFDRLEQRGNALMAKFEDTAEELRKLMSH----- 165

Query: 177 TTTIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMI--KAI 234
               +N+E +   L  N + I     +TQ+   S D       +  L+ SLD+     A 
Sbjct: 166 ----SNVEALGVTL-KNTAEI-----STQLNQVSRDLAPALRKVGPLVDSLDRASADAAQ 215

Query: 235 DLQKVNQILENIQVSSNNFVKSSDQVINTVHDV-RETTQTFQEVGQKIDHLLSDFSSKMK 293
            +Q  +Q L  +         +      ++ D+ R   +  Q+    +  + +  S   +
Sbjct: 216 LMQAASQSLARLNAPDGPLANAG----RSLQDIARAAARLNQDTLPAMTGMANSVSGAAR 271

Query: 294 SKETSAFLENIADSTSNM 311
             +T   L N+ DS  ++
Sbjct: 272 DAQT--VLRNLGDSPQSL 287


>gi|296284590|ref|ZP_06862588.1| ABC-type transport system periplasmic component [Citromicrobium
           bathyomarinum JL354]
          Length = 317

 Score = 62.0 bits (149), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 69/301 (22%), Positives = 143/301 (47%), Gaps = 23/301 (7%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++  +  VG   + +L      I W++   + D    E  I    SV GL+  SSV F
Sbjct: 1   METRANHVWVGAVTLLLLAALALFIVWIAGLGEND--RKEYDIFFKQSVAGLANGSSVSF 58

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G+PVG++  + L +  P     +  ++P+ P+   TTAT+++    G++ I L   RK 
Sbjct: 59  AGVPVGQVRDISLWETDPEFVRVRIAVKPEVPVLVGTTATVQSS-FTGVSTILLDGARKG 117

Query: 121 KKTIFQIATERNQRA-MITATPSGINYFISNAENTSKKISDSSRHIQKII-ENIEKPLTT 178
           +  I    T   + A +I     G    ++NA    +++S  +  +  ++ ++ ++ L+ 
Sbjct: 118 RPPITCETTACPEGAPVIPPKAGGFGEILANAPLLLERLSTLTERLTMLLSDDNQRELSG 177

Query: 179 TIANIETISTVLANNISHIDKMMHTTQVT-PHSSDSKNTF----NTITDLIT----SLDK 229
            + N   ++  +A+    +   +   Q+T   +S++ ++F    N+  +L+     SL K
Sbjct: 178 ILRNTNRVTADVADATPQLKGALAEMQITLREASEALDSFERTTNSANELLNNEGESLAK 237

Query: 230 MIKAIDLQK-------VNQILENIQVSSNNFVKSSDQVIN-TVHDVRETTQTFQEVGQKI 281
            ++   LQK       +NQ LE  Q +  +  + +    N T+ D++ T+++ + + Q+I
Sbjct: 238 ELRGT-LQKANQAADTLNQTLEQAQPAVRSLNEKTLPSANATLEDLQATSRSLRSLTQRI 296

Query: 282 D 282
           +
Sbjct: 297 E 297


>gi|205355660|ref|ZP_03222430.1| possible ABC transport system periplasmic substrate binding protein
           [Campylobacter jejuni subsp. jejuni CG8421]
 gi|205346437|gb|EDZ33070.1| possible ABC transport system periplasmic substrate binding protein
           [Campylobacter jejuni subsp. jejuni CG8421]
          Length = 296

 Score = 62.0 bits (149), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 67/281 (23%), Positives = 127/281 (45%), Gaps = 39/281 (13%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++  Y  VGLFV  + F S   I WL   ++ +       I    SV GL   + VR 
Sbjct: 1   MENRANYFFVGLFVFGVFFASLGFILWLGGYSKEE-SFKYYEIHTQESVAGLGVKAPVRL 59

Query: 61  NGIPVGRI--VGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLR 118
            G+ VG +  +G++   E   +   K  ++ +TP+   T AT++ QG+ G+ +++L    
Sbjct: 60  LGVEVGSVEEIGIYNQDELGVNIRIK--VKNNTPIKEDTFATLQLQGITGLKFVQLQGGS 117

Query: 119 KEKKTIFQ-------IATERNQRAMITATPSGINYFISNAENTSKKI--SDSSRHIQKII 169
           K  K +         I  + +  A I      I   +  A++ SK++    + ++++ ++
Sbjct: 118 KNSKDLVSIHGKLPVIPFKESFLATIDRQSEHIFSLVKTADDKSKELLSEKNLKNLEILL 177

Query: 170 ENIEKPLTTTIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDK 229
           +N+ +      AN + +S  L+N    I KM     ++  +      FN      +SL  
Sbjct: 178 QNLAELSANLNANSKNLSLNLSNASLKIGKMADNISLSAQN------FN------SSLK- 224

Query: 230 MIKAIDLQKVNQILENIQVSSNNFVKSSDQVINTVHDVRET 270
                D+++   IL+       NF+K +D+ +NT  D++ +
Sbjct: 225 -----DIKESTMILK-------NFIKKADEKLNTYDDIKAS 253


>gi|207727755|ref|YP_002256149.1| abc-type transport system involved in resistance to organic
           solvents, periplasmic component protein [Ralstonia
           solanacearum MolK2]
 gi|206590996|emb|CAQ56608.1| abc-type transport system involved in resistance to organic
           solvents, periplasmic component protein [Ralstonia
           solanacearum MolK2]
          Length = 333

 Score = 62.0 bits (149), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 30/114 (26%), Positives = 61/114 (53%), Gaps = 3/114 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++ +    GLF + +  F   ++ W +R      P  +V+ R   +V+GLS  ++V++
Sbjct: 1   MENRAHAFLAGLFTIGLAIFVALAVVWFNRDQTVRVPY-DVVTR--STVNGLSPQAAVKY 57

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIEL 114
            G+ VG++  +  D + P   + + L+  D P+  +T   +  QG+ G+ Y++L
Sbjct: 58  RGLDVGKVDTIRFDDKVPGQIIVRVLVDKDAPITTTTYGRLAYQGVTGLAYVQL 111


>gi|71274909|ref|ZP_00651197.1| Mce4/Rv3499c/MTV023.06c protein [Xylella fastidiosa Dixon]
 gi|71898797|ref|ZP_00680965.1| Mce4/Rv3499c/MTV023.06c protein [Xylella fastidiosa Ann-1]
 gi|71901851|ref|ZP_00683914.1| Mce4/Rv3499c/MTV023.06c protein [Xylella fastidiosa Ann-1]
 gi|170729827|ref|YP_001775260.1| ABC transporter permease [Xylella fastidiosa M12]
 gi|71164641|gb|EAO14355.1| Mce4/Rv3499c/MTV023.06c protein [Xylella fastidiosa Dixon]
 gi|71728379|gb|EAO30547.1| Mce4/Rv3499c/MTV023.06c protein [Xylella fastidiosa Ann-1]
 gi|71731383|gb|EAO33446.1| Mce4/Rv3499c/MTV023.06c protein [Xylella fastidiosa Ann-1]
 gi|167964620|gb|ACA11630.1| ABC transporter permease [Xylella fastidiosa M12]
          Length = 308

 Score = 62.0 bits (149), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 69/294 (23%), Positives = 132/294 (44%), Gaps = 17/294 (5%)

Query: 1   MESKNYYTSVGLF-VVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVR 59
           ME+K  Y  +G F +++ L    F ++    S+        V+ R   +V GLS  S V+
Sbjct: 1   METKANYVLIGSFTILTGLALLIFGLWAAKYSSDRTWQNYRVVFR--EAVTGLSVGSPVQ 58

Query: 60  FNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRK 119
           +NGI +G I  L L    P   +A   +   TP+   T A +    L G + I+LS    
Sbjct: 59  YNGIAIGSITQLTLAPNDPRQVVAHIRVNSTTPVKKDTRAKLAITSLTGPSIIQLSGGTP 118

Query: 120 EKKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISD-----SSRHIQKIIENIEK 174
           E  ++  I   ++   +I  TPS +      A +  +++ D     +   I  I++N++K
Sbjct: 119 ESPSLTSI--YKDDAPIIQTTPSALQNITDTANDIVERLYDVLSDKNVAAISTILQNMQK 176

Query: 175 PLTTTIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKM---I 231
            ++  +++ +T    L  +     + ++TT  T + +  +   N +  L   L+K+   +
Sbjct: 177 -ISGQVSDSDTGLEALLTSARDATRQLNTTLTTANGTVQQLDNNLVKQLPVILNKLEATL 235

Query: 232 KAID--LQKVNQILENIQVSSNNFVKSS-DQVINTVHDVRETTQTFQEVGQKID 282
             ID      N IL+N Q + N+F      Q   T+ ++R   +  +++  K++
Sbjct: 236 TKIDATASNANSILDNNQAAINSFANEGLSQFAPTMSELRNLIRDLRQISNKLE 289


>gi|260752532|ref|YP_003225425.1| hypothetical protein Za10_0289 [Zymomonas mobilis subsp. mobilis
           NCIMB 11163]
 gi|258551895|gb|ACV74841.1| Mammalian cell entry related domain protein [Zymomonas mobilis
           subsp. mobilis NCIMB 11163]
          Length = 315

 Score = 61.6 bits (148), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 73/337 (21%), Positives = 146/337 (43%), Gaps = 54/337 (16%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSR-----SNQYDGPMAEVIIRIPGSVDGLSTD 55
           ME+++ Y  VG   + +L      + W+ R     ++QYD       I    SVDGL+  
Sbjct: 1   METRSNYILVGSITLILLALIATILVWIGRVSGTETHQYD-------IFFHQSVDGLAKG 53

Query: 56  SSVRFNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELS 115
           SSV ++G+P G++  + L    P+    +  +  DTP+   TTATI + G +G++ I L+
Sbjct: 54  SSVSYSGVPSGQVKEIKLLPNNPDFVRVRISLNADTPVLEGTTATISSMGFSGVSQITLA 113

Query: 116 TLRKEKKTI-----FQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKII- 169
                 K I     F +        +I   P  +   +++A    ++I+  +  +  ++ 
Sbjct: 114 GGVSGAKPIENHGPFGV-------PVIPTKPGALGQLLNSAPQLLERITTLTERMSDLLN 166

Query: 170 ENIEKPLTTTIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDK 229
           ++ ++ +   + N+ T+S  LAN    + ++M          D+ +              
Sbjct: 167 DHNQRSIARILDNMNTLSGNLANQSPKMRQIM---------DDAHHAL------------ 205

Query: 230 MIKAIDLQKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFS 289
               ++L    Q +  +  ++NN VK  D    T H ++ET    ++  Q ++ +L D  
Sbjct: 206 ----VNLSDAGQQISELAQTTNNTVK-QDIHPATAH-LKETVMAARDSMQNLNDMLLDAR 259

Query: 290 SKMK--SKETSAFLENIADSTSNMRSSISAIREITDQ 324
             +   S ET    + +     +M  S+S++ +  +Q
Sbjct: 260 PGVHHFSNETMPQFDQLVHDLHDMIGSMSSLTDRLNQ 296


>gi|83748498|ref|ZP_00945519.1| Hypothetical exported protein [Ralstonia solanacearum UW551]
 gi|207742156|ref|YP_002258548.1| abc-type transport system involved in resistance to organic
           solvents, periplasmic component protein [Ralstonia
           solanacearum IPO1609]
 gi|83724802|gb|EAP71959.1| Hypothetical exported protein [Ralstonia solanacearum UW551]
 gi|206593544|emb|CAQ60471.1| abc-type transport system involved in resistance to organic
           solvents, periplasmic component protein [Ralstonia
           solanacearum IPO1609]
          Length = 333

 Score = 61.6 bits (148), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 30/114 (26%), Positives = 61/114 (53%), Gaps = 3/114 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++ +    GLF + +  F   ++ W +R      P  +V+ R   +V+GLS  ++V++
Sbjct: 1   MENRAHAFLAGLFTIGLAIFVALAVVWFNRDQTVRVPY-DVVTR--STVNGLSPQAAVKY 57

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIEL 114
            G+ VG++  +  D + P   + + L+  D P+  +T   +  QG+ G+ Y++L
Sbjct: 58  RGLDVGKVDTIRFDDKVPGQIIVRVLVDKDAPITTTTYGRLAYQGVTGLAYVQL 111


>gi|300705333|ref|YP_003746936.1| ABC transporter periplasmic component [Ralstonia solanacearum
           CFBP2957]
 gi|299072997|emb|CBJ44354.1| putative ABC-type transporter, periplasmic component (resistance to
           organic solvents) [Ralstonia solanacearum CFBP2957]
          Length = 327

 Score = 61.6 bits (148), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 30/114 (26%), Positives = 61/114 (53%), Gaps = 3/114 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++ +    GLF + +  F   ++ W +R      P  +V+ R   +V+GLS  ++V++
Sbjct: 1   MENRAHAFLAGLFTIGLAIFIALAVVWFNRDQTVRVPY-DVVTR--STVNGLSPQAAVKY 57

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIEL 114
            G+ VG++  +  D + P   + + L+  D P+  +T   +  QG+ G+ Y++L
Sbjct: 58  RGLDVGKVDTIRFDDKVPGQIIVRVLVDKDAPITTTTYGRLAYQGVTGLAYVQL 111


>gi|307825466|ref|ZP_07655684.1| Mammalian cell entry related domain protein [Methylobacter
           tundripaludum SV96]
 gi|307733352|gb|EFO04211.1| Mammalian cell entry related domain protein [Methylobacter
           tundripaludum SV96]
          Length = 304

 Score = 61.6 bits (148), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 74/307 (24%), Positives = 139/307 (45%), Gaps = 32/307 (10%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M  +N+    GLF+++++  S   I+W+   NQ     A   I    SV GL+ +S+V +
Sbjct: 1   MGRENHALITGLFLIALVTASTAIIFWIGTMNQERNLYA---ISTRASVSGLNPESTVFY 57

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            GI VG+++ +  D       L    +     L     AT+R +G+ G+T I+L    ++
Sbjct: 58  RGIAVGKVLNVQFDPLDSGTILVPIEVDKKIVLSKGVYATLRLKGVTGLTQIQL----ED 113

Query: 121 KKTIF-QIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKII--ENIEKPLT 177
             TI  ++    N    I   PS  +  + + E    K     + +  ++  EN EK + 
Sbjct: 114 SGTISEELPPGDNPMTRIPLVPSLTDKLMDSGEELLHKADHLMQRLSSLLNDEN-EKNIG 172

Query: 178 TTIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQ 237
             ++N++T++  L+     +DK +    V   ++D++ T + I  L         A +LQ
Sbjct: 173 GILSNLKTLTDKLSELQKSVDKAL--AGVPELTTDARKTMSNIDAL---------ANELQ 221

Query: 238 KVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDF-SSKMKSKE 296
            + + ++N+   + N V S     NT   + +TT        K++ LL++  S+  + K 
Sbjct: 222 GLTREVKNLSAKAGNLVDSGK---NTGDALAQTTLP------KVNKLLTELQSTTQQVKR 272

Query: 297 TSAFLEN 303
            +  LEN
Sbjct: 273 VATMLEN 279


>gi|329890327|ref|ZP_08268670.1| mce related family protein [Brevundimonas diminuta ATCC 11568]
 gi|328845628|gb|EGF95192.1| mce related family protein [Brevundimonas diminuta ATCC 11568]
          Length = 312

 Score = 61.6 bits (148), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 51/192 (26%), Positives = 92/192 (47%), Gaps = 5/192 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME   +Y +VG+  V++L        WL+R  Q++       I   G V GLS    V F
Sbjct: 1   MERDAHYAAVGIATVALLLALAVFTIWLARL-QFNKDFDVYDIVFYGPVRGLSEGGEVHF 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NGI VG +  L LD +  +  +A+  +   TP+  ++ A +  QG+ G+ YI++ T    
Sbjct: 60  NGIRVGEVTNLNLDPKKGDQVIARVRLNGTTPVRVTSRAQLEPQGITGLNYIQI-TAGAP 118

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKII--ENIEKPLTT 178
              + +     N   +I + PS I   +S +     +  D+   I +++  +NI +  +T
Sbjct: 119 DSPLLKDQYPDNVVPVIQSQPSPIAELLSGSGTVLAQTVDALNRINRVMSDDNI-RSFST 177

Query: 179 TIANIETISTVL 190
           ++ N+E ++  L
Sbjct: 178 SVKNVEALTAEL 189


>gi|295690464|ref|YP_003594157.1| mammalian cell entry related domain-containing protein [Caulobacter
           segnis ATCC 21756]
 gi|295432367|gb|ADG11539.1| Mammalian cell entry related domain protein [Caulobacter segnis
           ATCC 21756]
          Length = 312

 Score = 61.6 bits (148), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 67/289 (23%), Positives = 113/289 (39%), Gaps = 64/289 (22%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSR---SNQYDGPMAEVIIRIPGSVDGLSTDSS 57
           ME    Y  VG   +++         WL++   S  YD  + +V+    G V GLS    
Sbjct: 1   MERNANYAVVGAVTLALFMGLIVFAVWLAKISFSRDYD--LYDVLF--VGPVRGLSQGGE 56

Query: 58  VRFNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELST- 116
             FNGI VG +  + LD+  PN  +A+  +  D P+   + AT+  QG+ G+ YI+++  
Sbjct: 57  AHFNGIKVGEVTRIELDKSDPNRVIARIRVTSDVPIKVDSYATLEPQGITGVNYIQITAG 116

Query: 117 -----LRKEKKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIEN 171
                L K+     ++   R+QR+ ++                             ++E 
Sbjct: 117 SPNKELLKDTVKGGRVPVLRSQRSALS----------------------------DLLEG 148

Query: 172 IEKPLTTTIANIETISTVLA-NNISHIDKMMHTTQ-VTPHSSDSKNTFNTITDLITSLDK 229
               LT TI  ++ ++ VL+ NNI      +   Q VT    + K               
Sbjct: 149 GGTVLTRTIEALDRVNRVLSDNNIKTFSAALSDVQAVTAEMRERKEVIA----------- 197

Query: 230 MIKAIDLQKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVG 278
                D QK  Q ++    S      S+D V+N      +  +T +E+G
Sbjct: 198 -----DAQKALQSIDQTAQSITQLANSADGVVNG-----DAKRTLKELG 236


>gi|114320359|ref|YP_742042.1| hypothetical protein Mlg_1203 [Alkalilimnicola ehrlichii MLHE-1]
 gi|114226753|gb|ABI56552.1| Mammalian cell entry related domain protein [Alkalilimnicola
           ehrlichii MLHE-1]
          Length = 310

 Score = 61.2 bits (147), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 36/115 (31%), Positives = 61/115 (53%), Gaps = 1/115 (0%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++  Y  VGLFV+ +      +  +L   +    P  +  + +  SV GL+  + VR+
Sbjct: 1   METRVSYALVGLFVILLTLAIIGAGLYLG-GDIRTQPHTDYAVYMDESVAGLNVSAPVRY 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELS 115
            G+ VGR+  + L+  +P+       +    P+   T AT+R+QGL GI++IELS
Sbjct: 60  RGVDVGRVQAITLNPRHPDEVRIVISVEERVPIGRETVATLRSQGLTGISFIELS 114


>gi|86748500|ref|YP_484996.1| hypothetical protein RPB_1375 [Rhodopseudomonas palustris HaA2]
 gi|86571528|gb|ABD06085.1| Mammalian cell entry related [Rhodopseudomonas palustris HaA2]
          Length = 390

 Score = 61.2 bits (147), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 50/205 (24%), Positives = 92/205 (44%), Gaps = 16/205 (7%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++  +  VG FV++ +   F  ++WL  ++   G      I+    V GL   ++V F
Sbjct: 1   METRAPFVVVGAFVLAAILAVFGFVFWLHNTSGI-GARTSYHIQFRDPVPGLLVGAAVLF 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NGI VG +  L L  + P    A   +  +TP+ P T   +  QGL G+  + L     +
Sbjct: 60  NGIRVGEVTELGLASDDPRRVNATIAVATNTPVRPDTKVGLDFQGLTGVPVVALEG--GK 117

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
             T   IAT      +I    +G++         ++   ++ R +  ++    +PL  TI
Sbjct: 118 DLTGSAIAT-----TLIAEPGAGMSM--------TQAAREALRKVDSVLGENSQPLKETI 164

Query: 181 ANIETISTVLANNISHIDKMMHTTQ 205
            N++T S  L++    +D ++   +
Sbjct: 165 GNLKTFSEWLSSRTGKLDGILGGVE 189


>gi|91975835|ref|YP_568494.1| hypothetical protein RPD_1355 [Rhodopseudomonas palustris BisB5]
 gi|91682291|gb|ABE38593.1| Mammalian cell entry related [Rhodopseudomonas palustris BisB5]
          Length = 390

 Score = 61.2 bits (147), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 51/205 (24%), Positives = 91/205 (44%), Gaps = 16/205 (7%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++  +  VG FV++ +   F  ++WL  ++   G      I+    V GL   ++V F
Sbjct: 1   METRAPFVIVGAFVLAAILAVFGFVFWLHNTSGI-GARTSYHIQFRDPVPGLLVGAAVLF 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NGI VG +  L L  + P    A   +  DTP+   T   +  QGL G+  + L     +
Sbjct: 60  NGIRVGEVTALGLATDDPRRVNATIAVATDTPVRLDTRVGLDFQGLTGVPVVALEG--GK 117

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
             T   IAT      +I    +G++         ++   ++ R +  ++    +PL  TI
Sbjct: 118 DLTGSAIAT-----TLIAEPGAGMSM--------TQAAREALRKVDSVLGENSQPLKETI 164

Query: 181 ANIETISTVLANNISHIDKMMHTTQ 205
            N++T S  L+N    +D ++   +
Sbjct: 165 GNLKTFSEWLSNKTGKLDGILGGVE 189


>gi|148256835|ref|YP_001241420.1| ABC transporter periplasmic-binding protein [Bradyrhizobium sp.
           BTAi1]
 gi|146409008|gb|ABQ37514.1| Putative ABC transporter (periplasmic binding protein)
           [Bradyrhizobium sp. BTAi1]
          Length = 292

 Score = 60.8 bits (146), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 57/280 (20%), Positives = 123/280 (43%), Gaps = 30/280 (10%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLS--RSNQYDGPMAEVIIRIPGSVDGLSTDSSV 58
           ME++  Y  +G F ++++  +   + W     + +   P+  V+   P +  GL    SV
Sbjct: 1   METRANYVLIGSFTLAVIAAAVGFVLWFQSLHTTKQRSPL-RVVFEGPAA--GLRNGGSV 57

Query: 59  RFNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLR 118
            FNGI VG ++ + LD   P   +A A++  + P+   T   +  QGL G+  I    L+
Sbjct: 58  NFNGIRVGEVISVKLDN--PRRVVALAMVENNAPIRKDTLVGLEFQGLTGVAAI---ALK 112

Query: 119 KEKKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTT 178
             ++       + +   ++ A P+ +       ++ ++ I  + ++I K++ + +  +  
Sbjct: 113 GGEEAAPPPPLDEDGVPVLRADPTRL-------QDVTEAIRATLQNINKVVADNQDAVKN 165

Query: 179 TIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQK 238
           +I N+E  +  LA N   ID +M         +D+         L+  L+ +    D  +
Sbjct: 166 SIKNLEVFTQSLARNSERIDGVMSRVDGIMGKADT---------LMLGLNSLAGGKDGGE 216

Query: 239 VNQILENIQVSSNNFVKSSDQVI----NTVHDVRETTQTF 274
           +   +++I+  + +F K S  ++     T+ D+      F
Sbjct: 217 LFLTVKSIRELAEDFDKRSGALMADGRRTLSDISRAVNNF 256


>gi|90425516|ref|YP_533886.1| hypothetical protein RPC_4041 [Rhodopseudomonas palustris BisB18]
 gi|90107530|gb|ABD89567.1| Mammalian cell entry related [Rhodopseudomonas palustris BisB18]
          Length = 367

 Score = 60.8 bits (146), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 50/205 (24%), Positives = 90/205 (43%), Gaps = 16/205 (7%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++  +  VG FV++ +   F  + WL  ++   G      ++  GSV GL   ++V F
Sbjct: 1   METRAPFIIVGAFVLAAIAAVFGFVLWLHNTSGL-GARTTYHVQFNGSVPGLLVGAAVLF 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NGI VG +  L L  + P    A   +   TP+   T   +  QGL G+  I L     E
Sbjct: 60  NGIRVGEVTELGLAPDNPRQVNATIGVDATTPVRADTKVGLDFQGLTGVPVIAL-----E 114

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
             T  Q+A       ++    +G        ++ ++   ++ R +  ++    +PL  TI
Sbjct: 115 GGT--QLAPSGTVPTLVADPGAG--------QSMTQAAREALRKVDAVLTENAEPLKATI 164

Query: 181 ANIETISTVLANNISHIDKMMHTTQ 205
            +++  +  LA N   +D +M   +
Sbjct: 165 GDLKIFAEGLARNTGKLDGIMAGVE 189


>gi|157415868|ref|YP_001483124.1| ABC transporter, periplasmic substrate-binding protein, putative
           [Campylobacter jejuni subsp. jejuni 81116]
 gi|157386832|gb|ABV53147.1| ABC transporter, periplasmic substrate-binding protein, putative
           [Campylobacter jejuni subsp. jejuni 81116]
 gi|307748505|gb|ADN91775.1| ABC transporter, periplasmic substrate-binding protein, putative
           [Campylobacter jejuni subsp. jejuni M1]
 gi|315931383|gb|EFV10352.1| mce related family protein [Campylobacter jejuni subsp. jejuni 327]
          Length = 296

 Score = 60.8 bits (146), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 70/293 (23%), Positives = 131/293 (44%), Gaps = 41/293 (13%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++  Y  VGLFV  + F S   I WL   ++ +       I    SV GL   + VR 
Sbjct: 1   MENRANYFFVGLFVFGVFFASLGFILWLGGYSKEE-SFKYYEIHTQESVAGLGIKAPVRL 59

Query: 61  NGIPVGRI--VGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLR 118
            G+ VG +  + ++   E   +   K  ++ +TP+   T AT++ QG+ G+ +I+L    
Sbjct: 60  LGVEVGSVEEISIYNQDELGVNIRIK--VKNNTPIKEDTFATLQLQGITGLKFIQLQGGS 117

Query: 119 KEKKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIE---KP 175
           K  K +  I         +   P   ++  +        I   S HI  +++  +   K 
Sbjct: 118 KNSKDLVSI------HGKLPVIPFKESFLAT--------IDRQSEHIFSLVKTADDKSKE 163

Query: 176 LTT--TIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKA 233
           L +   + N+E    +L  N++ +   ++        ++SKN    +++    + KM   
Sbjct: 164 LLSEKNLKNLE----ILLQNLAELSANLN--------ANSKNLSLNLSNASLKIGKMADN 211

Query: 234 IDL--QKVNQILENIQVSS---NNFVKSSDQVINTVHDVRETTQTFQEVGQKI 281
           I L  Q  N  L+NI+ S+    NF+K +D+ +NT  D++ +     E+ +++
Sbjct: 212 ISLSAQNFNSSLKNIKESTMILKNFIKKADEKLNTYDDIKASLMQNLELFKRV 264


>gi|153951405|ref|YP_001398925.1| ABC transporter periplasmic substrate-binding protein
           [Campylobacter jejuni subsp. doylei 269.97]
 gi|152938851|gb|ABS43592.1| putative ABC transporter, periplasmic substrate-binding protein
           [Campylobacter jejuni subsp. doylei 269.97]
          Length = 296

 Score = 60.8 bits (146), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 67/282 (23%), Positives = 126/282 (44%), Gaps = 41/282 (14%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++  Y  VGLFV  + F S   I+WL   ++ +       I    SV GL   + VR 
Sbjct: 1   MENRANYFFVGLFVFGVFFASLGFIFWLGGYSKEE-SFKYYEIHTQESVAGLGIKAPVRL 59

Query: 61  NGIPVGRI--VGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLR 118
            G+ VG +  + ++   E   +   K  ++ +TP+   T AT++ QG+ G+ +++L    
Sbjct: 60  LGVEVGSVEEISIYNQDELGVNIRIK--VKNNTPIKEDTFATLQLQGITGLKFVQLQGGS 117

Query: 119 KEKKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIE---KP 175
           K  K +  I         +   P   ++  +        I   S HI  +++  +   K 
Sbjct: 118 KNSKDLVSI------HGKLPVIPFKESFLAT--------IDRQSEHIFSLVKTADDKSKE 163

Query: 176 LTT--TIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKA 233
           L +   + N+E    +   N++ +   ++        +DSKN    +++    + KM   
Sbjct: 164 LLSEKNLKNLE----IFLQNLAELSANLN--------ADSKNLSLNLSNASLKIGKMADN 211

Query: 234 IDL--QKVNQILENIQVSS---NNFVKSSDQVINTVHDVRET 270
           I L  Q  N  L++I+ S+    NF+K +D+ +NT  D++ +
Sbjct: 212 ISLSAQNFNSSLKDIKESTMILKNFIKKADEKLNTYDDIKAS 253


>gi|167561348|ref|ZP_02354264.1| ABC transporter, periplasmic substrate-binding protein
           [Burkholderia oklahomensis EO147]
 gi|167568580|ref|ZP_02361454.1| ABC transporter, periplasmic substrate-binding protein
           [Burkholderia oklahomensis C6786]
          Length = 309

 Score = 60.8 bits (146), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 49/238 (20%), Positives = 108/238 (45%), Gaps = 28/238 (11%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIP------GSVDGLST 54
           ME+K++    GLF + +L     ++YW +          +  +R+P       +V GL  
Sbjct: 1   MENKSHAFWAGLFTIGLLLAIVGAVYWFN---------VDRTVRVPYDLVSRSNVTGLFP 51

Query: 55  DSSVRFNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIEL 114
           D++VR+ G+ VG++  +  D+ +P   + + L+  + P+  ST  ++  QG+ GI +++L
Sbjct: 52  DAAVRYRGLDVGKVQSINFDRGHPGEIVIRILVDTNAPITRSTFGSLGFQGVTGIAFVQL 111

Query: 115 STLRKEKKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKII-ENIE 173
                ++     + T     A I   PS  +      +   K++  +++ I +++   + 
Sbjct: 112 DDTGADQAP---LPTSAKAVAQIPMHPSLFDQLQQRGDVLLKQMEIAAKSINEMLSPEMR 168

Query: 174 KPLTTTIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMI 231
             L  T A+++      A+ ++ + K     QV P  +    T   +   +TS + ++
Sbjct: 169 DQLKATAASMQHA----ADGVTRLSK-----QVEPALAQMPETMAHVNHALTSANALV 217


>gi|254251298|ref|ZP_04944616.1| ABC-type transport system periplasmic component [Burkholderia
           dolosa AUO158]
 gi|124893907|gb|EAY67787.1| ABC-type transport system periplasmic component [Burkholderia
           dolosa AUO158]
          Length = 309

 Score = 60.8 bits (146), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 49/216 (22%), Positives = 96/216 (44%), Gaps = 26/216 (12%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K++    GLF +++      +++W +       P  ++I R   +V GL  D++VRF
Sbjct: 1   MENKSHAFWAGLFTIALTLAIAGAVFWFNVDRTVRVPY-DLIART--NVTGLFPDAAVRF 57

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIE------- 113
            G+ VG++  +  D+ +P     + L+  D P+  ST  ++  QG+ GI +++       
Sbjct: 58  RGLDVGKVQSIGFDRSHPGQIRIRILVDQDAPITQSTYGSLGFQGVTGIAFVQLEDTGRD 117

Query: 114 LSTLRKEKKTIFQIATERN------QRAMITATPSGINYFISNAENTSKKISD-SSRHIQ 166
           LS L    K I QI    +      QR  +          +   E  +K ++   S  ++
Sbjct: 118 LSPLPSSPKKIAQIPMRPSLFDQIQQRGGV---------LLRQLEQAAKGVNQLLSPEMR 168

Query: 167 KIIENIEKPLTTTIANIETISTVLANNISHIDKMMH 202
           + +    + L      + T+S  L   ++ + + MH
Sbjct: 169 EQLRATTESLQHAADGVTTLSKQLGPAVAELPQTMH 204


>gi|330818438|ref|YP_004362143.1| Mce related protein [Burkholderia gladioli BSR3]
 gi|327370831|gb|AEA62187.1| Mce related protein [Burkholderia gladioli BSR3]
          Length = 315

 Score = 60.8 bits (146), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 32/120 (26%), Positives = 62/120 (51%), Gaps = 15/120 (12%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIP------GSVDGLST 54
           ME+K++    GLF + +L     +++W +          +  +RIP       +V GL  
Sbjct: 1   MENKSHAFWAGLFAIGLLLAIIAAVFWFN---------VDRTVRIPYDLVARTNVTGLFP 51

Query: 55  DSSVRFNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIEL 114
           D++VR+ G+ VG++  +  D+ +P     + L+  D P+  ST  ++  QG+ GI +++L
Sbjct: 52  DAAVRYRGLDVGKVATIHFDRAHPGEISIRILVDKDAPITRSTYGSLGFQGVTGIAFVQL 111


>gi|87200856|ref|YP_498113.1| hypothetical protein Saro_2843 [Novosphingobium aromaticivorans DSM
           12444]
 gi|87136537|gb|ABD27279.1| Mammalian cell entry related protein [Novosphingobium
           aromaticivorans DSM 12444]
          Length = 319

 Score = 60.8 bits (146), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 68/292 (23%), Positives = 130/292 (44%), Gaps = 35/292 (11%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++  +  VGL  + +L  +     W++R NQ D  + E  I    SVDGL+  S V F
Sbjct: 1   METRANHIWVGLVTLLLLAGTALLTVWIARINQGD--LHEYDIFFKQSVDGLAKGSEVSF 58

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQG-LAGITYIELSTLRK 119
           +G+P G++  + L +  P     +  +    P+   TTA++  QG   G++ I+LS   K
Sbjct: 59  SGVPSGQVKDIELWERDPEFVRVRIAVDKKVPILQGTTASL--QGSFTGVSTIQLSGAVK 116

Query: 120 EKKTIFQIATERNQRA-------MITATPSGINYFISNAENTSKKISDSSRHI------- 165
               I     + N+RA       +I    SG+   +SNA    ++++  +  +       
Sbjct: 117 GAPPID--CPDENRRAACPEGVPVIPTKRSGLGEILSNAPLLLERLATLTERLTMVLSDK 174

Query: 166 -QKIIENIEKPLTTTIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLI 224
            QK IENI       ++N + ++  LA+    + + +   Q T   ++   T  +   L 
Sbjct: 175 NQKSIENI-------LSNTDRLTGNLADASPDVKRTLAELQATLRQANY--TLASFEKLT 225

Query: 225 TSLDKMIKAIDLQKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQE 276
            S D M+      + N + + ++ +  +   ++D++  T+ + R   +   E
Sbjct: 226 NSADSMLN----DEGNGLAQQLRKTLKSAQGAADELQGTLSEARPAARQLNE 273


>gi|83719099|ref|YP_440933.1| ABC transporter periplasmic substrate-binding protein [Burkholderia
           thailandensis E264]
 gi|167617724|ref|ZP_02386355.1| ABC transporter, periplasmic substrate-binding protein
           [Burkholderia thailandensis Bt4]
 gi|257140412|ref|ZP_05588674.1| ABC transporter, periplasmic substrate-binding protein
           [Burkholderia thailandensis E264]
 gi|83652924|gb|ABC36987.1| ABC transporter, periplasmic substrate-binding protein
           [Burkholderia thailandensis E264]
          Length = 309

 Score = 60.5 bits (145), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 46/238 (19%), Positives = 110/238 (46%), Gaps = 28/238 (11%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIP------GSVDGLST 54
           ME+K++    GLF +++L     ++YW +          +  +R+P       +V GL  
Sbjct: 1   MENKSHAFWAGLFTIALLAAIVGAVYWFN---------VDRTVRVPYDLVSRSNVTGLFP 51

Query: 55  DSSVRFNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIEL 114
           D++VR+ G+ VG++  +  D+ +P   + + L+    P+  ST  ++  QG+ GI +++L
Sbjct: 52  DAAVRYRGLDVGKVQSIDFDRGHPGQIVIRILVDTHAPITRSTFGSLGFQGVTGIAFVQL 111

Query: 115 STLRKEKKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKII-ENIE 173
                +   +  + T     A I   PS  +      +   K++  +++ + +++  ++ 
Sbjct: 112 DDTGAD---LAPLPTSAKAVAQIPMRPSLFDQLQQRGDVLLKQMEIAAKSVNEMLSPDMR 168

Query: 174 KPLTTTIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMI 231
             L  T A+++      A+ ++H+ +     QV P  +    T   +   +++ + ++
Sbjct: 169 DQLKATAASMQHA----ADGVTHLSR-----QVEPALAQMPQTMEHVNHALSAANALV 217


>gi|254000134|ref|YP_003052197.1| Mammalian cell entry related domain-containing protein
           [Methylovorus sp. SIP3-4]
 gi|253986813|gb|ACT51670.1| Mammalian cell entry related domain protein [Methylovorus sp.
           SIP3-4]
          Length = 314

 Score = 60.5 bits (145), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 52/198 (26%), Positives = 91/198 (45%), Gaps = 18/198 (9%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++++  +VGLF + +   + F+ +WLS S +         I     V GL+ ++SV+F
Sbjct: 1   MENRSHAIAVGLFTLILGLAAIFAFWWLSGSREEK---THYTINSNRPVSGLNPEASVKF 57

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G+ VG+++ + LD    N    +  +     L  +  A +R QG+ G+ YI+L+     
Sbjct: 58  RGVEVGKVLHISLDDNTQNDIHVEIEVTKTLQLSKAAYAELRLQGVTGLAYIDLNDDGSS 117

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNA----ENTSKKISDSSRHIQKIIENIEK-- 174
           ++ +    T       I   PS ++ F  +A    E     +  SS+      E ++K  
Sbjct: 118 QQRLGPDDT-------IPLRPSFVDRFTEHAPEIIEQVETLVKSSSQLAATAHEMVQKID 170

Query: 175 --PLTTTIANIETISTVL 190
              L  TIAN+E  S  L
Sbjct: 171 TDQLNRTIANLEKASAQL 188


>gi|15606676|ref|NP_214056.1| hypothetical protein aq_1533 [Aquifex aeolicus VF5]
 gi|2983901|gb|AAC07452.1| putative protein [Aquifex aeolicus VF5]
          Length = 300

 Score = 60.5 bits (145), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 67/283 (23%), Positives = 133/283 (46%), Gaps = 32/283 (11%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           +E +  Y  VGLF++  L  + F ++ ++   + +      +I    SV+GL+T ++V +
Sbjct: 5   IEGRVNYILVGLFILLGLGVTLFVLFLMTDIMERE-KFRPYLIYTTQSVEGLNTGAAVYY 63

Query: 61  NGIPVGRIVGLFLDQEYPNHSL--AKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLR 118
            G+ VG++  + + +   N  L   K LI  D  +     AT+  QG+ G+ YI L    
Sbjct: 64  KGVQVGKVKEIKIAK---NQELIKIKVLIDKDFKVRDGLVATLGVQGITGLAYINL---- 116

Query: 119 KEKKTIFQIATERNQR-AMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLT 177
            E K  +++  +  +   +I   PS +       +  ++ + +      +++ N+ K  +
Sbjct: 117 -EYKEGYKLGRDPEENLPVIPMEPSEL-------QKLTQSLPELLSKTDELLTNLGKFFS 168

Query: 178 TTIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQ 237
               N E IS VL N     +K + + +    S   +N    +  L+ + DK +  ++++
Sbjct: 169 E--ENAEEISKVLKNT----NKTLKSFE--ELSGKLENISLRVEKLVANADKKLGELEVK 220

Query: 238 KVNQILE---NIQVSSNNFVKSSDQVINTVHDVRETTQTFQEV 277
           K+N++LE   N+ V    FVK+   +   V   RET + F+E+
Sbjct: 221 KLNEVLEEYKNLAVEVEKFVKNLSNLSEKVD--RETLRKFEEL 261


>gi|86149271|ref|ZP_01067502.1| ABC transporter, periplasmic substrate-binding protein, putative
           [Campylobacter jejuni subsp. jejuni CF93-6]
 gi|88596269|ref|ZP_01099506.1| ABC transporter, periplasmic substrate-binding protein, putative
           [Campylobacter jejuni subsp. jejuni 84-25]
 gi|218563237|ref|YP_002345017.1| putative ABC transporter periplasmic substrate-binding protein
           [Campylobacter jejuni subsp. jejuni NCTC 11168]
 gi|85840053|gb|EAQ57311.1| ABC transporter, periplasmic substrate-binding protein, putative
           [Campylobacter jejuni subsp. jejuni CF93-6]
 gi|88191110|gb|EAQ95082.1| ABC transporter, periplasmic substrate-binding protein, putative
           [Campylobacter jejuni subsp. jejuni 84-25]
 gi|112360944|emb|CAL35745.1| putative ABC transport system periplasmic substrate-binding protein
           [Campylobacter jejuni subsp. jejuni NCTC 11168]
 gi|284926842|gb|ADC29194.1| putative ABC transport system periplasmic substrate-binding protein
           [Campylobacter jejuni subsp. jejuni IA3902]
 gi|315927601|gb|EFV06932.1| mce related family protein [Campylobacter jejuni subsp. jejuni
           DFVF1099]
 gi|315929478|gb|EFV08674.1| mce related family protein [Campylobacter jejuni subsp. jejuni 305]
          Length = 296

 Score = 60.5 bits (145), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 72/293 (24%), Positives = 131/293 (44%), Gaps = 41/293 (13%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++  Y  VGLFV  + F S   I WL   ++ +       I    SV GL   + VR 
Sbjct: 1   MENRANYFFVGLFVFGVFFASLGFILWLGGYSKEE-SFKYYEIHTQESVAGLGIKAPVRL 59

Query: 61  NGIPVGRI--VGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLR 118
            G+ VG +  + ++   E   +   K  ++ +TP+   T AT++ QG+ G+ +I+L    
Sbjct: 60  LGVEVGSVEEISIYNQDELGVNIRIK--VKNNTPIKEDTFATLQLQGITGLKFIQLQGGS 117

Query: 119 KEKKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIE---KP 175
           K  K +          +M    P      I   E+    I   S HI  +++  +   K 
Sbjct: 118 KNSKDLV---------SMQGKLP-----VIPFKESFLATIDRQSEHIFSLVKTADDKSKE 163

Query: 176 LTT--TIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKA 233
           L +   + N+E    +L  N++ +   ++        ++SKN    +++    + KM   
Sbjct: 164 LLSEKNLKNLE----ILLQNLAELSANLN--------ANSKNLSLNLSNASLKIGKMADN 211

Query: 234 IDL--QKVNQILENIQVSS---NNFVKSSDQVINTVHDVRETTQTFQEVGQKI 281
           I L  Q  N  L+NI+ S+    NF+K +D+ +NT  D++ +     E+ +++
Sbjct: 212 ISLSAQNFNSSLKNIKESTMILKNFIKKADEKLNTYDDIKASLMQNLELFKRV 264


>gi|15837902|ref|NP_298590.1| hypothetical protein XF1301 [Xylella fastidiosa 9a5c]
 gi|9106292|gb|AAF84110.1|AE003963_7 conserved hypothetical protein [Xylella fastidiosa 9a5c]
          Length = 308

 Score = 60.5 bits (145), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 67/294 (22%), Positives = 129/294 (43%), Gaps = 17/294 (5%)

Query: 1   MESKNYYTSVGLF-VVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVR 59
           ME+K  Y  +G F +++ L    F ++    S+        V+ R   +V GLS  S V+
Sbjct: 1   METKANYVLIGSFTILTGLALLIFGLWAAKYSSDRTWQNYRVVFR--EAVTGLSVGSPVQ 58

Query: 60  FNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRK 119
           +NGI +G I  L L    P   +A   +   TP+   T A +    L G + I+LS    
Sbjct: 59  YNGIAIGSITQLTLAPNDPRQVIAHIRVNSTTPVKKDTRAKLAITSLTGPSIIQLSGGTP 118

Query: 120 EKKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISD-----SSRHIQKIIENIEK 174
           E  ++  I   ++   +I  TPS +      A +  +++ D     +   I  I++N++K
Sbjct: 119 ESPSLTSI--YKDDAPIIQTTPSALQNITDTANDIVERLYDVLSDKNVAAISTILQNMQK 176

Query: 175 ---PLTTTIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMI 231
               ++ +   ++ + T   +    ++  + TT  T    D+ N    +  ++  L+  +
Sbjct: 177 ISGQVSDSDTGLKALLTSAHDATRQLNAALATTNGTVQQLDN-NLVKQLPVILNKLEATL 235

Query: 232 KAID--LQKVNQILENIQVSSNNFVKSS-DQVINTVHDVRETTQTFQEVGQKID 282
             ID      N IL+N Q + N+F      Q   T+ ++R   +  +++  K++
Sbjct: 236 TKIDATASNANSILDNNQAAINSFASEGLSQFAPTMSELRNLIRDLRQISNKLE 289


>gi|148555655|ref|YP_001263237.1| hypothetical protein Swit_2744 [Sphingomonas wittichii RW1]
 gi|148500845|gb|ABQ69099.1| Mammalian cell entry related domain protein [Sphingomonas wittichii
           RW1]
          Length = 315

 Score = 60.5 bits (145), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 67/296 (22%), Positives = 128/296 (43%), Gaps = 32/296 (10%)

Query: 25  IYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRFNGIPVGRIVGLFLDQEYPNHSLAK 84
           I WL+  N       ++  +   SVDGL+  S V F+G+PVG+I  + L  + P     +
Sbjct: 25  IVWLAGFNTASNQRYDIFFKT--SVDGLAKGSPVNFSGVPVGKIEEIKLLPDSPEFVRVR 82

Query: 85  ALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKEKKTIFQIATERNQRAMITATPSGI 144
             I  DTP+   TTATI   G  G++ I L    K    I +         +I   P  +
Sbjct: 83  IAIDQDTPILQGTTATIAGIGFTGVSQINLDGAVKGAPPITEPGPY--GEPVIPTKPGAL 140

Query: 145 NYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTIANIETISTVLANNISHIDKMMHTT 204
              +++A     +IS  +  + +++ +          N ++IS +LA    H+DK+    
Sbjct: 141 GELLNSAPELLNRISTLTERLTELLND---------KNQKSISGILA----HVDKLSGDL 187

Query: 205 QVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVNQILENIQVSSNNFVKSSDQVINTV 264
                +         +  L T++++   A   ++V Q+ E    ++N  +  +D V   +
Sbjct: 188 -----ADRGPEIAAAVVQLKTTMEQAGNAA--ERVGQLAE----TTNGVM--ADDVKPAM 234

Query: 265 HDVRETTQTFQEVGQKIDHLLSDFSSKMK--SKETSAFLENIADSTSNMRSSISAI 318
            ++ + T   Q   + +D  ++D    +K  S +T   +  +A + + M  ++ AI
Sbjct: 235 ANLNKATVAAQHTLETLDATITDARPGIKAFSTQTVPQINQLARNLAEMSEALGAI 290


>gi|325527208|gb|EGD04597.1| mce related protein [Burkholderia sp. TJI49]
          Length = 309

 Score = 60.1 bits (144), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 38/134 (28%), Positives = 69/134 (51%), Gaps = 10/134 (7%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K++    GLF +++      +++W +       P  ++I R   +V GL  D++VRF
Sbjct: 1   MENKSHAFWAGLFTIALTLAIAGTVFWFNVDRTVRVPY-DLIART--NVTGLFPDAAVRF 57

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIE------- 113
            G+ VG++  +  D+ +P     + L+  D P+  ST  ++  QG+ GI +++       
Sbjct: 58  RGLDVGKVQSIGFDRTHPGQIRIRILVDHDAPITQSTYGSLGFQGVTGIAFVQLEDTGRD 117

Query: 114 LSTLRKEKKTIFQI 127
           LS L    K+I QI
Sbjct: 118 LSPLPSSPKSIAQI 131


>gi|254496224|ref|ZP_05109118.1| ABC transport system periplasmic substrate binding protein
           [Legionella drancourtii LLAP12]
 gi|254354529|gb|EET13170.1| ABC transport system periplasmic substrate binding protein
           [Legionella drancourtii LLAP12]
          Length = 280

 Score = 60.1 bits (144), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 47/152 (30%), Positives = 76/152 (50%), Gaps = 3/152 (1%)

Query: 48  SVDGLSTDSSVRFNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLA 107
           +  GLS D++V++NG+ VG +  + L++  P        I   TP+  ST AT+ +QG+ 
Sbjct: 20  AASGLSKDAAVKYNGVQVGYVHEIKLNKNDPRQVEIILSIESGTPITTSTVATLISQGIT 79

Query: 108 GITYIELSTLRKEKKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQK 167
           G+TYI L+    +   I ++  E     +I A PS  N   S  +  S+ I   S   Q 
Sbjct: 80  GVTYIGLTAGSSDLTPIKKLPGE--PYPVIPARPSLFNQLDSLLKEVSESIGKVSVQAQH 137

Query: 168 II-ENIEKPLTTTIANIETISTVLANNISHID 198
           I  E     +   +AN+E ++ V+A+N   ID
Sbjct: 138 IFNEENASHVRHILANMERLTGVVAHNSKKID 169


>gi|313202097|ref|YP_004040755.1| mammalian cell entry related domain-containing protein
           [Methylovorus sp. MP688]
 gi|312441413|gb|ADQ85519.1| Mammalian cell entry related domain protein [Methylovorus sp.
           MP688]
          Length = 314

 Score = 59.7 bits (143), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 52/198 (26%), Positives = 90/198 (45%), Gaps = 18/198 (9%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++++  +VGLF + +   + F+ +WLS S +         I     V GL+ ++SV+F
Sbjct: 1   MENRSHAIAVGLFTLILGLAAIFAFWWLSGSREEK---THYTINSNRPVSGLNPEASVKF 57

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G+ VG+++ + LD    N       +     L  +  A +R QG+ G+ YI+L+     
Sbjct: 58  RGVEVGKVLHISLDDNTQNDIHVDIEVTKTLQLSKAAYAELRLQGVTGLAYIDLNDDGSS 117

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNA----ENTSKKISDSSRHIQKIIENIEK-- 174
           ++ +    T       I   PS ++ F  +A    E     +  SS+      E ++K  
Sbjct: 118 QQRLGPDDT-------IPLRPSFVDRFTEHAPEIIEQVETLVKSSSQLAATAHEMVQKID 170

Query: 175 --PLTTTIANIETISTVL 190
              L  TIAN+E  S  L
Sbjct: 171 TDQLNRTIANLEKASAQL 188


>gi|194364300|ref|YP_002026910.1| Mammalian cell entry related domain-containing protein
           [Stenotrophomonas maltophilia R551-3]
 gi|194347104|gb|ACF50227.1| Mammalian cell entry related domain protein [Stenotrophomonas
           maltophilia R551-3]
          Length = 308

 Score = 59.7 bits (143), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 73/303 (24%), Positives = 128/303 (42%), Gaps = 33/303 (10%)

Query: 1   MESKNYYTSVGLF-VVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVR 59
           ME+K  Y  +G F +++ L    F ++    S+        V+ R   +V GLS  S V+
Sbjct: 1   METKANYVLIGAFTLITGLALLAFGLWAAKYSSDRTWQEYRVVFR--EAVTGLSVGSPVQ 58

Query: 60  FNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRK 119
           +NGI VG I+ L L  + P   +A+  +   TP+   T A +    L G + I+LS    
Sbjct: 59  YNGIAVGSIIELNLVPDDPRQVVARIRLNSTTPVKTDTRAKLAITSLTGPSIIQLSGGTP 118

Query: 120 EKKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISD--SSRHIQKIIENIEKPLT 177
           +   +  +   ++   +I  TPS +      A    +++    S R++  I         
Sbjct: 119 QSPALTTV--NKDPAPIIPTTPSALQNITDVANRIVERMDQILSDRNVASI--------N 168

Query: 178 TTIANIETISTVLANN--------------ISHIDKMMHTTQVTPHSSDSKNTFNTITDL 223
            T+AN+ETIS  LA+                  +D  + TT  T    D KN    +  +
Sbjct: 169 ATLANLETISGGLADRDQGTQALLLSARDAARSLDTTLKTTNGTIERLD-KNLVQQLPGI 227

Query: 224 ITSLDKMIKAIDLQKVNQ--ILENIQVSSNNFVKSS-DQVINTVHDVRETTQTFQEVGQK 280
           I  LD  +  +D    N   IL   + + N+F      Q+  T+ ++R   +  + V  +
Sbjct: 228 IDKLDGTLVKLDSAAGNADSILGENRAAINSFANDGLGQLGPTLTELRGLIRDLRRVSDR 287

Query: 281 IDH 283
           +++
Sbjct: 288 LEN 290


>gi|190572712|ref|YP_001970557.1| hypothetical protein Smlt0660 [Stenotrophomonas maltophilia K279a]
 gi|190010634|emb|CAQ44243.1| conserved hypothetical protein [Stenotrophomonas maltophilia K279a]
          Length = 308

 Score = 59.7 bits (143), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 65/257 (25%), Positives = 115/257 (44%), Gaps = 18/257 (7%)

Query: 1   MESKNYYTSVGLF-VVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVR 59
           ME+K  Y  +G F +++ L    F ++    S+        V+ R   +V GLS  S V+
Sbjct: 1   METKANYVLIGAFTLITGLALLAFGLWAAKYSSDRTWQEYRVVFR--EAVTGLSVGSPVQ 58

Query: 60  FNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRK 119
           +NGI VG I+ L L  + P   +A+  +   TP+   T A +    L G + I+LS    
Sbjct: 59  YNGIAVGSIIELNLVPDDPRQVVARIRLNSTTPVKTDTRAKLAITSLTGPSIIQLSGGTP 118

Query: 120 EKKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISD--SSRHIQKIIENIEKPLT 177
           +   +  +   ++   +I  TPS +      A    +++    S R++  I         
Sbjct: 119 QSPALTTV--NKDPAPIIPTTPSALQNITDVANRIVERMDQILSDRNVASI--------N 168

Query: 178 TTIANIETISTVLANNISHIDKMMHTTQVTPHSSDS--KNTFNTITDLITSLDKMIKAID 235
            T+AN+ETIS  LA+       ++ + +    S D+  K T  TI  L  +L + +  I 
Sbjct: 169 ATLANLETISGGLADRDQGTQALLLSARDAARSLDTTLKTTNGTIERLDRNLVQQLPGI- 227

Query: 236 LQKVNQILENIQVSSNN 252
           + K++  L  +  ++ N
Sbjct: 228 IDKLDGTLAKLDSAAGN 244


>gi|161523585|ref|YP_001578597.1| hypothetical protein Bmul_0405 [Burkholderia multivorans ATCC
           17616]
 gi|189351645|ref|YP_001947273.1| putative ABC transporter substrate-binding protein [Burkholderia
           multivorans ATCC 17616]
 gi|221211090|ref|ZP_03584069.1| ABC transporter, periplasmic ligand binding protein [Burkholderia
           multivorans CGD1]
 gi|160341014|gb|ABX14100.1| Mammalian cell entry related domain protein [Burkholderia
           multivorans ATCC 17616]
 gi|189335667|dbj|BAG44737.1| putative ABC transport system substrate-binding protein
           [Burkholderia multivorans ATCC 17616]
 gi|221168451|gb|EEE00919.1| ABC transporter, periplasmic ligand binding protein [Burkholderia
           multivorans CGD1]
          Length = 309

 Score = 59.7 bits (143), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 38/134 (28%), Positives = 67/134 (50%), Gaps = 10/134 (7%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K++    GLF + +      +++W +       P  ++I R   +V GL  D++VRF
Sbjct: 1   MENKSHAFWAGLFTILLTLAIVGAVFWFNVDRTVRVPY-DLIART--NVTGLFPDAAVRF 57

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIE------- 113
            G+ VG++  +  D+ +P     + L+  D P+  ST  ++  QG+ GI +++       
Sbjct: 58  RGLDVGKVQSIGFDRSHPGQIRIRILVDQDAPITQSTYGSLGFQGVTGIAFVQLEDTGRD 117

Query: 114 LSTLRKEKKTIFQI 127
           LS L    K I QI
Sbjct: 118 LSPLPSSPKAIAQI 131


>gi|317401489|gb|EFV82121.1| hypothetical protein HMPREF0005_00960 [Achromobacter xylosoxidans
           C54]
          Length = 318

 Score = 59.7 bits (143), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 44/189 (23%), Positives = 94/189 (49%), Gaps = 9/189 (4%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++++    G+F + +L  +     W+ R ++      E+I     +V GL+  S+VR+
Sbjct: 1   MENRSHALMAGIFTLVLLAAAALVAVWIGR-DRTKLQTYEIISAT--AVSGLNPQSTVRY 57

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G+PVG++  L L+ + P     +  + P+TP+  ST A +  QG+ G+  +E   LR +
Sbjct: 58  QGVPVGKVQSLALNPDKPGQVRIRIGVAPNTPITESTWAELGVQGVTGMANVE---LRDD 114

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKII--ENIEKPLTT 178
             +  ++A+     A I   P  ++            + D++  +++++  +N++  LT 
Sbjct: 115 GSSFKRLASSAANPAAIPLRPGFLDRIEQRGGRLISNVEDATEQLRRLLSEQNVQA-LTA 173

Query: 179 TIANIETIS 187
           ++ N   I+
Sbjct: 174 SLQNATDIT 182


>gi|218678848|ref|ZP_03526745.1| Mammalian cell entry related domain protein [Rhizobium etli CIAT
           894]
          Length = 78

 Score = 59.7 bits (143), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 26/62 (41%), Positives = 42/62 (67%)

Query: 378 TFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFERNPQDIV 437
           +F+  ++ +N  I  I +NLQ FS  GL D+Q LV  ++ TVN+ +D + NF+RNPQ ++
Sbjct: 4   SFKKVADNLNARIGPIADNLQKFSSGGLRDVQTLVNDMRGTVNNLNDTITNFDRNPQRLI 63

Query: 438 WG 439
           +G
Sbjct: 64  FG 65


>gi|238028750|ref|YP_002912981.1| Mce-like protein [Burkholderia glumae BGR1]
 gi|237877944|gb|ACR30277.1| Mce related protein [Burkholderia glumae BGR1]
          Length = 316

 Score = 59.7 bits (143), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 36/134 (26%), Positives = 65/134 (48%), Gaps = 10/134 (7%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K++    GLF + +L      ++W +       P  +++ R   +V GL  D+ VR+
Sbjct: 1   MENKSHAFWAGLFAIGLLLAIVAVVFWFNVDRTVRIPY-DLVART--NVTGLYPDADVRY 57

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIE------- 113
            G+ VG++  +  D  +P     + L+  D P+  ST  T+  QG+ GI +++       
Sbjct: 58  RGLDVGKVASIHFDHAHPGEISIRILVDHDAPITRSTFGTLGFQGVTGIAFVQLDDTGHD 117

Query: 114 LSTLRKEKKTIFQI 127
           L+ L    K + QI
Sbjct: 118 LAPLPSSSKAVAQI 131


>gi|221199882|ref|ZP_03572925.1| ABC transporter, periplasmic ligand binding protein [Burkholderia
           multivorans CGD2M]
 gi|221207450|ref|ZP_03580459.1| ABC transporter, periplasmic ligand binding protein [Burkholderia
           multivorans CGD2]
 gi|221172653|gb|EEE05091.1| ABC transporter, periplasmic ligand binding protein [Burkholderia
           multivorans CGD2]
 gi|221180121|gb|EEE12525.1| ABC transporter, periplasmic ligand binding protein [Burkholderia
           multivorans CGD2M]
          Length = 309

 Score = 59.7 bits (143), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 38/134 (28%), Positives = 67/134 (50%), Gaps = 10/134 (7%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K++    GLF + +      +++W +       P  ++I R   +V GL  D++VRF
Sbjct: 1   MENKSHAFWAGLFTILLTLAIVGAVFWFNVDRTVRVPY-DLIART--NVTGLFPDAAVRF 57

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIE------- 113
            G+ VG++  +  D+ +P     + L+  D P+  ST  ++  QG+ GI +++       
Sbjct: 58  RGLDVGKVQSIGFDRSHPGQIRIRILVDHDAPITQSTYGSLGFQGVTGIAFVQLEDTGRD 117

Query: 114 LSTLRKEKKTIFQI 127
           LS L    K I QI
Sbjct: 118 LSPLPSSPKAIAQI 131


>gi|293602527|ref|ZP_06684973.1| hypothetical protein HMPREF0004_0549 [Achromobacter piechaudii ATCC
           43553]
 gi|292819289|gb|EFF78324.1| hypothetical protein HMPREF0004_0549 [Achromobacter piechaudii ATCC
           43553]
          Length = 310

 Score = 59.3 bits (142), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 45/183 (24%), Positives = 89/183 (48%), Gaps = 9/183 (4%)

Query: 10  VGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRFNGIPVGRIV 69
            G+F + +L  +     W+ R      P  E+I     +V GL+  S+VR+ G+PVG++ 
Sbjct: 2   AGIFTLVLLAAAALVAVWIGRDRTKLQPY-EIISAT--AVSGLNPQSAVRYQGVPVGKVQ 58

Query: 70  GLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKEKKTIFQIAT 129
            L L+ + P     +  + P+TP+  ST A +  QG+ GI  +E   LR +  +I ++A+
Sbjct: 59  SLALNPDKPGQVRIRIGVAPNTPITESTWAELGVQGVTGIANVE---LRDDGSSIKRLAS 115

Query: 130 ERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKII--ENIEKPLTTTIANIETIS 187
                A I   P  ++            + +++  +++++  +N++  LT ++ N   I+
Sbjct: 116 SAEHPAAIPLRPGFLDRIEQRGGKLLSNVEEATEQLRRVLSEQNVQA-LTASLQNATDIT 174

Query: 188 TVL 190
             L
Sbjct: 175 QSL 177


>gi|254521254|ref|ZP_05133309.1| ABC transporter substrate-binding protein [Stenotrophomonas sp.
           SKA14]
 gi|219718845|gb|EED37370.1| ABC transporter substrate-binding protein [Stenotrophomonas sp.
           SKA14]
          Length = 308

 Score = 59.3 bits (142), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 73/303 (24%), Positives = 127/303 (41%), Gaps = 33/303 (10%)

Query: 1   MESKNYYTSVGLF-VVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVR 59
           ME+K  Y  +G F +++ L    F ++    S+        V+ R   +V GLS  S V+
Sbjct: 1   METKANYVLIGAFTLITGLALLAFGLWAAKYSSDRTWQEYRVVFR--EAVTGLSVGSPVQ 58

Query: 60  FNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRK 119
           +NGI VG I  L L  + P   +A+  +   TP+   T A +    L G + I+LS    
Sbjct: 59  YNGIAVGSITELNLVPDDPRQVVARIRLNSTTPVKTDTRAKLAITSLTGPSIIQLSGGTP 118

Query: 120 EKKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISD--SSRHIQKIIENIEKPLT 177
           +   +  +   ++   +I  TPS +      A    +++    S R++  I         
Sbjct: 119 QSPALTTV--NKDPAPIIPTTPSALQNITDVANRIVERMDQILSDRNVASI--------N 168

Query: 178 TTIANIETISTVLANN--------------ISHIDKMMHTTQVTPHSSDSKNTFNTITDL 223
            T+AN+ETIS  LA+                  +D  + TT  T    D KN    +  +
Sbjct: 169 ATLANLETISGGLADRDQGTQALLLSARDAARSLDTTLKTTNGTIERLD-KNLVQQLPGI 227

Query: 224 ITSLDKMIKAIDLQKVNQ--ILENIQVSSNNFVKSS-DQVINTVHDVRETTQTFQEVGQK 280
           I  LD  +  +D    N   IL   + + N+F      Q+  T+ ++R   +  + V  +
Sbjct: 228 IDKLDATLGKLDSAAGNADSILGENRAAINSFANDGLGQLGPTLTELRGLIRDLRRVSDR 287

Query: 281 IDH 283
           +++
Sbjct: 288 LEN 290


>gi|160895816|ref|YP_001561398.1| hypothetical protein Daci_0367 [Delftia acidovorans SPH-1]
 gi|160361400|gb|ABX33013.1| Mammalian cell entry related domain protein [Delftia acidovorans
           SPH-1]
          Length = 320

 Score = 59.3 bits (142), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 53/267 (19%), Positives = 128/267 (47%), Gaps = 19/267 (7%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSR-SNQYDGPMAEVIIRIPGSVDGLSTDSSVR 59
           ME+K++  + G+FV+ +         WL+R + QY+    E  +     + GL   ++VR
Sbjct: 1   MENKSHAMAAGIFVLVVAALLAGLAIWLTRDTRQYN----EYELSTKDGISGLQAQAAVR 56

Query: 60  FNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRK 119
           + G+ VG++  +  D +   + L +  I  +TP+ P+T A +  QG+ G+ +++L    +
Sbjct: 57  YKGVAVGKVTQIGFDPQTNGNVLIRIAIGVNTPITPTTFAVLGYQGVTGLAHVQLDDADQ 116

Query: 120 EKKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIE-NIEKPLTT 178
            +  +    +    R  + ++P  ++      +   ++  + SR +  +++ + +K ++ 
Sbjct: 117 PQPQLPPGPSGL-PRLPLRSSP--LSMLADQGQVLLERADEISRRLSDMLDTDNQKRVSQ 173

Query: 179 TIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTF-------NTITDLITSLDKMI 231
            + NI   +  +     ++D+ + +TQV   ++D+ NT        N  + + + L + +
Sbjct: 174 ALENIAAAAAGVQQLTQNLDRTL-STQVPQLAADAHNTLQSLEKASNGASAVASELQQTV 232

Query: 232 KAIDLQKVNQILENIQVSSNNFVKSSD 258
           + ++ Q  +  LE I  S+    + +D
Sbjct: 233 RRVNAQ--DGPLEQIAQSTRALTRMAD 257


>gi|56479163|ref|YP_160752.1| periplasmic component of ABC-type transport system involved in
           resistance to organic solvents [Aromatoleum aromaticum
           EbN1]
 gi|56315206|emb|CAI09851.1| periplasmic component of probable ABC-type transport system
           involved in resistance to organic solvents [Aromatoleum
           aromaticum EbN1]
          Length = 311

 Score = 59.3 bits (142), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 62/281 (22%), Positives = 115/281 (40%), Gaps = 57/281 (20%)

Query: 26  YWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRFNGIPVGRIVGLFLDQEYPNHSLAKA 85
           +W S   Q   P  + ++   GSV GL+ +  VR+ G+  G++  + LD + P+  L   
Sbjct: 26  WWFSDERQ---PTRDYVLESRGSVTGLNVEGQVRYRGMSAGKVTDIRLDPQDPSKILVDI 82

Query: 86  LIRPDTPLYPSTTATIRTQGLAGITYIEL-----------------------------ST 116
            IR D P+  ST A +  QG+ GI Y++L                             ST
Sbjct: 83  RIREDLPITRSTRARLGYQGVTGIAYVQLDDSEENPVPLTGDPPRLVLEPGLMEQLTDST 142

Query: 117 LRKEKKTIFQIATE-------------RNQRAMITATPSGINYFISNAENTSKKISDSSR 163
           L   K+ +  IA +             RN    + +  +GI+   ++A  T + I  +  
Sbjct: 143 LDAMKR-VTMIADQLAQFLSDDNLGRLRNTLQHLDSAAAGIDRTFADAPATLEAIRSALN 201

Query: 164 HIQKIIENIEKPLTTTIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTF---NTI 220
                 +N++K   TT+AN+E  S      ++ +  +M   Q T  + D+         I
Sbjct: 202 Q-----DNLKK-FATTLANLEQASGDAVPAVAEMRALMSRLQTTAENLDAAMAATGEGLI 255

Query: 221 TDLITSLDKMIKAIDL--QKVNQILENIQVSSNNFVKSSDQ 259
            + +  L+ ++K +    +++  ++E +Q S    +    Q
Sbjct: 256 DNTLPQLNVLLKELTGTSRRLGSLIEEVQASPQMLLSGRSQ 296


>gi|57238659|ref|YP_179790.1| ABC transporter, periplasmic substrate-binding protein, putative
           [Campylobacter jejuni RM1221]
 gi|86153127|ref|ZP_01071332.1| ABC transporter, periplasmic substrate-binding protein, putative
           [Campylobacter jejuni subsp. jejuni HB93-13]
 gi|57167463|gb|AAW36242.1| ABC transporter, periplasmic substrate-binding protein, putative
           [Campylobacter jejuni RM1221]
 gi|85844012|gb|EAQ61222.1| ABC transporter, periplasmic substrate-binding protein, putative
           [Campylobacter jejuni subsp. jejuni HB93-13]
 gi|315059098|gb|ADT73427.1| Possible ABC transport system periplasmic substrate-binding protein
           [Campylobacter jejuni subsp. jejuni S3]
          Length = 296

 Score = 58.9 bits (141), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 68/293 (23%), Positives = 132/293 (45%), Gaps = 41/293 (13%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++  Y  VGLFV  + F S   I WL   ++ +       I    SV GL   + VR 
Sbjct: 1   MENRANYFFVGLFVFGVFFASLGFILWLGGYSKEE-SFKYYEIHTQESVAGLGIKAPVRL 59

Query: 61  NGIPVGRI--VGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLR 118
            G+ VG +  + ++   E   +   K  ++ +TP+   T AT++ QG+ G+ +++L    
Sbjct: 60  LGVEVGSVEEISIYNQDELGVNIRIK--VKNNTPIKEDTFATLQLQGITGLKFVQLQGGS 117

Query: 119 KEKKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIE---KP 175
           K  K +  I      +  +   P   ++  +        I   S HI  +++  +   K 
Sbjct: 118 KNSKDLVSI------QGKLPVIPFKESFLAT--------IDRQSEHIFSLVKTADDKSKE 163

Query: 176 LTT--TIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKA 233
           L +   + N+E    +L  N++ +   ++        ++SKN    +++    + KM   
Sbjct: 164 LLSEKNLKNLE----ILLQNLAELSANLN--------ANSKNLSLNLSNASLKIGKMADN 211

Query: 234 IDL--QKVNQILENIQVSS---NNFVKSSDQVINTVHDVRETTQTFQEVGQKI 281
           I L  Q  N  L++I+ S+    NF+K +D+ +NT  D++ +     E+ +++
Sbjct: 212 ISLSAQNFNSSLKDIKESTMILKNFIKKADEKLNTYDDIKASLMQNLELFKRV 264


>gi|167835252|ref|ZP_02462135.1| ABC transporter, periplasmic substrate-binding protein
           [Burkholderia thailandensis MSMB43]
          Length = 309

 Score = 58.9 bits (141), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 51/252 (20%), Positives = 115/252 (45%), Gaps = 21/252 (8%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K++    GLF +++L     ++YW +       P  +++ R   +V GL  D++VR+
Sbjct: 1   MENKSHAFWAGLFTIALLAAIVGAVYWFNVDRTVRAPY-DLVSR--SNVTGLFPDAAVRY 57

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G+ VG++  +  D+ +P   + + L+  + P+  ST  ++  QG+ GI +++L     +
Sbjct: 58  RGLDVGKVQSINFDRGHPGQIVIRILVDTNAPITRSTFGSLGFQGVTGIAFVQLDDTGAD 117

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKII-ENIEKPLTTT 179
              +  + T     A I   PS  +      +   K++  +++ + +++   +   L  T
Sbjct: 118 ---LAPLPTSAKAVAQIPMRPSLFDQLQQRGDVLLKQMEIAAKSVNEMLSPEMRGQLKAT 174

Query: 180 IANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKA-----I 234
            A+++      A+ I+ + K     QV P  +    T   +   + S + ++        
Sbjct: 175 AASMQHA----ADGITQLSK-----QVEPALAQMPQTMAHVNRALGSANALVAPGGPLVA 225

Query: 235 DLQKVNQILENI 246
           +L +  Q L ++
Sbjct: 226 NLNRAGQALASM 237


>gi|283957034|ref|ZP_06374506.1| ABC transporter, periplasmic substrate-binding protein, putative
           [Campylobacter jejuni subsp. jejuni 1336]
 gi|283791535|gb|EFC30332.1| ABC transporter, periplasmic substrate-binding protein, putative
           [Campylobacter jejuni subsp. jejuni 1336]
          Length = 296

 Score = 58.9 bits (141), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 67/292 (22%), Positives = 129/292 (44%), Gaps = 39/292 (13%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++  Y  VGLFV  + F S   I WL   ++ +       I    SV GL   + VR 
Sbjct: 1   MENRANYFFVGLFVFGVFFASLGFILWLGGYSKEE-SFKYYEIHTQESVAGLGIKAPVRL 59

Query: 61  NGIPVGRI--VGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLR 118
            G+ VG +  + ++   E   +   K  ++ +TP+   T AT++ QG+ G+ +++L    
Sbjct: 60  LGVEVGSVEEISIYNQDELGVNIRIK--VKNNTPIKEDTFATLQLQGITGLKFVQLQGGS 117

Query: 119 KEKKTIFQIAT-------ERNQRAMITATPSGINYFISNAENTSKKI--SDSSRHIQKII 169
           K  K +  I         + +  A I      I   +  A++ SK++    + ++++  +
Sbjct: 118 KNSKDLVSIQGKLPVIPFKESFLATIDRQSEHIFSLVKTADDKSKELLSEKNLKNLEIFL 177

Query: 170 ENIEKPLTTTIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDK 229
           +N+ +      AN + +S  L+N    I KM     ++  + +S            SL  
Sbjct: 178 QNLAELSANLNANSKNLSLNLSNTSLKIGKMADNISLSAQNFNS------------SLK- 224

Query: 230 MIKAIDLQKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKI 281
                D+++   IL+       NF+K +D+ +NT  D++ +     E+ ++I
Sbjct: 225 -----DIKESTMILK-------NFIKKADEKLNTYDDIKASLMQNLELFKRI 264


>gi|206559097|ref|YP_002229857.1| mce related protein [Burkholderia cenocepacia J2315]
 gi|198035134|emb|CAR51008.1| mce related protein [Burkholderia cenocepacia J2315]
          Length = 309

 Score = 58.9 bits (141), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 37/134 (27%), Positives = 68/134 (50%), Gaps = 10/134 (7%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K++    GLF +++      +++W +       P  +++ R   +V GL  D++VRF
Sbjct: 1   MENKSHAFWAGLFTIALTLAIAGTVFWFNVDRTVRVPY-DLLART--NVTGLFPDAAVRF 57

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIE------- 113
            G+ VG++  +  D+ +P     + L+  D P+  ST  ++  QG+ GI +++       
Sbjct: 58  RGLDVGKVQSIGFDRTHPGQIRIRILVDHDAPITQSTYGSLGFQGVTGIAFVQLEDTGRD 117

Query: 114 LSTLRKEKKTIFQI 127
           LS L    K I QI
Sbjct: 118 LSPLPSSPKAIAQI 131


>gi|134297085|ref|YP_001120820.1| hypothetical protein Bcep1808_2994 [Burkholderia vietnamiensis G4]
 gi|134140242|gb|ABO55985.1| Mammalian cell entry related domain protein [Burkholderia
           vietnamiensis G4]
          Length = 309

 Score = 58.9 bits (141), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 36/134 (26%), Positives = 69/134 (51%), Gaps = 10/134 (7%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K++    GLF +++      +++W +       P  +++ R   +V GL  D++VRF
Sbjct: 1   MENKSHAFWAGLFTIALTLAIAGTVFWFNVDRTVRVPY-DLLART--NVTGLFPDAAVRF 57

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIE------- 113
            G+ VG++  +  D+ +P     + L+  D P+  ST  ++  QG+ GI +++       
Sbjct: 58  RGLDVGKVQSIGFDRTHPGQIRIRILVDHDAPITQSTYGSLGFQGVTGIAFVQLEDTGRD 117

Query: 114 LSTLRKEKKTIFQI 127
           L+ L    K+I QI
Sbjct: 118 LAPLPSSSKSIAQI 131


>gi|146277757|ref|YP_001167916.1| hypothetical protein Rsph17025_1718 [Rhodobacter sphaeroides ATCC
           17025]
 gi|145555998|gb|ABP70611.1| Mammalian cell entry related domain protein [Rhodobacter
           sphaeroides ATCC 17025]
          Length = 321

 Score = 58.9 bits (141), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 37/117 (31%), Positives = 66/117 (56%), Gaps = 6/117 (5%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++  Y  +G+F +  +  +   + WL++  + D   AE  I    SV+GL   S VR+
Sbjct: 1   METRARYVLIGIFTLLSILATLGFLLWLAKV-ELDRTYAEYDILFT-SVEGLGRASPVRY 58

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIR--PDTPLYPSTTATIRTQGLAGITYIELS 115
           NG+ VG ++ + +D+E  + SL +  I+    TP+   T A + +QG+ G++Y+ LS
Sbjct: 59  NGVDVGEVLTIEVDEE--DSSLVRVRIQLAATTPVRTDTRAQVASQGVTGVSYVALS 113



 Score = 38.9 bits (89), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 26/140 (18%), Positives = 61/140 (43%), Gaps = 23/140 (16%)

Query: 330 STINTIENITSNLNDSSQKFAELMSKINNIS-----ALKENNSLFKDAQRAMHTFRDTSE 384
           +++  I  IT + ++++ +  +  ++++ ++     AL    +  ++ Q A    RDT E
Sbjct: 181 ASVQNIAAITRDASEATARLNDFTARLDTMADRAEEALATLETALEEGQGAASAARDTFE 240

Query: 385 KINRYI-----PSIGN-------------NLQNFSQSGLNDIQNLVRKLQETVNHFDDCL 426
            +NR +     P +                ++NF+ +GL    +L  + + TV +F+  +
Sbjct: 241 SVNRVVDQDVPPMLAQIRSAVAGIEQSVAGIRNFADNGLPQYASLAAETRRTVTNFNSLI 300

Query: 427 NNFERNPQDIVWGREKGSVK 446
               R+P     G +  S +
Sbjct: 301 AQISRDPARFFLGNQTPSYR 320


>gi|107023831|ref|YP_622158.1| hypothetical protein Bcen_2284 [Burkholderia cenocepacia AU 1054]
 gi|116690917|ref|YP_836540.1| hypothetical protein Bcen2424_2899 [Burkholderia cenocepacia
           HI2424]
 gi|254247080|ref|ZP_04940401.1| Mce4/Rv3499c/MTV023.06c protein [Burkholderia cenocepacia PC184]
 gi|105894020|gb|ABF77185.1| Mammalian cell entry related protein [Burkholderia cenocepacia AU
           1054]
 gi|116649006|gb|ABK09647.1| Mammalian cell entry related domain protein [Burkholderia
           cenocepacia HI2424]
 gi|124871856|gb|EAY63572.1| Mce4/Rv3499c/MTV023.06c protein [Burkholderia cenocepacia PC184]
          Length = 309

 Score = 58.9 bits (141), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 37/134 (27%), Positives = 68/134 (50%), Gaps = 10/134 (7%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K++    GLF +++      +++W +       P  +++ R   +V GL  D++VRF
Sbjct: 1   MENKSHAFWAGLFTIALTLAIAGTVFWFNVDRTVRVPY-DLLART--NVTGLFPDAAVRF 57

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIE------- 113
            G+ VG++  +  D+ +P     + L+  D P+  ST  ++  QG+ GI +++       
Sbjct: 58  RGLDVGKVQSIGFDRTHPGQIRIRILVDHDAPITQSTYGSLGFQGVTGIAFVQLEDTGRD 117

Query: 114 LSTLRKEKKTIFQI 127
           LS L    K I QI
Sbjct: 118 LSPLPSSPKAIAQI 131


>gi|167585310|ref|ZP_02377698.1| ABC transporter, periplasmic ligand binding protein [Burkholderia
           ubonensis Bu]
          Length = 308

 Score = 58.9 bits (141), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 37/134 (27%), Positives = 67/134 (50%), Gaps = 10/134 (7%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K++    GLF +++      +++W +       P  ++I R   +V GL  D++VRF
Sbjct: 1   MENKSHAFWAGLFTIALTLAIAGAVFWFNVDRAVRIPY-DLIART--NVTGLFPDAAVRF 57

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIE------- 113
            G+ VG++  +  D+  P     + L+  D P+  ST  ++  QG+ GI +++       
Sbjct: 58  RGLDVGKVQSIGFDRSRPGQIRIRILVDKDAPITQSTFGSLGFQGVTGIAFVQLDDTGTD 117

Query: 114 LSTLRKEKKTIFQI 127
           LS L    K + QI
Sbjct: 118 LSPLPSSVKAVAQI 131


>gi|34558308|ref|NP_908123.1| ABC transporter permease [Wolinella succinogenes DSM 1740]
 gi|34484027|emb|CAE11023.1| conserved hypothetical protein-Permease component of an
           ABC-transporter [Wolinella succinogenes]
          Length = 298

 Score = 58.5 bits (140), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 47/208 (22%), Positives = 93/208 (44%), Gaps = 19/208 (9%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++  YT VG F ++ +      ++W+ R  +         +       G+   + VRF
Sbjct: 1   MENRLSYTLVGGFFIACMVAMALFVWWIGRYGEDREAYRPYYLLTKELQSGIKKQTPVRF 60

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            GIPVG + G    +E+      +  +  + P+   + A I +QGL+GI+YI +     E
Sbjct: 61  QGIPVGFVRGFDFSKEHSGWIEIELWVEQEIPIKRDSLAVIESQGLSGISYIAIKQ-GSE 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
              +F     R+++A++    + +      A+  S+ +S +   I  ++E          
Sbjct: 120 DSPLFG----RDEKAILNLGETLVEKIGGRADMISQDLSVTLGRINALLEE--------- 166

Query: 181 ANIETISTVLANNISHIDK-MMHTTQVT 207
            N++ I+++L +     D+ M+H  Q T
Sbjct: 167 KNLQKIASILEST----DRVMLHLAQGT 190


>gi|28198462|ref|NP_778776.1| ABC transporter permease [Xylella fastidiosa Temecula1]
 gi|182681135|ref|YP_001829295.1| hypothetical protein XfasM23_0577 [Xylella fastidiosa M23]
 gi|28056546|gb|AAO28425.1| ABC transporter permease [Xylella fastidiosa Temecula1]
 gi|182631245|gb|ACB92021.1| Mammalian cell entry related domain protein [Xylella fastidiosa
           M23]
 gi|307579583|gb|ADN63552.1| hypothetical protein XFLM_08240 [Xylella fastidiosa subsp.
           fastidiosa GB514]
          Length = 308

 Score = 58.5 bits (140), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 68/294 (23%), Positives = 131/294 (44%), Gaps = 17/294 (5%)

Query: 1   MESKNYYTSVGLF-VVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVR 59
           ME+K  Y  +G F +++ L    F ++    S+        V+ R   +V GLS  S V+
Sbjct: 1   METKANYVLIGSFTILTGLALLIFGLWAAKYSSDRTWQNYRVVFR--EAVTGLSVGSPVQ 58

Query: 60  FNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRK 119
           +NGI +G I  L L    P   +A   +   TP+   T A +    L G + I+LS    
Sbjct: 59  YNGIAIGSITQLTLAPNDPRQVVAHIRVNSTTPVKKDTRAKLAITSLTGPSIIQLSGGTP 118

Query: 120 EKKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISD-----SSRHIQKIIENIEK 174
           E  ++  I   ++   +I  TPS +      A +  +++ D     +   I  I++N++K
Sbjct: 119 ESPSLTSI--YKDDAPIIQTTPSALQNITDTANDIVERLYDVLSDKNVAAISTILQNMQK 176

Query: 175 PLTTTIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKM---I 231
            ++  +++ +T    L  +     + ++TT  T + +  +   N +  L   L+K+   +
Sbjct: 177 -ISGQVSDSDTGLEALLTSARDATRQLNTTLTTANGTVQQLDNNLVKQLPIILNKLEATL 235

Query: 232 KAID--LQKVNQILENIQVSSNNFVKSS-DQVINTVHDVRETTQTFQEVGQKID 282
             ID      N IL+N Q + N+F      Q   T+ ++    +  +++  K++
Sbjct: 236 TKIDATASNANSILDNNQAAINSFANEGLSQFAPTMSELSNLIRDLRQISNKLE 289


>gi|261885876|ref|ZP_06009915.1| putative ABC transport system periplasmic substrate-binding protein
           [Campylobacter fetus subsp. venerealis str. Azul-94]
          Length = 234

 Score = 58.5 bits (140), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 35/116 (30%), Positives = 55/116 (47%), Gaps = 3/116 (2%)

Query: 1   MESKNYYTSVGLFVVSIL-FFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVR 59
           ME+KN Y   GLF   +L   +FF +Y   + N+  G      I      +G+  DS VR
Sbjct: 1   MENKNSYFIAGLFFCIVLAMLTFFVLYMNIKGNE--GETRYYYIETKELPNGIKNDSQVR 58

Query: 60  FNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELS 115
           F G+P G +  ++           K  ++ D P+   + A +  QG++GI YI +S
Sbjct: 59  FIGVPAGIVKDIYFSDPKSATIEIKMSLKKDLPIKRDSVAVVEVQGISGIAYINIS 114


>gi|118475119|ref|YP_891670.1| putative ABC transport system periplasmic substrate-binding protein
           [Campylobacter fetus subsp. fetus 82-40]
 gi|28974223|gb|AAO64224.1| putative ABC transport system periplasmic substrate-binding protein
           Cf0018 [Campylobacter fetus]
 gi|118414345|gb|ABK82765.1| putative ABC transport system periplasmic substrate-binding protein
           [Campylobacter fetus subsp. fetus 82-40]
          Length = 304

 Score = 58.5 bits (140), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 35/116 (30%), Positives = 55/116 (47%), Gaps = 3/116 (2%)

Query: 1   MESKNYYTSVGLFVVSIL-FFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVR 59
           ME+KN Y   GLF   +L   +FF +Y   + N+  G      I      +G+  DS VR
Sbjct: 1   MENKNSYFIAGLFFCIVLAMLTFFVLYMNIKGNE--GETRYYYIETKELPNGIKNDSQVR 58

Query: 60  FNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELS 115
           F G+P G +  ++           K  ++ D P+   + A +  QG++GI YI +S
Sbjct: 59  FIGVPAGIVKDIYFSDPKSATIEIKMSLKKDLPIKRDSVAVVEVQGISGIAYINIS 114


>gi|172061851|ref|YP_001809503.1| hypothetical protein BamMC406_2810 [Burkholderia ambifaria MC40-6]
 gi|171994368|gb|ACB65287.1| Mammalian cell entry related domain protein [Burkholderia ambifaria
           MC40-6]
          Length = 311

 Score = 58.5 bits (140), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 36/134 (26%), Positives = 69/134 (51%), Gaps = 10/134 (7%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K++    GLF +++      +++W +       P  +++ R   +V GL  D++VRF
Sbjct: 1   MENKSHAFWAGLFTIALTLAIAGTVFWFNVDRTVRVPY-DLLART--NVTGLFPDAAVRF 57

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIE------- 113
            G+ VG++  +  D+ +P     + L+  D P+  ST  ++  QG+ GI +++       
Sbjct: 58  RGLDVGKVQSIGFDRTHPGQIRIRILVDRDAPITQSTYGSLGFQGVTGIAFVQLEDTGRD 117

Query: 114 LSTLRKEKKTIFQI 127
           L+ L    K+I QI
Sbjct: 118 LAPLPSSPKSIAQI 131


>gi|115352999|ref|YP_774838.1| hypothetical protein Bamb_2948 [Burkholderia ambifaria AMMD]
 gi|115282987|gb|ABI88504.1| Mammalian cell entry related domain protein [Burkholderia ambifaria
           AMMD]
          Length = 310

 Score = 58.2 bits (139), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 36/134 (26%), Positives = 69/134 (51%), Gaps = 10/134 (7%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K++    GLF +++      +++W +       P  +++ R   +V GL  D++VRF
Sbjct: 1   MENKSHAFWAGLFTIALTLAIAGTVFWFNVDRTVRVPY-DLLART--NVTGLFPDAAVRF 57

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIE------- 113
            G+ VG++  +  D+ +P     + L+  D P+  ST  ++  QG+ GI +++       
Sbjct: 58  RGLDVGKVQSIGFDRTHPGQIRIRILVDRDAPITQSTYGSLGFQGVTGIAFVQLEDTGRD 117

Query: 114 LSTLRKEKKTIFQI 127
           L+ L    K+I QI
Sbjct: 118 LAPLPSSPKSIAQI 131


>gi|171322066|ref|ZP_02910938.1| Mammalian cell entry related domain protein [Burkholderia ambifaria
           MEX-5]
 gi|171092628|gb|EDT37932.1| Mammalian cell entry related domain protein [Burkholderia ambifaria
           MEX-5]
          Length = 311

 Score = 58.2 bits (139), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 36/134 (26%), Positives = 68/134 (50%), Gaps = 10/134 (7%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K++    GLF +++      +++W +       P  +++ R   +V GL  D++VRF
Sbjct: 1   MENKSHAFWAGLFTIALTLAIAGTVFWFNVDRTVRVPY-DLLART--NVTGLFPDAAVRF 57

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIE------- 113
            G+ VG++  +  D+ +P     + L+  D P+  ST  ++  QG+ GI +++       
Sbjct: 58  RGLDVGKVQSIGFDRTHPGQIRIRILVDRDAPITQSTYGSLGFQGVTGIAFVQLEDTGRD 117

Query: 114 LSTLRKEKKTIFQI 127
           L+ L    K I QI
Sbjct: 118 LAPLPSSPKAIAQI 131


>gi|134279684|ref|ZP_01766396.1| ABC transporter, periplasmic substrate-binding protein
           [Burkholderia pseudomallei 305]
 gi|167736873|ref|ZP_02409647.1| ABC transporter, periplasmic substrate-binding protein
           [Burkholderia pseudomallei 14]
 gi|134248884|gb|EBA48966.1| ABC transporter, periplasmic substrate-binding protein
           [Burkholderia pseudomallei 305]
          Length = 309

 Score = 58.2 bits (139), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 35/140 (25%), Positives = 70/140 (50%), Gaps = 22/140 (15%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIP------GSVDGLST 54
           ME+K++    GLF +++L     ++YW +          +  +R+P       +V GL  
Sbjct: 1   MENKSHAFWAGLFTIALLGAIVGAVYWFN---------VDRTVRVPYDLVSRSNVTGLFP 51

Query: 55  DSSVRFNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIE- 113
           D++VR+ G+ VG++  +  D+ +P   + + L+  + P+  ST  ++  QG+ GI +++ 
Sbjct: 52  DAAVRYRGLDVGKVQSINFDRGHPGQIVIRILVDTNAPITRSTFGSLGFQGVTGIAFVQL 111

Query: 114 ------LSTLRKEKKTIFQI 127
                 L+ L    K + QI
Sbjct: 112 DDTGADLAPLPTSAKAVAQI 131


>gi|53718043|ref|YP_107029.1| mce related protein [Burkholderia pseudomallei K96243]
 gi|53724607|ref|YP_101913.1| ABC transporter periplasmic substrate-binding protein [Burkholderia
           mallei ATCC 23344]
 gi|67642418|ref|ZP_00441175.1| ABC transporter, periplasmic substrate-binding protein
           [Burkholderia mallei GB8 horse 4]
 gi|76812149|ref|YP_332028.1| ABC transporter periplasmic substrate-binding protein [Burkholderia
           pseudomallei 1710b]
 gi|121600461|ref|YP_991581.1| ABC transporter, periplasmic substrate-binding protein
           [Burkholderia mallei SAVP1]
 gi|124386612|ref|YP_001027346.1| ABC transporter, periplasmic substrate-binding protein
           [Burkholderia mallei NCTC 10229]
 gi|126439252|ref|YP_001057486.1| ABC transporter, periplasmic substrate-binding protein
           [Burkholderia pseudomallei 668]
 gi|126448984|ref|YP_001082716.1| ABC transporter, periplasmic substrate-binding protein
           [Burkholderia mallei NCTC 10247]
 gi|126454456|ref|YP_001064735.1| ABC transporter, periplasmic substrate-binding protein
           [Burkholderia pseudomallei 1106a]
 gi|167004398|ref|ZP_02270156.1| ABC transporter, periplasmic substrate-binding protein
           [Burkholderia mallei PRL-20]
 gi|167717854|ref|ZP_02401090.1| ABC transporter, periplasmic substrate-binding protein
           [Burkholderia pseudomallei DM98]
 gi|167813978|ref|ZP_02445658.1| ABC transporter, periplasmic substrate-binding protein
           [Burkholderia pseudomallei 91]
 gi|167822499|ref|ZP_02453970.1| ABC transporter, periplasmic substrate-binding protein
           [Burkholderia pseudomallei 9]
 gi|167844080|ref|ZP_02469588.1| ABC transporter, periplasmic substrate-binding protein
           [Burkholderia pseudomallei B7210]
 gi|167892584|ref|ZP_02479986.1| ABC transporter, periplasmic substrate-binding protein
           [Burkholderia pseudomallei 7894]
 gi|167901081|ref|ZP_02488286.1| ABC transporter, periplasmic substrate-binding protein
           [Burkholderia pseudomallei NCTC 13177]
 gi|167909301|ref|ZP_02496392.1| ABC transporter, periplasmic substrate-binding protein
           [Burkholderia pseudomallei 112]
 gi|167917333|ref|ZP_02504424.1| ABC transporter, periplasmic substrate-binding protein
           [Burkholderia pseudomallei BCC215]
 gi|217419794|ref|ZP_03451300.1| ABC transporter, periplasmic substrate-binding protein
           [Burkholderia pseudomallei 576]
 gi|226193726|ref|ZP_03789329.1| ABC transporter, periplasmic substrate-binding protein
           [Burkholderia pseudomallei Pakistan 9]
 gi|237810637|ref|YP_002895088.1| ABC transporter, periplasmic substrate-binding protein
           [Burkholderia pseudomallei MSHR346]
 gi|242314483|ref|ZP_04813499.1| ABC transporter, periplasmic substrate-binding protein
           [Burkholderia pseudomallei 1106b]
 gi|254176977|ref|ZP_04883634.1| ABC transporter, periplasmic substrate-binding protein
           [Burkholderia mallei ATCC 10399]
 gi|254181996|ref|ZP_04888593.1| ABC transporter, periplasmic substrate-binding protein
           [Burkholderia pseudomallei 1655]
 gi|254187925|ref|ZP_04894437.1| ABC transporter, periplasmic substrate-binding protein
           [Burkholderia pseudomallei Pasteur 52237]
 gi|254196753|ref|ZP_04903177.1| ABC transporter, periplasmic substrate-binding protein
           [Burkholderia pseudomallei S13]
 gi|254202026|ref|ZP_04908390.1| ABC transporter, periplasmic substrate-binding protein
           [Burkholderia mallei FMH]
 gi|254207357|ref|ZP_04913708.1| ABC transporter, periplasmic substrate-binding protein
           [Burkholderia mallei JHU]
 gi|254261934|ref|ZP_04952988.1| ABC transporter, periplasmic substrate-binding protein
           [Burkholderia pseudomallei 1710a]
 gi|254295955|ref|ZP_04963412.1| ABC transporter, periplasmic substrate-binding protein
           [Burkholderia pseudomallei 406e]
 gi|254357614|ref|ZP_04973888.1| ABC transporter, periplasmic substrate-binding protein
           [Burkholderia mallei 2002721280]
 gi|52208457|emb|CAH34391.1| mce related protein [Burkholderia pseudomallei K96243]
 gi|52428030|gb|AAU48623.1| ABC transporter, periplasmic substrate-binding protein
           [Burkholderia mallei ATCC 23344]
 gi|76581602|gb|ABA51077.1| ABC transporter, periplasmic substrate-binding protein
           [Burkholderia pseudomallei 1710b]
 gi|121229271|gb|ABM51789.1| ABC transporter, periplasmic substrate-binding protein
           [Burkholderia mallei SAVP1]
 gi|124294632|gb|ABN03901.1| ABC transporter, periplasmic substrate-binding protein
           [Burkholderia mallei NCTC 10229]
 gi|126218745|gb|ABN82251.1| ABC transporter, periplasmic substrate-binding protein
           [Burkholderia pseudomallei 668]
 gi|126228098|gb|ABN91638.1| ABC transporter, periplasmic substrate-binding protein
           [Burkholderia pseudomallei 1106a]
 gi|126241854|gb|ABO04947.1| ABC transporter, periplasmic substrate-binding protein
           [Burkholderia mallei NCTC 10247]
 gi|147747920|gb|EDK54996.1| ABC transporter, periplasmic substrate-binding protein
           [Burkholderia mallei FMH]
 gi|147752899|gb|EDK59965.1| ABC transporter, periplasmic substrate-binding protein
           [Burkholderia mallei JHU]
 gi|148026678|gb|EDK84763.1| ABC transporter, periplasmic substrate-binding protein
           [Burkholderia mallei 2002721280]
 gi|157805734|gb|EDO82904.1| ABC transporter, periplasmic substrate-binding protein
           [Burkholderia pseudomallei 406e]
 gi|157935605|gb|EDO91275.1| ABC transporter, periplasmic substrate-binding protein
           [Burkholderia pseudomallei Pasteur 52237]
 gi|160698018|gb|EDP87988.1| ABC transporter, periplasmic substrate-binding protein
           [Burkholderia mallei ATCC 10399]
 gi|169653496|gb|EDS86189.1| ABC transporter, periplasmic substrate-binding protein
           [Burkholderia pseudomallei S13]
 gi|184212534|gb|EDU09577.1| ABC transporter, periplasmic substrate-binding protein
           [Burkholderia pseudomallei 1655]
 gi|217397098|gb|EEC37114.1| ABC transporter, periplasmic substrate-binding protein
           [Burkholderia pseudomallei 576]
 gi|225934304|gb|EEH30288.1| ABC transporter, periplasmic substrate-binding protein
           [Burkholderia pseudomallei Pakistan 9]
 gi|237503443|gb|ACQ95761.1| ABC transporter, periplasmic substrate-binding protein
           [Burkholderia pseudomallei MSHR346]
 gi|238523567|gb|EEP87005.1| ABC transporter, periplasmic substrate-binding protein
           [Burkholderia mallei GB8 horse 4]
 gi|242137722|gb|EES24124.1| ABC transporter, periplasmic substrate-binding protein
           [Burkholderia pseudomallei 1106b]
 gi|243060280|gb|EES42466.1| ABC transporter, periplasmic substrate-binding protein
           [Burkholderia mallei PRL-20]
 gi|254220623|gb|EET10007.1| ABC transporter, periplasmic substrate-binding protein
           [Burkholderia pseudomallei 1710a]
          Length = 309

 Score = 58.2 bits (139), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 35/140 (25%), Positives = 70/140 (50%), Gaps = 22/140 (15%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIP------GSVDGLST 54
           ME+K++    GLF +++L     ++YW +          +  +R+P       +V GL  
Sbjct: 1   MENKSHAFWAGLFTIALLGAIVGAVYWFN---------VDRTVRVPYDLVSRSNVTGLFP 51

Query: 55  DSSVRFNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIE- 113
           D++VR+ G+ VG++  +  D+ +P   + + L+  + P+  ST  ++  QG+ GI +++ 
Sbjct: 52  DAAVRYRGLDVGKVQSINFDRGHPGQIVIRILVDTNAPITRSTFGSLGFQGVTGIAFVQL 111

Query: 114 ------LSTLRKEKKTIFQI 127
                 L+ L    K + QI
Sbjct: 112 DDTGADLAPLPTSAKAVAQI 131


>gi|16126559|ref|NP_421123.1| ABC transporter periplasmic substrate-binding protein [Caulobacter
           crescentus CB15]
 gi|221235341|ref|YP_002517778.1| ABC membrane transporter periplasmic protein [Caulobacter
           crescentus NA1000]
 gi|13423843|gb|AAK24291.1| ABC transporter, periplasmic substrate-binding protein, putative
           [Caulobacter crescentus CB15]
 gi|220964514|gb|ACL95870.1| ABC membrane transporter, periplasmic component [Caulobacter
           crescentus NA1000]
          Length = 312

 Score = 58.2 bits (139), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 74/338 (21%), Positives = 141/338 (41%), Gaps = 69/338 (20%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIY--WLSR------SNQYDGPMAEVIIRIPGSVDGL 52
           ME    Y  VG   +S+  F    I+  WL++       + YD       I   G V GL
Sbjct: 1   MERNANYALVG--AISLALFMGLVIFAVWLAKLSFNRDYDVYD-------ILFVGPVRGL 51

Query: 53  STDSSVRFNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYI 112
           S    V FNGI VG +  + LD+   N  +A+  +  D P+   + AT+  QG+ G+ Y+
Sbjct: 52  SQGGEVHFNGIKVGEVTRIELDKTDTNRVIARVRVTSDVPIKVDSYATLEPQGITGVNYV 111

Query: 113 ELST------LRKEKKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQ 166
           +++       L K+     ++   R QR+ ++                            
Sbjct: 112 QITAGAPNKELLKDTVKTGKVPVIRTQRSALS---------------------------- 143

Query: 167 KIIENIEKPLTTTIANIETISTVLAN-NISHIDKMMHTTQ-VTPHSSDSKNTFNTITDLI 224
            ++E     LT TI  ++ ++ VL++ NI      +   Q VT    D K       +++
Sbjct: 144 DLLEGGGTVLTRTIEALDRVNRVLSDRNIKSFGATLTNVQAVTQEMRDRK-------EIL 196

Query: 225 TSLDKMIKAIDLQKVNQILENIQVSSNNFV-----KSSDQVINTVHDVRETTQTFQEVGQ 279
               K +++ID  +  Q +  +  S+N  V     ++  ++ +   ++R T +  + +  
Sbjct: 197 ADAQKALQSID--QTAQSITELSNSANTLVDGDAKRTLKELGDAAAELRATAKDARGMVT 254

Query: 280 KIDHLLSDFSSKMKSKETSAF--LENIADSTSNMRSSI 315
           K++   SDF++    + +SA   L++ A+S   +   +
Sbjct: 255 KLEGPASDFATTGLPQLSSAIVTLQSAAESLDRLVGEV 292


>gi|170734242|ref|YP_001766189.1| hypothetical protein Bcenmc03_2908 [Burkholderia cenocepacia MC0-3]
 gi|169817484|gb|ACA92067.1| Mammalian cell entry related domain protein [Burkholderia
           cenocepacia MC0-3]
          Length = 309

 Score = 58.2 bits (139), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 36/134 (26%), Positives = 68/134 (50%), Gaps = 10/134 (7%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K++    GLF +++      +++W +       P  +++ R   +V GL  D++VRF
Sbjct: 1   MENKSHAFWAGLFTIALTLAIAGTVFWFNVDRTVRVPY-DLLART--NVTGLFPDAAVRF 57

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIE------- 113
            G+ VG++  +  D+ +P     + L+  D P+  ST  ++  QG+ GI +++       
Sbjct: 58  RGLDVGKVQSIGFDRTHPGQIRIRILVDHDAPITQSTYGSLGFQGVTGIAFVQLEDTGRD 117

Query: 114 LSTLRKEKKTIFQI 127
           L+ L    K I QI
Sbjct: 118 LAPLPSSPKAIAQI 131


>gi|167579646|ref|ZP_02372520.1| ABC transporter, periplasmic substrate-binding protein
           [Burkholderia thailandensis TXDOH]
          Length = 309

 Score = 57.8 bits (138), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 35/140 (25%), Positives = 69/140 (49%), Gaps = 22/140 (15%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIP------GSVDGLST 54
           ME+K++    GLF +++L     ++YW +          +  +R+P       +V GL  
Sbjct: 1   MENKSHAFWAGLFTIALLAAIVGAVYWFN---------VDRTVRVPYDLVSRSNVTGLFP 51

Query: 55  DSSVRFNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIE- 113
           D++VR+ G+ VG++  +  D+ +P   + + L+    P+  ST  ++  QG+ GI +++ 
Sbjct: 52  DAAVRYRGLDVGKVQSIDFDRGHPGQIVIRILVDTHAPITRSTFGSLGFQGVTGIAFVQL 111

Query: 114 ------LSTLRKEKKTIFQI 127
                 L+ L    K + QI
Sbjct: 112 DDTGADLAPLPTSAKAVAQI 131


>gi|218780628|ref|YP_002431946.1| mammalian cell entry related domain protein [Desulfatibacillum
           alkenivorans AK-01]
 gi|218762012|gb|ACL04478.1| Mammalian cell entry related domain protein [Desulfatibacillum
           alkenivorans AK-01]
          Length = 338

 Score = 57.8 bits (138), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 69/344 (20%), Positives = 142/344 (41%), Gaps = 57/344 (16%)

Query: 10  VGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRFNGIPVGRIV 69
           VGLF+++ +  +   + W+  S  Y       ++    SV GL  DS+V++ G+P+G + 
Sbjct: 10  VGLFLIAGVALTVVVVIWVGMSG-YLEKGVNYVMYFDESVQGLDQDSTVKYRGVPIGSVQ 68

Query: 70  GLFLDQEYPNHSLAKALIR------PDTPLYPSTTATIRTQGLAGITYIELSTLRKEKKT 123
            +   +   +  L + +++      P+ P++    A +++ G+ GI +IEL  L     +
Sbjct: 69  SI---EVAADGKLVEVVVKIRKGDIPEEPVF----AQLKSVGITGIMFIELD-LEPVPSS 120

Query: 124 IFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTIANI 183
           I Q  +      +I    SGIN    N E    +                        ++
Sbjct: 121 IKQEFSFETPYPVIPTRLSGINQMFRNVETMFSRFEQ--------------------MDV 160

Query: 184 ETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVNQIL 243
           E +   L  ++  +DK++  T     SS           ++ SLD++   +D ++ + IL
Sbjct: 161 EGVIVRLQRDLDSLDKVIKNTDTEAISS----------SIVESLDRLNNILDPERWDAIL 210

Query: 244 ENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAFLEN 303
            ++Q       +   +V +TV D R      +    ++D LL      + +    A  E 
Sbjct: 211 ASVQ-------QVGPEVEDTVGDARAMFNRAESALGRLDGLLLQNQENL-TLAMDALRET 262

Query: 304 IADSTSNMRSSISAIREITDQ----RQKIISTINTIENITSNLN 343
           +  + S ++   + +    D+    +Q ++ ++  +E  T NLN
Sbjct: 263 MEAAASMVKEGENLVAGTDDKFSHLQQHLLVSVQNLEKATENLN 306


>gi|57505620|ref|ZP_00371547.1| conserved hypothetical protein [Campylobacter upsaliensis RM3195]
 gi|57016167|gb|EAL52954.1| conserved hypothetical protein [Campylobacter upsaliensis RM3195]
          Length = 295

 Score = 57.8 bits (138), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 56/207 (27%), Positives = 91/207 (43%), Gaps = 13/207 (6%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K  Y  VG+F+  + F S   + WL      +       I    SV GL   + VR 
Sbjct: 1   MENKASYFWVGIFIFGVFFASLIFMLWLG-GYSEEESFEYYEIHTQESVAGLGLKAPVRL 59

Query: 61  NGIPVGRI--VGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLR 118
            G+ VG +  + ++  Q    + L K  ++ +TP+   T AT++ QG+ G+ +I+L    
Sbjct: 60  LGVEVGSVENISIYTKQNLEVNILIK--VKKETPIKEDTFATLQLQGITGLKFIQLQGGS 117

Query: 119 KEKKTIFQ------IATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENI 172
              K +        IA   +  A I      I   I  A++ SKK+  S  ++Q  IE +
Sbjct: 118 VNSKKLTSDDGYPVIAFRESFLATIDRQGERIFSLIKTADDKSKKLL-SDENLQN-IEML 175

Query: 173 EKPLTTTIANIETISTVLANNISHIDK 199
            K L     N+   S  L+ N++   K
Sbjct: 176 LKNLAQLSENLNANSKALSKNLNEASK 202


>gi|78067710|ref|YP_370479.1| ABC transporter, periplasmic ligand binding protein [Burkholderia
           sp. 383]
 gi|77968455|gb|ABB09835.1| ABC transporter, periplasmic ligand binding protein [Burkholderia
           sp. 383]
          Length = 309

 Score = 57.8 bits (138), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 36/134 (26%), Positives = 68/134 (50%), Gaps = 10/134 (7%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K++    GLF +++      +++W +       P  +++ R   +V GL  D++VRF
Sbjct: 1   MENKSHAFWAGLFTIALTLAIAGTVFWFNVDRTVRVPY-DLLART--NVTGLFPDAAVRF 57

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIE------- 113
            G+ VG++  +  D+ +P     + L+  D P+  ST  ++  QG+ GI +++       
Sbjct: 58  RGLDVGKVQSIGFDRSHPGQIRIRILVDHDAPITQSTYGSLGFQGVTGIAFVQLEDTGRD 117

Query: 114 LSTLRKEKKTIFQI 127
           L+ L    K I QI
Sbjct: 118 LAPLPSSTKAIAQI 131


>gi|121998620|ref|YP_001003407.1| hypothetical protein Hhal_1841 [Halorhodospira halophila SL1]
 gi|121590025|gb|ABM62605.1| Mammalian cell entry related domain protein [Halorhodospira
           halophila SL1]
          Length = 313

 Score = 57.8 bits (138), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 67/308 (21%), Positives = 127/308 (41%), Gaps = 31/308 (10%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++  +  +GL  ++++        WL+ S+ Y G      I     V GLS  S V+F
Sbjct: 1   METRARHFWIGLATLAMILGGILFGVWLTDSDLY-GERQRFEIVFDEDVGGLSPRSPVKF 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGL-AGITYIEL----- 114
           NGI VG I  L LD + P   +A+  +  +TP+   T A I +  L AG  +I L     
Sbjct: 60  NGINVGEIDHLGLDPDNPGRVIARITVSGETPVRTDTRAQIGSSSLFAGGAHIRLKPGDP 119

Query: 115 --STLRKEKKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENI 172
               L   ++ + +I TE +  A +      +   I+N   T+ ++  +        EN+
Sbjct: 120 DAPPLEPPEQGLARIETESSPMARLREDSDQLLAGINNLVETANQLLSA--------ENL 171

Query: 173 EKPLTTTIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIK 232
           +  LT T+ ++E  +  +A     + + +  T +      ++ T      L+  +  ++ 
Sbjct: 172 DT-LTATLNHLEQTTGAVAARRDDLGRGI--TALADGGEQAERTLQEAQQLVKEVRGLLD 228

Query: 233 AIDLQKVNQILENIQVSSNNFVKSSDQVINTVHDVRETT-------QTFQEVGQKIDHLL 285
                   +IL +   ++     SS +      D RE         Q  + + +++   L
Sbjct: 229 G----PGREILHSTARATEALEGSSREAQELFRDNREAVERGLQSLQDLEPLSEELQRTL 284

Query: 286 SDFSSKMK 293
            D  S ++
Sbjct: 285 GDLRSLLR 292


>gi|255322242|ref|ZP_05363388.1| mce related protein [Campylobacter showae RM3277]
 gi|255300615|gb|EET79886.1| mce related protein [Campylobacter showae RM3277]
          Length = 310

 Score = 57.8 bits (138), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 71/304 (23%), Positives = 139/304 (45%), Gaps = 35/304 (11%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M +K  YT +GLF V ++     + +W+    +         I+      G+  DS+V+F
Sbjct: 1   MGNKINYTLIGLFFVLVVSALGVTAWWMGGYGKRADDYRSYFIKTTSLPSGIKKDSTVKF 60

Query: 61  NGIPVGRIVGL-FLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRK 119
            G+  G +  + F D++     L  + +R D P+   +TA+   QG+ GI Y+ +S    
Sbjct: 61  IGVDAGTVKDIRFADEKEALIELELS-VRKDIPIRTDSTASAEIQGITGIGYLNIS---- 115

Query: 120 EKKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKII--ENIEKPLT 177
            + ++     ++N++A I    S  +   + AE  ++ +  + ++I K +  EN  K  +
Sbjct: 116 -RGSMDSPLFDKNEKAYIGLEASFFDKIGNRAEYLTQNLESTFKNINKFLSDENAAKFSS 174

Query: 178 TTIANIETISTVLANN------ISHIDKMMHTTQVTPHSSDS--KNTFNTITDLITSLDK 229
             ++  E +  + A N      I++ ++++    +T +      KN   T+ + + S   
Sbjct: 175 ILVSADEAMKKINAGNLDINATIANANEVLANANLTLNELKKALKNASGTL-EFVNSF-- 231

Query: 230 MIKAIDLQKVNQILENIQVSSNNFVKSSD----QVINTVHDVRE-TTQTFQEVGQKIDHL 284
             KA D     Q L+N+Q + +  +KS +      +NT+ D  E T  +FQ+       L
Sbjct: 232 TTKATD---AAQALKNLQTAISEKIKSGEYDVKDALNTIGDETERTLLSFQK-------L 281

Query: 285 LSDF 288
           +SDF
Sbjct: 282 ISDF 285


>gi|85373089|ref|YP_457151.1| ABC-type transport system periplasmic component [Erythrobacter
           litoralis HTCC2594]
 gi|84786172|gb|ABC62354.1| ABC-type transport system periplasmic component [Erythrobacter
           litoralis HTCC2594]
          Length = 316

 Score = 57.8 bits (138), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 69/303 (22%), Positives = 136/303 (44%), Gaps = 24/303 (7%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++  +  VG   +++L      I W++R N  +G   E  I    SV GL+T S V F
Sbjct: 1   METRANHIWVGAVSLALLAALAAFIIWIARFN--EGNQNEYDIFFQQSVSGLATGSQVSF 58

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQG-LAGITYIELSTLRK 119
            G+PVG++  + L +  P     +  ++ + P+   TTATI  QG   G++ I L   R 
Sbjct: 59  AGVPVGQVSQIALWERDPEFVRVRIRVQEEVPILIGTTATI--QGSFTGVSTILLDGARA 116

Query: 120 EKKTIF--QIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKII-ENIEKPL 176
               I   + +       +I   P G+   ++NA    ++++  +  +   + ++ +  L
Sbjct: 117 GAPPIACDEASACPEGVPVIPTKPGGLGELLANAPLLLERLATLTERLTLTLSDDNQAAL 176

Query: 177 TTTIANIETISTVLANNISHIDKMMHTTQVT-PHSSDSKNTFNTITD------------L 223
           T  +AN   ++  LA     I+  +   ++T   + ++ + F ++T             L
Sbjct: 177 TGILANTNAMTEDLARATPRIEATLAELEITLREAGETLDAFESVTQSTDQLINQEGQAL 236

Query: 224 ITSLDKMIK--AIDLQKVNQILENIQVSSNNFVKSSDQVIN-TVHDVRETTQTFQEVGQK 280
              L   +K  A  L  + + LE  Q ++      +    N T+ D+RET++  + V ++
Sbjct: 237 AVELRGTLKSAAGALDSLGKTLEEAQPAARQLNNQTLPAANATLQDLRETSRALRAVTER 296

Query: 281 IDH 283
           +++
Sbjct: 297 LEN 299


>gi|223040189|ref|ZP_03610468.1| mce related protein [Campylobacter rectus RM3267]
 gi|222878550|gb|EEF13652.1| mce related protein [Campylobacter rectus RM3267]
          Length = 310

 Score = 57.8 bits (138), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 66/298 (22%), Positives = 134/298 (44%), Gaps = 23/298 (7%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M +K  YT +GLF V ++     + +WL    +         I+      G+  DS+V+F
Sbjct: 1   MGNKINYTLIGLFFVLVVSALGIAAWWLGGYGKKADDYRSYFIKTTSLPSGIKKDSTVKF 60

Query: 61  NGIPVGRIVGL-FLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRK 119
            G+  G +  + F D++     L  + +R D P+   +TA+   QG+ GI Y+ +S    
Sbjct: 61  IGVDAGSVKDIRFADEKEALIELELS-VRKDIPIRTDSTASAEIQGITGIGYLNIS---- 115

Query: 120 EKKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKII--ENIEKPLT 177
            + ++     ++N++A I       +     AE  ++ +  + ++I K +  EN  K  +
Sbjct: 116 -RGSMDSPLFDKNEKAYIGLEAGFFDKIGDRAEYITQNLESTFKNINKFLSDENAAKFSS 174

Query: 178 TTIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQ 237
             ++  E +  + A N+     + +  +V  +++ + N         +S  + I +   +
Sbjct: 175 ILVSTDEAMKKINAGNLDMNATIANANEVLVNANLTLNELKKALKNASSTLEFINSFTTK 234

Query: 238 KVN--QILENIQVSSNNFVKSSD----QVINTVHDVRE-TTQTFQEVGQKIDHLLSDF 288
             +  Q L+N+Q + +  +KS +      +NT+ D  E T  +FQ+       L+SDF
Sbjct: 235 AADAAQELKNLQTAISEKIKSGEYDVKDALNTLSDETERTLLSFQK-------LISDF 285


>gi|301057236|ref|ZP_07198365.1| conserved hypothetical protein [delta proteobacterium NaphS2]
 gi|300448687|gb|EFK12323.1| conserved hypothetical protein [delta proteobacterium NaphS2]
          Length = 331

 Score = 57.4 bits (137), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 79/339 (23%), Positives = 145/339 (42%), Gaps = 54/339 (15%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M SK    +VGLFV   L  +  +I WL  S  ++     V      SV GL  DS V++
Sbjct: 1   MASKKAKFTVGLFVAGGLAITVLAIVWLGMSRYFEKGRFYVTY-FNESVQGLQKDSPVKY 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDT--PLYPSTTATIRTQGLAGITYIELSTLR 118
            G+ +GR+  + +    P+  L + +++ +T   L  S  A ++  G+ G   +EL   +
Sbjct: 60  RGVSIGRVESIGV---APDSKLIQVILKIETGQKLDHSIVAQLKNVGITGSMLVELDRKK 116

Query: 119 KEKKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKI-IENIEKPLT 177
             +       +  ++  ++ + PS IN  +         + D   H + I ++ I   L 
Sbjct: 117 MGESDKSPGISFPSEYPIVASKPSEINRLLQG-------LDDMLNHFKSIDLKGISDKLK 169

Query: 178 TTI---------ANIETISTVLANNISHIDKMMHTTQV------TPHSSDS-----KNTF 217
            T+         A+I+ IS+ L ++++  D+++   +         H+++S     KN  
Sbjct: 170 LTLDNANIMMADADIKGISSKLQSSLTSADQILKNEKWESILGSVDHAAESADALMKNAE 229

Query: 218 NTITDL---ITSLDKMI--KAIDLQKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQ 272
            T+  L   I   +K +   A DL+KV     N+      F+ SSD  +N +        
Sbjct: 230 RTLVRLENFIGENEKPVSEAATDLRKVMVNANNLLEKWAAFISSSDDTLNRL-------- 281

Query: 273 TFQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNM 311
                  K+  L+S  + +  ++    F+E IADS S +
Sbjct: 282 -------KVQLLISAQNLERATEHLDRFMEVIADSPSQL 313


>gi|170703964|ref|ZP_02894626.1| Mammalian cell entry related domain protein [Burkholderia ambifaria
           IOP40-10]
 gi|170131127|gb|EDS99792.1| Mammalian cell entry related domain protein [Burkholderia ambifaria
           IOP40-10]
          Length = 311

 Score = 57.4 bits (137), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 36/134 (26%), Positives = 68/134 (50%), Gaps = 10/134 (7%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K++    GLF +++      +++W +       P  +++ R   +V GL  D++VRF
Sbjct: 1   MENKSHAFWAGLFTIALTLAIAGTVFWFNVDRTVRVPY-DLLART--NVTGLFPDAAVRF 57

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIE------- 113
            G+ VG++  +  D+ +P     + L+  D P+  ST  ++  QG+ GI +++       
Sbjct: 58  RGLDVGKVQLIGFDRTHPGQIRIRILVDRDAPITQSTYGSLGFQGVTGIAFVQLEDTGRD 117

Query: 114 LSTLRKEKKTIFQI 127
           L+ L    K I QI
Sbjct: 118 LAPLPSSPKAIAQI 131


>gi|119897984|ref|YP_933197.1| hypothetical protein azo1693 [Azoarcus sp. BH72]
 gi|119670397|emb|CAL94310.1| conserved hypothetical secreted protein [Azoarcus sp. BH72]
          Length = 312

 Score = 57.4 bits (137), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 44/185 (23%), Positives = 82/185 (44%), Gaps = 11/185 (5%)

Query: 26  YWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRFNGIPVGRIVGLFLDQEYPNHSLAKA 85
           +W S   +   PM E ++   G+V+GL+    VR+ G+  G +  + LD + P   L + 
Sbjct: 26  WWFSDGRE---PMREYVLVSEGTVNGLNVHGRVRYRGMLAGNVAHIGLDPQNPRLILVRI 82

Query: 86  LIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKEKKT-IFQIATERNQRAMITATPSGI 144
            IR   P+   T A + TQGL G+ +++L     E+ T    +  E      I   P  +
Sbjct: 83  RIREGLPVTRGTRAMLATQGLTGLAFVQLD----ERGTDPTPLVGEDGSPPRIRLEPGVM 138

Query: 145 NYFISNAENTSKKISDSSRHIQKII--ENIEKPLTTTIANIETISTVLANNISHIDKMMH 202
                 A   +++    +  +  ++  ENI + +  ++AN+E  S  L   ++H    + 
Sbjct: 139 EQITDRALAAAERFKTVADRVALVVDDENIAR-IKRSLANLEAASAGLDRALAHAPATLE 197

Query: 203 TTQVT 207
             + T
Sbjct: 198 AVRNT 202


>gi|254458216|ref|ZP_05071642.1| mammalian cell entry related [Campylobacterales bacterium GD 1]
 gi|207085052|gb|EDZ62338.1| mammalian cell entry related [Campylobacterales bacterium GD 1]
          Length = 300

 Score = 57.4 bits (137), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 60/256 (23%), Positives = 112/256 (43%), Gaps = 30/256 (11%)

Query: 26  YWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRFNGIPVGRIVGLFLDQEYPNHSLAKA 85
           YWL +  + +    +  I    SV GL+ D++V++ GI VG++  L ++ +       + 
Sbjct: 6   YWLLKPAE-ETQTQKYNILFDESVLGLNLDAAVKYRGISVGKVSRLRINPKNSEQVEVQV 64

Query: 86  LIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKEKKTIFQIATERNQRAMITATPSGIN 145
            I   TP+  +T A +  QG+ G++YI LS        +  +A E  +  +I    S   
Sbjct: 65  TILKTTPVKETTVAKLTAQGITGLSYINLSLGDNGAANL--VAKEGEEYPVIKTEDSFFE 122

Query: 146 YFISNAENTSKKISDSSRHIQKII-ENIEKPLTTTIANIETISTVL---ANNISHIDKMM 201
            F  + E+ S K+S +    QK++ EN          N E I+ +L   A+ ++ +DK++
Sbjct: 123 QFEKSLESVSTKLSKTLSGTQKLLAEN----------NQENITLLLKSTASFMTQMDKLL 172

Query: 202 HTTQVTPHSSDSKNTFNTITDLITSLDKMIKAID--LQKVNQILENIQVSSNNFVKSSDQ 259
               +    S  KN            D   K ID  + K+   ++N     N   K+   
Sbjct: 173 SDEAIANFHSSIKN-----------FDNATKKIDVMMPKIEHFVDNSVAWENKIAKTFSS 221

Query: 260 VINTVHDVRETTQTFQ 275
           ++N+   ++ +   F+
Sbjct: 222 IMNSYLGIKASMDRFK 237


>gi|313683001|ref|YP_004060739.1| mammalian cell entry related domain protein [Sulfuricurvum kujiense
           DSM 16994]
 gi|313155861|gb|ADR34539.1| Mammalian cell entry related domain protein [Sulfuricurvum kujiense
           DSM 16994]
          Length = 322

 Score = 57.4 bits (137), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 36/122 (29%), Positives = 69/122 (56%), Gaps = 14/122 (11%)

Query: 1   MESKNYYTSVGLFV----VSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDS 56
           MES+  YT++G+FV    V+++ F F    WL + +Q +       + +  SV GLS ++
Sbjct: 1   MESRVNYTAIGVFVILFTVAVVAFGF----WLGKYSQDERLYRRYKVYMTESVSGLSPEA 56

Query: 57  SVRFNGIPVGRIVGLFLDQEYPNHSLAKAL---IRPDTPLYPSTTATIRTQGLAGITYIE 113
           +V+F G+ VG++  +   Q  P++S    L   I+ +TP+   + A ++  G+ G+ +IE
Sbjct: 57  AVKFQGVDVGKVESI---QINPHNSEEVELTLKIKKETPIKTDSNAMLKFYGITGLAFIE 113

Query: 114 LS 115
           ++
Sbjct: 114 IA 115


>gi|103485972|ref|YP_615533.1| hypothetical protein Sala_0479 [Sphingopyxis alaskensis RB2256]
 gi|98976049|gb|ABF52200.1| Mammalian cell entry related [Sphingopyxis alaskensis RB2256]
          Length = 313

 Score = 57.0 bits (136), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 67/313 (21%), Positives = 136/313 (43%), Gaps = 28/313 (8%)

Query: 1   MESKNYYTSVGLFVVSILF---FSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSS 57
           ME+++    VG FV  +LF    +FF + WL+  N   G   E  I    SVDGL+  + 
Sbjct: 1   METRSNNILVGAFV--LLFTAALAFF-VVWLA--NDSGGAKREYDIFFKQSVDGLNKGAQ 55

Query: 58  VRFNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTL 117
           V+F+G+P G++  + L  + P     +  +    P+   TTA +   G  G++ I L   
Sbjct: 56  VQFSGVPSGQVREIALWPDDPQFVRVRIEVNEGVPVLQGTTAALEGVGFTGVSQISLDGA 115

Query: 118 RKEKKTIFQIATERN--QRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENI-EK 174
            K    I    T++    + +I     G+   ++ A    +++S  +  + ++ ++  + 
Sbjct: 116 VKGAPPI----TDKGPAGKPVIPTRVGGLGEILNTAPQLLQRLSTLTERLAELADDENQA 171

Query: 175 PLTTTIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAI 234
            +   + N+E  + +LA N   I++ +  T++    +          + I +L    +  
Sbjct: 172 SIRGILNNVEASTAILARNGPAIERALADTRIAIQQT------GIAAEQIGNLAAAAQGT 225

Query: 235 DLQKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVG-QKIDHLLSDFSSKMK 293
             + V+  + N++ +  +   S   +   + D R   +TF E    + + L+ D      
Sbjct: 226 IDRNVDPAMANLRDTLKSANASMKTLEGAIADARPGLKTFSETTIPEANALIRDL----- 280

Query: 294 SKETSAFLENIAD 306
            + TSA L ++ D
Sbjct: 281 -RRTSASLSSLTD 292


>gi|121612777|ref|YP_001001291.1| ABC transporter, periplasmic substrate-binding protein, putative
           [Campylobacter jejuni subsp. jejuni 81-176]
 gi|167006185|ref|ZP_02271943.1| ABC transporter, periplasmic substrate-binding protein, putative
           [Campylobacter jejuni subsp. jejuni 81-176]
 gi|87249981|gb|EAQ72940.1| ABC transporter, periplasmic substrate-binding protein, putative
           [Campylobacter jejuni subsp. jejuni 81-176]
          Length = 296

 Score = 57.0 bits (136), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 66/292 (22%), Positives = 131/292 (44%), Gaps = 39/292 (13%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++  Y  VGLFV  + F S   I WL   ++ +       I    SV GL   + VR 
Sbjct: 1   MENRANYFFVGLFVFGVFFASLGFILWLGGYSKEE-SFKYYEIHTQESVAGLGIKAPVRL 59

Query: 61  NGIPVGRI--VGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLR 118
            G+ VG +  + ++   E   +   K  ++ +TP+   T AT++ QG+ G+ +++L    
Sbjct: 60  LGVEVGSVEEISIYNQDELGVNIRIK--VKNNTPIKEDTFATLQLQGITGLKFVQLQGGS 117

Query: 119 KEKKTIFQIAT-------ERNQRAMITATPSGINYFISNAENTSKKI--SDSSRHIQKII 169
           K  K +  I         + +  A I      I   +  A++ SK++    + ++++ ++
Sbjct: 118 KNSKDLVSIQGKLPVIPFKESFLATIDRQSEHIFSLVKTADDKSKELLSEKNLKNLEILL 177

Query: 170 ENIEKPLTTTIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDK 229
           +N+ +      AN + +S  L+N    I KM +   ++  +      FN      +SL  
Sbjct: 178 QNLAELSANLNANSKNLSLNLSNASLKIGKMANNISLSAQN------FN------SSLK- 224

Query: 230 MIKAIDLQKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKI 281
                D+++   IL+        F+K +D+ +NT  D++ +     E+ +++
Sbjct: 225 -----DIKESTMILK-------KFIKKADEKLNTYDDIKASLMQNLELFKRV 264


>gi|149187030|ref|ZP_01865337.1| ABC-type transport system periplasmic component [Erythrobacter sp.
           SD-21]
 gi|148829319|gb|EDL47763.1| ABC-type transport system periplasmic component [Erythrobacter sp.
           SD-21]
          Length = 299

 Score = 57.0 bits (136), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 62/281 (22%), Positives = 124/281 (44%), Gaps = 29/281 (10%)

Query: 25  IYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRFNGIPVGRIVGLFLDQEYPNHSLAK 84
           I W++R    +G   E  I    SV GL+  S V F G+PVG++  + L  + P     +
Sbjct: 9   IVWIARWG--EGAQKEYDIFFKESVSGLANGSQVAFAGVPVGQVSQIVLWDKDPEFVRVR 66

Query: 85  ALIRPDTPLYPSTTATIRTQG-LAGITYIELSTLRKEKKTIFQIATERNQRA-MITATPS 142
             ++ + P+   TTATI  QG   G++ I L   R     I    T   +   +I     
Sbjct: 67  ISVKDEVPILVGTTATI--QGSFTGVSTILLDGARSGAPPISCETTACTEGVPIIPPKDG 124

Query: 143 GINYFISNAENTSKKISDSSRHIQKIIENI-EKPLTTTIANIETISTVLANNISHIDKMM 201
           G+N  +SNA    ++++  +  + +++++  +  +   +AN   ++  LA      +  M
Sbjct: 125 GLNALLSNAPLLLERLATLTERLTQLLDDENQGEIAGILANTNQMTADLAQAAPQFESTM 184

Query: 202 HTTQVT-PHSSDSKNTFNTITDLITSLDKMIKAIDLQKVNQILENIQVSSN--------- 251
              Q+T   +S++ + F  +T    S D+++        +Q+ + ++ + N         
Sbjct: 185 AELQMTLREASEALDQFEQVT---ASTDRLLNQEGAALADQLRQTLKQAGNASEELQGVL 241

Query: 252 -NFVKSSDQVIN--------TVHDVRETTQTFQEVGQKIDH 283
                ++ Q+          T+ D+R T++  ++V +KID 
Sbjct: 242 AEARPATKQLTESTLPAAEATLRDLRATSKALRDVTEKIDE 282


>gi|291279511|ref|YP_003496346.1| ABC transporter substrate-binding protein [Deferribacter
           desulfuricans SSM1]
 gi|290754213|dbj|BAI80590.1| ABC transporter, substrate-binding protein [Deferribacter
           desulfuricans SSM1]
          Length = 526

 Score = 57.0 bits (136), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 82/350 (23%), Positives = 149/350 (42%), Gaps = 76/350 (21%)

Query: 10  VGLFVV-SILFFSFFSI----YWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRFNGIP 64
           VG+FVV  +L   + +       L +S+ Y+      II       GL  DS V++ G+ 
Sbjct: 9   VGIFVVIGLLLLGYMTTKVEDLKLGKSDGYE------IIAYLNDASGLVKDSYVKYRGVE 62

Query: 65  VGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKEKKTI 124
           VG++  + L +   NH     LI     L  +  A +R+ G  G  Y+EL T+ KE +  
Sbjct: 63  VGKVKDIRLKE---NHVEVVLLIDKQYKLPSNVAAIVRSSGFLGEKYLELQTVGKETEGY 119

Query: 125 FQIATE-RNQRAM----------------ITATPSGINYFI------SNAENTSKKISDS 161
               +E +N ++                 I A  + +   I      ++ + T + I  S
Sbjct: 120 LTTGSEIKNYKSSADFDELQNKFSEIADDIKAITASLKEVIASDNGKADMKMTLQNIRYS 179

Query: 162 SRHIQKIIENIEKPLTTTIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTIT 221
           + +I++++E  +K +   + NIE I+  + N             VT  + ++ N      
Sbjct: 180 TEYIRQMLEENQKRINQIVKNIEAITASIKN-------------VTEANQENVNQ----- 221

Query: 222 DLITSLDKMIKAIDLQ------KVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQ 275
            LIT+L ++ + +  Q      K+N I  NI           D V N+  D+RET    +
Sbjct: 222 -LITNLKEVSETLKNQTPQIAKKINNITTNI----------DDLVGNSKGDLRETISNIK 270

Query: 276 EVGQKIDHL---LSDFSSKM-KSKETSAFLENIADSTSNMRSSISAIREI 321
            V  K++     L+D + K+ K K T   L N  ++  +++ +I  ++ +
Sbjct: 271 VVTAKLEKTVDNLNDITDKINKGKGTVGTLINDNETAKDVKDTIKGLKNL 320


>gi|82703104|ref|YP_412670.1| hypothetical protein Nmul_A1983 [Nitrosospira multiformis ATCC
           25196]
 gi|82411169|gb|ABB75278.1| Mammalian cell entry related protein [Nitrosospira multiformis ATCC
           25196]
          Length = 301

 Score = 57.0 bits (136), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 65/288 (22%), Positives = 128/288 (44%), Gaps = 55/288 (19%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRS----NQYDGPMAEVIIRIPGSVDGLSTDS 56
           ME++ +  + GLFV+ +      ++ W        N+Y      ++  +P  V GL++ +
Sbjct: 1   MENRAHALAAGLFVIILGTALVAAVLWFGGDTMMRNKY-----MLVSEMP--VSGLNSQA 53

Query: 57  SVRFNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELST 116
            VR+ G+ VG++  + LD+E P+  L +  +  + PL  +  A +  QGL G+ Y++L+ 
Sbjct: 54  IVRYRGVTVGKVENIKLDKEDPHKILIQIAVDKNVPLTRNAFAQLGYQGLTGLAYVQLN- 112

Query: 117 LRKEKKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPL 176
              E     Q+ T+ ++   I   PS    F S        I+ S +H+          L
Sbjct: 113 --DEDGETEQLETDSDEPPQIPLRPS---LFDS--------ITSSGQHL----------L 149

Query: 177 TTTIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDL 236
            T    IE ++ +L +   +  + MH  + T  ++        ++ ++  L+  +KAI  
Sbjct: 150 GTASVLIERMNLLLED--ENRTRFMHILENTEKAT------GRLSRVLNQLEPGLKAI-- 199

Query: 237 QKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHL 284
                    +   +++ +K++DQ+   V D+ + T      G  ID L
Sbjct: 200 -------PGLAADASSVMKNADQL---VVDLNQITSRLNRQGGAIDGL 237


>gi|163744193|ref|ZP_02151553.1| Putative ABC transporter, periplasmic substrate-binding protein
           [Oceanibulbus indolifex HEL-45]
 gi|161381011|gb|EDQ05420.1| Putative ABC transporter, periplasmic substrate-binding protein
           [Oceanibulbus indolifex HEL-45]
          Length = 571

 Score = 57.0 bits (136), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 43/169 (25%), Positives = 79/169 (46%), Gaps = 5/169 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++  +  +G F ++I+  +     WLS S Q D   A   I     V GL    +V F
Sbjct: 1   METRANFILIGAFTLAIIIGTLGFFIWLS-SVQIDRQYATYGILFD-DVSGLDPSGNVLF 58

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NGI VG++ G+ + ++  +       I   TP+  +T A +++QG+ G+ YI LS     
Sbjct: 59  NGISVGKVTGINIHEDDASKVFVTIEIDSSTPVRANTVAQVQSQGVTGVAYISLS---GG 115

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKII 169
                 +  E++   MI +  S +   + +A +   + +D    +Q ++
Sbjct: 116 TPGAAPLEAEQDGLPMIPSERSTVQLLVEDAPDLMVQANDLMAQLQALL 164


>gi|315639124|ref|ZP_07894291.1| ABC superfamily ATP binding cassette transporter periplasmic
           substrate-binding protein [Campylobacter upsaliensis
           JV21]
 gi|315480828|gb|EFU71465.1| ABC superfamily ATP binding cassette transporter periplasmic
           substrate-binding protein [Campylobacter upsaliensis
           JV21]
          Length = 295

 Score = 56.6 bits (135), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 55/207 (26%), Positives = 91/207 (43%), Gaps = 13/207 (6%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K  Y  VG+F+  + F S   + WL      +       I    SV GL   + VR 
Sbjct: 1   MENKASYFWVGIFIFGVFFVSLIFMLWLG-GYSEEESFEYYEIHTQESVAGLGLKAPVRL 59

Query: 61  NGIPVGRI--VGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLR 118
            G+ VG +  + ++  Q    + L K  ++ +TP+   T AT++ QG+ G+ +I+L    
Sbjct: 60  LGVEVGSVENISIYTKQNLGVNILIK--VKKETPIKEDTFATLQLQGITGLKFIQLQGGS 117

Query: 119 KEKKTIFQ------IATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENI 172
              K +        IA   +  A I      I   I  A++ SK++  S  ++Q  IE +
Sbjct: 118 VNSKKLTGDDGYPVIAFRESFLATIDRQGERIFSLIKTADDKSKRLL-SDENLQN-IEML 175

Query: 173 EKPLTTTIANIETISTVLANNISHIDK 199
            K L     N+   S  L+ N++   K
Sbjct: 176 LKNLAQLSENLNANSKALSKNLNEASK 202


>gi|312797430|ref|YP_004030352.1| hypothetical protein RBRH_02223 [Burkholderia rhizoxinica HKI 454]
 gi|312169205|emb|CBW76208.1| Hypothetical exported protein [Burkholderia rhizoxinica HKI 454]
          Length = 345

 Score = 56.6 bits (135), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 33/114 (28%), Positives = 56/114 (49%), Gaps = 3/114 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K++    GLF + +L     +I W S       P   V      +V GL  D++VR+
Sbjct: 27  MENKSHAFWAGLFTIVLLVAIALTIAWFSMDRTERVPYDLVATT---NVTGLRADAAVRY 83

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIEL 114
            G+ VG +  +  D   P   + + L+    PL  S+ A++  QG+ G+ +I+L
Sbjct: 84  RGLAVGNVQNIHFDTHRPGRIVIRILVDKRVPLTHSSFASLGLQGVTGLGFIQL 137


>gi|295675323|ref|YP_003603847.1| Mammalian cell entry related domain protein [Burkholderia sp.
           CCGE1002]
 gi|295435166|gb|ADG14336.1| Mammalian cell entry related domain protein [Burkholderia sp.
           CCGE1002]
          Length = 325

 Score = 56.2 bits (134), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 50/236 (21%), Positives = 106/236 (44%), Gaps = 16/236 (6%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K +    GLF V +      + Y  +       P  ++I R   +V GL  D++VRF
Sbjct: 1   MENKAHAFWAGLFTVVLTAAIALAAYLFNVDRTVRVPY-DLIART--NVTGLFADAAVRF 57

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G+ VGR+  +  D  +P   L + ++    P+  ST  ++  QG+ GI +I+L    ++
Sbjct: 58  RGLDVGRVQSIKFDPAHPGQILIRIMVDEHAPITHSTFGSLGLQGVTGIAFIQLDDTGRD 117

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTT-T 179
              +  + +  +Q A +   P  ++      +   +K       ++K+ +N+   L+   
Sbjct: 118 ---LTPLHSSVHQVAQLPMRPGLLDQLQQRGDVLLRK-------LEKVTDNVNDMLSPEM 167

Query: 180 IANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAID 235
           +  +   +  +A   S +  +  T ++ P +S    T + +   + S ++MI  ++
Sbjct: 168 VEQLHETAASIAQAASGVATL--TREMAPVASKLPGTIDQLNHTLASTNQMITGLN 221


>gi|332187413|ref|ZP_08389151.1| mce related family protein [Sphingomonas sp. S17]
 gi|332012574|gb|EGI54641.1| mce related family protein [Sphingomonas sp. S17]
          Length = 320

 Score = 56.2 bits (134), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 66/314 (21%), Positives = 138/314 (43%), Gaps = 24/314 (7%)

Query: 1   MESKNYYTSVGLFVVSIL-FFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVR 59
           ME+++ +  VG  V+ +L   + F++ W++R         ++  R   SVDGL+  S+V 
Sbjct: 1   METRSNHVLVGSVVLILLAVLAIFTV-WIARLGGTSEKEYDIFFR--QSVDGLAKGSAVT 57

Query: 60  FNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRK 119
           ++G+P G++  + L +  P     +  +   TP+   TTA+I +    G + I L   RK
Sbjct: 58  YSGVPSGQVKEIALWRPDPQFVRVRVSVNEQTPILQGTTASI-SASFTGTSTISLDGARK 116

Query: 120 EKKTIFQIATERNQRAMITATP------SGINYFISNAENTSKKISDSSRHIQKIIENI- 172
               I     E N+       P       GI   +++A    +++S  +  +  ++ +  
Sbjct: 117 GAPPITCPQPE-NRSVCPYGVPVIPTKQGGIGAILNSAPQLLERLSTLTERLTGLLSDRN 175

Query: 173 EKPLTTTIANIETISTVLANNISHIDKMMHTTQVT-PHSSDSKNTFNTITDLITSLDKMI 231
           +  +   + N   ++  LA+    I   +  T+V    + D+  +       I  L    
Sbjct: 176 QASIAGILENTNRLTDALADRGPEIAATLAQTRVAIQQAGDAAQS-------IGQLAATT 228

Query: 232 KAIDLQKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTF-QEVGQKIDHLLSDFSS 290
             I  ++V   + N+  +  +  KS+D + + + D R   QTF ++   ++D L+ D   
Sbjct: 229 NGILAEEVKPTMANLNKAIASAQKSADTLNSAIGDARPGLQTFSKQTVPEVDRLVRDL-- 286

Query: 291 KMKSKETSAFLENI 304
           ++ ++  +A  E +
Sbjct: 287 RVMTQSLAAVAEKV 300


>gi|187922500|ref|YP_001894142.1| hypothetical protein Bphyt_0493 [Burkholderia phytofirmans PsJN]
 gi|187713694|gb|ACD14918.1| Mammalian cell entry related domain protein [Burkholderia
           phytofirmans PsJN]
          Length = 320

 Score = 56.2 bits (134), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 60/302 (19%), Positives = 138/302 (45%), Gaps = 20/302 (6%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K++    GLF + +L     + +  +       P  ++I R   +V GL TD++VR+
Sbjct: 1   MENKSHAFWAGLFTIVLLVAIALAGFLFNVDRSVRVPY-DLIART--NVTGLFTDAAVRY 57

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G+ VG++  +  D  +P   L + L+    P+  ST  ++  QG+ GI +I+L    ++
Sbjct: 58  RGLDVGKVQSIKFDPAHPGQILIRILVDTHAPITHSTFGSLGFQGVTGIAFIQLDDNGRD 117

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
                 +A+   Q A +   P  ++      +   +K       ++K+ +++++ L+  +
Sbjct: 118 PTP---LASSPKQVAQLPMRPGLLDQLQQRGDVLLRK-------LEKVTDDVDRLLSPEM 167

Query: 181 -ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKV 239
            A ++  +  L      +  +  T ++ P +     T N +   + S +++I +  L + 
Sbjct: 168 AAQLQGTAASLQQAADGVATL--TQKIAPAAGMLPGTINQLDRTLASTNQLITS--LNRP 223

Query: 240 NQILE-NIQVSSNNFVKSSDQVINTVHDVRE-TTQTFQEVGQKIDHLLSDFSSKMKSKET 297
           N   E N+        ++ D +++    V+E +++   +   +++ L  D  S  +S + 
Sbjct: 224 NGPFETNLNKVGTAAQQAGDALVSINGAVQELSSRVGYDTLPRVNSLAEDVRSAARSVDR 283

Query: 298 SA 299
           +A
Sbjct: 284 AA 285


>gi|78357342|ref|YP_388791.1| putative ABC transport system substrate-binding protein
           [Desulfovibrio desulfuricans subsp. desulfuricans str.
           G20]
 gi|78219747|gb|ABB39096.1| putative ABC transport system substrate-binding protein
           [Desulfovibrio desulfuricans subsp. desulfuricans str.
           G20]
          Length = 148

 Score = 56.2 bits (134), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 37/108 (34%), Positives = 56/108 (51%), Gaps = 2/108 (1%)

Query: 8   TSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRFNGIPVGR 67
           TSVG+FV+  L    +    L +   +      V  R   SV GL   + V  +G+PVG+
Sbjct: 8   TSVGIFVLIGLLCLGYVTVKLGKMEVFSSEGYTVQARFT-SVTGLRVGADVEISGVPVGK 66

Query: 68  IVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELS 115
           + G+ LDQ   N ++    +RPD  L   T A+++T GL G  Y++LS
Sbjct: 67  VSGINLDQ-MDNVAVVSLRLRPDVELSEDTIASVKTSGLIGDKYVKLS 113


>gi|186474976|ref|YP_001856446.1| hypothetical protein Bphy_0207 [Burkholderia phymatum STM815]
 gi|184191435|gb|ACC69400.1| Mammalian cell entry related domain protein [Burkholderia phymatum
           STM815]
          Length = 320

 Score = 56.2 bits (134), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 61/305 (20%), Positives = 137/305 (44%), Gaps = 26/305 (8%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K++    GLF V ++     + +  +       P  ++I R   +V GL  D++VR+
Sbjct: 1   MENKSHAFWAGLFTVVMVAAIAAAAFLFNVDRSVRIPF-DLIART--NVTGLYPDAAVRY 57

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G+ VG++  +  D+E+P   L + L+  + P+  ST  ++  QG+ G+ +I+L    ++
Sbjct: 58  RGLDVGKVQSIKFDREHPGQILIRILVDKNAPITHSTFGSLGLQGVTGLAFIQLDDTGRD 117

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKII-ENIEKPLTTT 179
                 +A+     A +   P  ++   +  +   +++  + R +  ++   +   L  T
Sbjct: 118 TT---PLASSAKSVAQLPMRPGLLDQLQARGDILIRQLEKTVRDVDALLSPEMRDQLLAT 174

Query: 180 IANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKV 239
            A+++      A+ ++ +     T Q+ P      +T   +   + S ++MI   +L + 
Sbjct: 175 AASLQHA----ADGVTTL-----TAQMGPAVGKLPDTLTALDQTLASTNRMIT--NLNRP 223

Query: 240 NQILENIQVSSNNFVKSSDQVINTVHDVRETTQTF-QEVG----QKIDHLLSDFSSKMKS 294
           +  LE    + N    ++ Q  + +  +  T Q     VG     +++ L  D  S ++S
Sbjct: 224 DGPLEG---TLNKVGTAAQQAGDALTAMNATLQDISARVGYDTLPRVNSLADDVRSAVRS 280

Query: 295 KETSA 299
            + +A
Sbjct: 281 VDRAA 285


>gi|86152242|ref|ZP_01070453.1| ABC transporter, periplasmic substrate-binding protein, putative
           [Campylobacter jejuni subsp. jejuni 260.94]
 gi|85840731|gb|EAQ57982.1| ABC transporter, periplasmic substrate-binding protein, putative
           [Campylobacter jejuni subsp. jejuni 260.94]
          Length = 296

 Score = 55.8 bits (133), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 67/293 (22%), Positives = 131/293 (44%), Gaps = 41/293 (13%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++  Y  VGLFV  + F S   I WL   ++ +       I    SV GL   + VR 
Sbjct: 1   MENRANYFFVGLFVFGVFFASLGFILWLGGYSKEE-SFKYYEIHTQESVAGLGIKAPVRL 59

Query: 61  NGIPVGRI--VGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLR 118
            G+ VG +  + ++   E   +   K  ++ +TP+   T AT++ QG+ G+ +++L    
Sbjct: 60  LGVEVGSVEEISIYNQDELGVNIRIK--VKNNTPIKEDTFATLQLQGIIGLKFVQLQGGS 117

Query: 119 KEKKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIE---KP 175
           K  K +  I      +  +   P   ++  +        I   S HI  +++  +   K 
Sbjct: 118 KNSKDLVSI------QGKLPVIPFKESFLAT--------IDRQSEHIFSLVKTADDKSKE 163

Query: 176 LTT--TIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKA 233
           L +   + N+E    +L  N++ +   ++        ++SKN    +++    + KM   
Sbjct: 164 LLSEKNLKNLE----ILLQNLAELSANLN--------ANSKNLSLNLSNASLKIGKMADN 211

Query: 234 IDL--QKVNQILENIQVSS---NNFVKSSDQVINTVHDVRETTQTFQEVGQKI 281
           I L  Q  N  L++I+ S+     F+K +D+ +NT  D++ +     E+ +++
Sbjct: 212 ISLSAQNFNSNLKDIKESTMILKKFIKKADEKLNTYDDIKASLMQNLELFKRV 264


>gi|121607912|ref|YP_995719.1| hypothetical protein Veis_0922 [Verminephrobacter eiseniae EF01-2]
 gi|121552552|gb|ABM56701.1| Mammalian cell entry related domain protein [Verminephrobacter
           eiseniae EF01-2]
          Length = 321

 Score = 55.8 bits (133), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 46/230 (20%), Positives = 101/230 (43%), Gaps = 19/230 (8%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K++  + GLFV+ +         WL+R N Y     E  +     V GL   ++VR+
Sbjct: 1   MENKSHALAAGLFVLLVAAMLAGLSLWLTRDNAY---YEEYELSTRDGVSGLQPQANVRY 57

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G+ VG++  +  D +   + L +  +    P+ P+T A +  QG+ G+ ++    L  +
Sbjct: 58  KGVAVGKVTRIGFDPQVNGNVLIRIAVNEQAPISPTTYAVLGYQGVTGLAHV----LLDD 113

Query: 121 KKTIF-QIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTT- 178
             T +  +         +   PS        A     +  +++R I +++ +  + L T 
Sbjct: 114 AATPYPALPPGPGGLPRLPLKPSPFGRLAEQAPTILAQADEATRRINQLLGDGNQQLLTE 173

Query: 179 -------TIANIETISTVLANNISH-IDKMMHTTQVTPHSSDSKNTFNTI 220
                    ++I+T++  L  +++  +D  +    + P + D++ T  ++
Sbjct: 174 ALGHFSQVASHIDTLTRRLDASVAQRLDSAL--AALPPLADDARKTLQSL 221


>gi|209521693|ref|ZP_03270383.1| Mammalian cell entry related domain protein [Burkholderia sp. H160]
 gi|209497884|gb|EDZ98049.1| Mammalian cell entry related domain protein [Burkholderia sp. H160]
          Length = 289

 Score = 55.5 bits (132), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 51/232 (21%), Positives = 103/232 (44%), Gaps = 16/232 (6%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K +    GLF V +      + Y  +       P  ++I R   +V GL  D++VRF
Sbjct: 1   MENKAHAFWAGLFTVVLTAAIALAAYLFNVDRTVRVPY-DLIART--NVTGLFVDAAVRF 57

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G+ VGR+  +  D E+P   L +  +    P+  ST  ++  QG+ GI +I+L    ++
Sbjct: 58  RGLDVGRVQSIKFDPEHPGQILIRINVDEHAPITHSTFGSLGLQGVTGIAFIQLDDTGRD 117

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTT-T 179
              +  + +   + A +   P  ++      +   +K       ++K+ +N+   L+   
Sbjct: 118 ---LTPLPSSVQKVARLPMRPGLLDQLQQRGDVLLRK-------LEKVTDNVNDMLSPEM 167

Query: 180 IANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMI 231
           +  +   +  LA   S +  +  T+Q+ P +     T + +   + S ++MI
Sbjct: 168 VEQLHETAASLAQAASGVATL--TSQLGPVAGKLPGTVDQLNRTLASTNQMI 217


>gi|109948192|ref|YP_665420.1| ABC transport system substrate-binding protein [Helicobacter
           acinonychis str. Sheeba]
 gi|109715413|emb|CAK00421.1| ABC transport system substrate-binding protein [Helicobacter
           acinonychis str. Sheeba]
          Length = 271

 Score = 55.1 bits (131), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 52/233 (22%), Positives = 99/233 (42%), Gaps = 23/233 (9%)

Query: 5   NYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRFNGIP 64
           NY    GLF + ++F   F I WL      DG     ++     + G++T+S + + GI 
Sbjct: 6   NYTLIGGLFFLCLIFMVGF-ILWLGHVGLDDGKYHRYVVYTDKDLGGIATNSPISYKGIQ 64

Query: 65  VGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKEKKTI 124
           VG +V +   ++         +I+    +   +   + +QGL G+ Y+ L     E+   
Sbjct: 65  VGNVVKVGFAKDKVGVVRLDLMIKNSVKIRKDSKVVVSSQGLMGLKYLSLEQSHNEE--- 121

Query: 125 FQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTIANIE 184
           F  + ++ +R +I         FI      + ++    +   K+I N+ + L     NIE
Sbjct: 122 FYSSDDKEERVLIFKEG-----FIGRLSVDANQM---VKEAMKVINNVNRVLDNE--NIE 171

Query: 185 TISTVLANNISHIDKMMHTTQVTPHSSDS--KNTFNTIT---DLITSLDKMIK 232
            +  +L    S +D ++          DS  KN  N ++   D+  ++DK +K
Sbjct: 172 RVKHIL----SSVDDLIANLDARKVQFDSLIKNANNLVSSANDVALNVDKRLK 220


>gi|289165422|ref|YP_003455560.1| Mammalian cell entry related domain protein [Legionella longbeachae
           NSW150]
 gi|288858595|emb|CBJ12476.1| Mammalian cell entry related domain protein [Legionella longbeachae
           NSW150]
          Length = 300

 Score = 55.1 bits (131), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 60/215 (27%), Positives = 104/215 (48%), Gaps = 10/215 (4%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRS-NQYDGPMAEVIIRIPGSVDGLSTDSSVR 59
           ME+K  YT VG+ V+ +L     ++ WLS   NQ         + +  +  GL+ D+ V+
Sbjct: 1   MEAKTNYTIVGVVVLILLVGLITTMLWLSIGFNQKK--YTTYTVYMHEAASGLTQDAPVK 58

Query: 60  FNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRK 119
           +NG+ VG +  + L+Q  P        I   TP+  ST AT+ +QG+ G++YI LS    
Sbjct: 59  YNGVQVGYVKEIRLNQNDPRQVEILLDIEEGTPVTTSTFATLNSQGITGVSYIGLSASTS 118

Query: 120 EKKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKII-ENIEKPLTT 178
               I ++  E     +I + PS  N   S  +  S+ +   +   Q+I  E   K +  
Sbjct: 119 NLTPITKMPGE--PYPVIPSKPSVFNQLDSILKKVSEDMGIVTTEAQRIFNEENAKHIKH 176

Query: 179 TIANIETISTVLANNISHIDKMMH----TTQVTPH 209
            ++NI++ S  +A+N  +++  M     T++  PH
Sbjct: 177 ILSNIDSFSKDIADNGKNVNVFMENLAKTSRDFPH 211


>gi|254488024|ref|ZP_05101229.1| mce related protein [Roseobacter sp. GAI101]
 gi|214044893|gb|EEB85531.1| mce related protein [Roseobacter sp. GAI101]
          Length = 571

 Score = 55.1 bits (131), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 41/117 (35%), Positives = 61/117 (52%), Gaps = 6/117 (5%)

Query: 1   MESKNYYTSVG-LFVVSILF-FSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSV 58
           ME++  +  +G  F++SI+    FF   WL+ S Q D   A   I     V GL     V
Sbjct: 1   METRANFILIGAFFLLSIIGTLGFF--IWLA-SVQIDRQYATYGILFD-DVSGLDPSGDV 56

Query: 59  RFNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELS 115
            FNGI VG+++GL +  + P+  L    I   TP+   T A +++QG+ G+ YI LS
Sbjct: 57  LFNGISVGKVIGLEIYPQNPSKVLTTIEIDTATPVTSGTIAQLQSQGVTGVAYISLS 113


>gi|84516866|ref|ZP_01004224.1| putative ABC transporter, periplasmic substrate-binding protein
           [Loktanella vestfoldensis SKA53]
 gi|84509334|gb|EAQ05793.1| putative ABC transporter, periplasmic substrate-binding protein
           [Loktanella vestfoldensis SKA53]
          Length = 564

 Score = 54.7 bits (130), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 32/115 (27%), Positives = 60/115 (52%), Gaps = 2/115 (1%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++  +  +G+F ++ +  +     WL+ S Q D       I +   V GL    +V +
Sbjct: 1   METRANFILIGIFTLAAMLGTLGFFIWLA-SVQLDRQYVTYGILLD-DVSGLDAAGAVTY 58

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELS 115
           NGI VG ++GL + ++ P+       +   TP+  +T A +++QG+ G+ +I LS
Sbjct: 59  NGIAVGSVIGLRIFEDDPSKVFTIIQVDAATPVSTATIAQLQSQGVTGVAFISLS 113


>gi|270159820|ref|ZP_06188476.1| conserved hypothetical protein [Legionella longbeachae D-4968]
 gi|269988159|gb|EEZ94414.1| conserved hypothetical protein [Legionella longbeachae D-4968]
          Length = 276

 Score = 54.7 bits (130), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 46/167 (27%), Positives = 82/167 (49%), Gaps = 7/167 (4%)

Query: 48  SVDGLSTDSSVRFNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLA 107
           +  GL+ D+ V++NG+ VG +  + L+Q  P        I   TP+  ST AT+ +QG+ 
Sbjct: 23  AASGLTQDAPVKYNGVQVGYVKEIRLNQNDPRQVEILLDIEEGTPVTTSTFATLNSQGIT 82

Query: 108 GITYIELSTLRKEKKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQK 167
           G++YI LS        I ++  E     +I + PS  N   S  +  S+ +   +   Q+
Sbjct: 83  GVSYIGLSASTSNLTPITKMPGE--PYPVIPSKPSVFNQLDSILKKVSEDMGIVTTEAQR 140

Query: 168 II-ENIEKPLTTTIANIETISTVLANNISHIDKMMH----TTQVTPH 209
           I  E   K +   ++NI++ S  +A+N  +++  M     T++  PH
Sbjct: 141 IFNEENAKHIKHILSNIDSFSKDIADNGKNVNVFMENLAKTSRDFPH 187


>gi|283953734|ref|ZP_06371265.1| ABC transporter, periplasmic substrate-binding protein, putative
           [Campylobacter jejuni subsp. jejuni 414]
 gi|283794775|gb|EFC33513.1| ABC transporter, periplasmic substrate-binding protein, putative
           [Campylobacter jejuni subsp. jejuni 414]
          Length = 296

 Score = 54.7 bits (130), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 67/282 (23%), Positives = 122/282 (43%), Gaps = 45/282 (15%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++  Y  VGLFV  + F S   I WL   ++ +       I    SV GL   + VR 
Sbjct: 1   MENRANYFFVGLFVFGVFFASLGFILWLGGYSKKE-SFKYYEIHTQESVAGLGIKAPVRL 59

Query: 61  NGIPVGRI--VGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLR 118
            G+ VG +  + ++   E   +   K  ++ +TP+   T AT++ QG+ G+ +++L    
Sbjct: 60  LGVEVGSVEEISIYNQDELGVNIRIK--VKNNTPIKEDTFATLQLQGITGLKFVQLQGGS 117

Query: 119 KEKKTIFQ-------IATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIEN 171
           K  K +         I  + +  A I      I   +  A++ SK++       +K ++N
Sbjct: 118 KNSKDLVSTHGKLPVIPFKESFLATIDKQSEHIFSLVKTADDKSKELLS-----EKNLKN 172

Query: 172 IEKPLTTTIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMI 231
           +E               +   N++ +   ++        ++SKN    ++     + KM 
Sbjct: 173 LE---------------IFLQNLAELSANLN--------ANSKNLSLNLSSASLKIGKMA 209

Query: 232 KAIDL--QKVNQILENIQVSS---NNFVKSSDQVINTVHDVR 268
             I L  Q  N  L++I+ S+    NF+K +D  +NT  D+R
Sbjct: 210 DNISLGAQNFNSSLKDIKESATTLKNFIKKADAKLNTYDDIR 251


>gi|323524593|ref|YP_004226746.1| mammalian cell entry related domain-containing protein
           [Burkholderia sp. CCGE1001]
 gi|323381595|gb|ADX53686.1| Mammalian cell entry related domain protein [Burkholderia sp.
           CCGE1001]
          Length = 320

 Score = 54.7 bits (130), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 50/236 (21%), Positives = 112/236 (47%), Gaps = 18/236 (7%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K++    GLF V +L     + +  +       P  ++I R   +V GL TD++VR+
Sbjct: 1   MENKSHAFWAGLFTVVLLGAIATAAFLFNVDRAVRVPY-DLIART--NVTGLFTDAAVRY 57

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G+ VG++  +  D+++P   + + L+    P+  ST  ++  QG+ GI +I+L    ++
Sbjct: 58  RGLDVGKVQSIKFDRDHPGQIVIRILVDTHAPITHSTFGSLGFQGVTGIAFIQLDDTGRD 117

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKII--ENIEKPLTT 178
                 +A+   Q A +   P  ++      +   +K+   +  +  ++  E +++ L  
Sbjct: 118 PSP---LASSPKQVAQLPMRPGLLDQLQQRGDVLLRKLEKVTDDVDNLLSPEMVDQ-LHG 173

Query: 179 TIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAI 234
           T A+I+      A+ ++ +     T Q+ P +     T + +   + S +++I ++
Sbjct: 174 TAASIQKA----ADGVATL-----TQQMAPAAGKLPATIDKLDATLASTNQLITSL 220


>gi|46203119|ref|ZP_00052045.2| COG1463: ABC-type transport system involved in resistance to
           organic solvents, periplasmic component
           [Magnetospirillum magnetotacticum MS-1]
          Length = 144

 Score = 54.3 bits (129), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 32/102 (31%), Positives = 50/102 (49%), Gaps = 1/102 (0%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++  Y  +G F +  +  +F  ++WL   ++     A  I+   GSV GL+  S+V F
Sbjct: 1   METRANYALIGAFTIGAVIAAFGFVFWLQGGSRGQATQALRIV-FSGSVGGLAKGSTVSF 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIR 102
           NGI VG  + + L  + P   +A   + P TPL   T    R
Sbjct: 60  NGIKVGEALDVRLLPQDPRRVVAVVQVDPSTPLRADTPRPAR 101


>gi|197120796|ref|YP_002132747.1| hypothetical protein AnaeK_0376 [Anaeromyxobacter sp. K]
 gi|196170645|gb|ACG71618.1| Mammalian cell entry related domain protein [Anaeromyxobacter sp.
           K]
          Length = 295

 Score = 54.3 bits (129), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 36/115 (31%), Positives = 50/115 (43%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M ++     VG FVV +   +     WL+    +       I R   SV GL   + V F
Sbjct: 1   MRAQPNLAVVGAFVVGLGAAAIVVGLWLAAGGFHLKRQERYIARFEESVSGLGRGAPVSF 60

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELS 115
            G+PVG +  L L+   P        + P TP+   T A +  QGL GI  +ELS
Sbjct: 61  RGVPVGSVRDLSLEPGDPARVRLVLEVAPGTPVTRDTVAVLAFQGLTGIASVELS 115


>gi|291277562|ref|YP_003517334.1| putative ABC transporter periplasmic substrate-binding protein
           [Helicobacter mustelae 12198]
 gi|290964756|emb|CBG40612.1| putative possible ABC transport system periplasmic
           substrate-binding protein [Helicobacter mustelae 12198]
          Length = 263

 Score = 54.3 bits (129), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 59/235 (25%), Positives = 102/235 (43%), Gaps = 21/235 (8%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME    +T +G+   SIL      I  +   N         ++     + G+  ++ VRF
Sbjct: 1   MERNVNFTIIGVIFFSILSALVIFIMIMGNFNLQKDEYTNYVVYTTKEITGIGVNTPVRF 60

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            GI +G +  +  D++ P+       I+   P+   +T    +QGLAGIT++   TL++ 
Sbjct: 61  KGINIGSVTYVGFDKQNPDVVKIMVQIKKHIPIKEGSTLMADSQGLAGITFL---TLKQS 117

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
              IF I  E    A++   PS  +   + A   S  I D  +  + ++   EK      
Sbjct: 118 NSKIF-ITGENG--ALLNFEPSLFHRLSTKANQASTDIIDILKDAKNVLN--EK------ 166

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAID 235
            NIE++S +L  NI  +   ++ TQ      D     N    L+ +L+K I++ D
Sbjct: 167 -NIESVSHILT-NIKILSANLNQTQ-----KDIDRLTNNFDTLVNNLNKQIQSGD 214


>gi|154148511|ref|YP_001406163.1| putative ABC transport system periplasmic substrate-binding protein
           [Campylobacter hominis ATCC BAA-381]
 gi|153804520|gb|ABS51527.1| putative ABC transport system periplasmic substrate-binding protein
           [Campylobacter hominis ATCC BAA-381]
          Length = 288

 Score = 53.9 bits (128), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 64/273 (23%), Positives = 124/273 (45%), Gaps = 35/273 (12%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++N YT VGLFV+ I  F    ++W+    + +       I       G+   + V+F
Sbjct: 1   MENRNSYTIVGLFVMLIGAFLGIFMWWMLTRTEANETYRSYFIHTKELPVGIKEGADVKF 60

Query: 61  NGIPVGRIVGL-FLDQEYPNHSLAKAL-IRPDTPLYPSTTATIRTQGLAGITYIELSTLR 118
            G+  G +  + F+D +  N  +   L I+   P+   + A + +QG++GI++I ++   
Sbjct: 61  IGVNAGIVKKIDFIDMK--NAIIEIELSIKDKLPISKDSIAKVESQGISGISFINITQGS 118

Query: 119 KEKKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTT 178
            E      I  E  ++ +I+   + ++     AE  S ++S++   I  ++ N       
Sbjct: 119 GE------IFNENEKKPIISLDKALLDKIGKKAEVISDQVSETIYKINMLLSN------- 165

Query: 179 TIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAID--L 236
              NI+ I+ +L  N     K ++  ++T      KN +  I + I    K  K +D   
Sbjct: 166 --QNIDKINKILT-NFETFSKKLNDEKLT------KNIYTAIDEFI----KFQKTMDNSA 212

Query: 237 QKVNQILENIQVSSNNFVKSSDQVINTVHDVRE 269
           +K N  ++N+  + N   K S ++ N   ++RE
Sbjct: 213 KKFNNFIDNLNKTQN---KISARIDNGDFNIRE 242


>gi|149200414|ref|ZP_01877430.1| possible ABC transport system periplasmic substrate-binding protein
           [Lentisphaera araneosa HTCC2155]
 gi|149136483|gb|EDM24920.1| possible ABC transport system periplasmic substrate-binding protein
           [Lentisphaera araneosa HTCC2155]
          Length = 361

 Score = 53.9 bits (128), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 81/371 (21%), Positives = 164/371 (44%), Gaps = 64/371 (17%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K++   +G+FV++ L     ++++L    Q+     + +     SV GL   SSV+ 
Sbjct: 1   MENKHF--KLGIFVLTGLVLFVLALFYLGLREQFRKSY-DFVTYFDRSVQGLEVGSSVKL 57

Query: 61  NGIPVGRIVGLFL------------------DQEYPNHSLAKALIRPDTPLYPSTTATIR 102
            G+ VGR+  + L                  D E    S A+A +R +  +  +    +R
Sbjct: 58  KGVTVGRVSSVELWEQEYVKVTMSAVPRNVSDSEMKEMSEAQAQLRFEGYIVEAVDKGLR 117

Query: 103 T----QGLAGITYIELSTLRKEKKTIFQIATERNQRAMITATPSGINYFISNAENTSKKI 158
                 G+ G+ YIEL  +  ++    ++     +   I A  S +   + + E    KI
Sbjct: 118 VSLNYAGITGMKYIELDYVDMKRDNSVELPFTVTE-TYIPALRSSLEDIVLDVE----KI 172

Query: 159 SDSSRHI--QKIIENIEKPLTT---TIANIE--------TISTVLANNISHIDKMMHTTQ 205
            D    I  Q+I EN EK +++   T+A+++        T+S  L++++  IDK     +
Sbjct: 173 MDGVARIDFQQIGENAEKAMSSAEKTMASLDKFATSELLTLSKDLSSSLKRIDKFTEVLE 232

Query: 206 VTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVNQILENIQVSSN----NFVKSSDQVI 261
               ++   +T  ++   +  LD     ++  ++N+ L ++  +S+    +F K SD V 
Sbjct: 233 KEIIAAKVGDTTTSVRKTLAKLD-----VNSAELNKALASVTKTSDMIGKDFSKISDGVT 287

Query: 262 NTVHDVRETTQTFQEVGQKIDHLLSDFSSKMK-----SKETSAFLENIADSTSNMRSSIS 316
             +  V +  +    +  +++ +L+      K     +K+TSA L++  D T      + 
Sbjct: 288 VALATVEKNLKALASLTPQLEKMLAGEGKIGKAVVGLAKDTSASLDSF-DRT------LD 340

Query: 317 AIREITDQRQK 327
           +IR +TD  ++
Sbjct: 341 SIRRLTDYLER 351


>gi|34557287|ref|NP_907102.1| hypothetical protein WS0897 [Wolinella succinogenes DSM 1740]
 gi|34483003|emb|CAE10002.1| hypothetical protein WS0897 [Wolinella succinogenes]
          Length = 463

 Score = 53.9 bits (128), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 72/318 (22%), Positives = 133/318 (41%), Gaps = 58/318 (18%)

Query: 10  VGLFVVSILFFSFFSIYWLSR--SNQYDGPMAEVIIRIPGSVDGLSTDSSVRFNGIPVGR 67
           VG+FV S +   F     ++R    Q  G   E ++   G+  GL   + V+ NG+  G 
Sbjct: 8   VGIFVFSAIVMLFLMSTQINRFSVGQKSGYPIEALL---GNASGLEMYAKVKVNGVESGH 64

Query: 68  IVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIEL---STLRKEKKTI 124
           +  ++L   Y N + A   ++    +   +   +  + + G  YIEL   ++L    + +
Sbjct: 65  VSRVYL---YENQAYATLFLQEGVKIPVDSKVLLTQESMLGSKYIELIPGASL----EVV 117

Query: 125 FQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKII--------ENIEKPL 176
            +    +NQ+ M            S+ + TS  I++++   ++ I        E   + L
Sbjct: 118 ERNGVLKNQKIM------------SSFDQTSDSINEAAVEFKEFIKEAREVLNEESRQDL 165

Query: 177 TTTIANI----ETISTVLANNISHIDKMMHTTQVTPHSSDSKN--------TFNTITDLI 224
           T T AN+    ETI  +LA N S + K +   ++   S +            F T  D I
Sbjct: 166 TQTFANLRRVTETIEAMLAENRSELKKAIEGVRLMASSLEGAGREFGTTSSKFGTTADTI 225

Query: 225 TS--------LDKMIKAID--LQKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTF 274
            +        +D ++   D  +Q+  Q L +   S + F  + ++V+N + D        
Sbjct: 226 NAKLPHIVDRVDSVVTGADEVIQENKQPLNDALKSVDQFFSNGNRVVNKLDDYLSIVDRS 285

Query: 275 Q-EVGQKIDHLLSDFSSK 291
           + EVG +++HL  D  SK
Sbjct: 286 EIEVGMRVEHLARDSYSK 303


>gi|313109006|ref|ZP_07794980.1| hypothetical protein PA39016_001650019 [Pseudomonas aeruginosa
           39016]
 gi|310881482|gb|EFQ40076.1| hypothetical protein PA39016_001650019 [Pseudomonas aeruginosa
           39016]
          Length = 309

 Score = 53.9 bits (128), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 37/117 (31%), Positives = 58/117 (49%), Gaps = 5/117 (4%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLS--RSNQYDGPMAEVIIRIPGSVDGLSTDSSV 58
           ME + ++  +GLFVV +         WLS  RS+ +D     ++   P  V GL+  S V
Sbjct: 1   MEPRAHHVFIGLFVVLLGAIGIGFALWLSDTRSD-HDYQYYRIMFDEP--VTGLTPGSQV 57

Query: 59  RFNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELS 115
           +++GI +G +V L L    P  ++A+  I    P+   T A +   G+ G   IELS
Sbjct: 58  QYSGITIGEVVALSLSPRDPRRAIARVRINATIPVRQDTRAELVITGITGNAVIELS 114



 Score = 39.3 bits (90), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 40/157 (25%), Positives = 71/157 (45%), Gaps = 19/157 (12%)

Query: 289 SSKMKSKETSAFLENIADSTSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQK 348
           + ++ SKE  A +     S  N+  +  A+    DQR +I + I       SNL ++S++
Sbjct: 161 TQELLSKENLALVHR---SLVNLEQTTGAV---ADQRAEIATLI-------SNLTEASRE 207

Query: 349 FAELMSKINNISALKENNSLFK-DAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQS---G 404
               + + N  S L++ N L   D ++ M   RD +  + R    +   LQN  +S   G
Sbjct: 208 STAAVRQAN--STLRDANLLLNNDGKQIMVNTRDATASLERAAFRVETLLQNNQESLNQG 265

Query: 405 LNDIQNLVRKLQETVNHFDDCLNNFERNPQDIVWGRE 441
           L      + +LQ+ + + +  L   +RNP   + G E
Sbjct: 266 LAATGPAMHELQQALANLNTVLRRLDRNPAQYLLGGE 302


>gi|327399069|ref|YP_004339938.1| Mammalian cell entry related domain-containing protein [Hippea
           maritima DSM 10411]
 gi|327181698|gb|AEA33879.1| Mammalian cell entry related domain protein [Hippea maritima DSM
           10411]
          Length = 291

 Score = 53.9 bits (128), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 39/145 (26%), Positives = 64/145 (44%), Gaps = 3/145 (2%)

Query: 27  WLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRFNGIPVGRIVGLFLDQEYPNHSLAKAL 86
           WL   + Y       I+    ++ GL  DS V++ G+ VG++  + +DQ +P+      L
Sbjct: 27  WLIGGSNYTN-YKRYIVYTNSNISGLHVDSDVKYKGLSVGKVEDILIDQRHPDFFKIIIL 85

Query: 87  IRPDTPLYPSTTATIRTQGLAGITYIELSTLRKEKKTIFQIATERNQRAMITATPSGINY 146
           I  + PL  +  A I + GL GI+YI L       K    +  E     +I + PS I  
Sbjct: 86  IERNLPLKANMAARISSNGLTGISYINLIYTNNPPKLPGYLKNE--PYPVIGSIPSNIEE 143

Query: 147 FISNAENTSKKISDSSRHIQKIIEN 171
             S    T+  +   S  I  +++N
Sbjct: 144 ISSVIMETADSLKSISNKINVLLDN 168


>gi|328954407|ref|YP_004371741.1| Mammalian cell entry related domain protein [Desulfobacca
           acetoxidans DSM 11109]
 gi|328454731|gb|AEB10560.1| Mammalian cell entry related domain protein [Desulfobacca
           acetoxidans DSM 11109]
          Length = 302

 Score = 53.5 bits (127), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 67/290 (23%), Positives = 123/290 (42%), Gaps = 45/290 (15%)

Query: 10  VGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRFNGIPVGRIV 69
           VGLFV+  +  + F+I W+  +  +    A  +  +  SV GL  DS V+F G+ VGR+ 
Sbjct: 10  VGLFVIIGVALTVFAIIWVGVTGYFQQ-GATYVTYVDESVQGLQKDSVVKFRGVDVGRVE 68

Query: 70  GLFLDQEYPNHSLAKALIRPDTP--LYPSTTATIRTQGLAGITYIELSTLRKEKKTIFQI 127
            + +    P++ L   +++ + P  L  +  A + + G+ GI +I+L   R     +   
Sbjct: 69  HIRI---APDNKLVAIIMKINLPGDLTENIVAQLTSSGITGIMFIDLDYRRPGAPDLSPK 125

Query: 128 ATERNQRAMITATP-------SGINYFIS-----NAENTSKKISDSSRHI---------Q 166
               ++  +I + P       SGIN  IS     + E  S ++ D+ R I         Q
Sbjct: 126 IDFPSEYPIIPSKPSEYTRIISGINDVISRLNQIDIEGISTQLKDAIREITLLLKGDKVQ 185

Query: 167 KIIENIEKPLTTTIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITS 226
            I+   EK    T AN+E + T  AN ++   K+    + T             T  I+ 
Sbjct: 186 SILAKTEK----TAANLEAL-TGKANTLAGEVKLTEVIRET-------------TATISE 227

Query: 227 LDKMIKAIDLQKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQE 276
             K +  ++ Q  +  L      + N ++ +  +   +H   E+ + F +
Sbjct: 228 ARKFVVDLNRQLYDLKLPETMGKTRNLLREAQAIGENLHRTTESLEMFAD 277


>gi|83593774|ref|YP_427526.1| hypothetical protein Rru_A2439 [Rhodospirillum rubrum ATCC 11170]
 gi|83576688|gb|ABC23239.1| Mammalian cell entry related [Rhodospirillum rubrum ATCC 11170]
          Length = 271

 Score = 53.5 bits (127), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 36/77 (46%), Positives = 41/77 (53%), Gaps = 6/77 (7%)

Query: 50  DGLSTDSSVRFNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTP--LYPSTTATIRTQGLA 107
           DG+   S VR  GIP+GRIVG  LD EY     A   +R D P  L   T A I+T GL 
Sbjct: 50  DGIGIGSPVRLAGIPIGRIVGHKLDPEY----RAIVTMRLDLPNELPDDTAAKIQTDGLL 105

Query: 108 GITYIELSTLRKEKKTI 124
           G  YIEL +L     TI
Sbjct: 106 GSKYIELVSLGGGYGTI 122


>gi|241668210|ref|ZP_04755788.1| cell entry related family protein [Francisella philomiragia subsp.
           philomiragia ATCC 25015]
 gi|254876745|ref|ZP_05249455.1| conserved hypothetical protein [Francisella philomiragia subsp.
           philomiragia ATCC 25015]
 gi|254842766|gb|EET21180.1| conserved hypothetical protein [Francisella philomiragia subsp.
           philomiragia ATCC 25015]
          Length = 243

 Score = 53.5 bits (127), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 41/167 (24%), Positives = 78/167 (46%), Gaps = 5/167 (2%)

Query: 11  GLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRFNGIPVGRIVG 70
           GLFV+ ++F   F  ++LS    +        +    S+ GL+  S V + G  +G++  
Sbjct: 12  GLFVIFMVFVMVFIGFFLSGG--FKNQDTTTFVTNFKSISGLNVGSDVSYKGFNIGKVSD 69

Query: 71  LFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKEKKTIFQIATE 130
           + +++E P        I    P+Y  T AT+++ G+ G + +ELS    EK T   +   
Sbjct: 70  ISINKENPKLVSVYMKINSQIPIYKQTVATLQSVGITGQSKVELSLDISEKNTSLDLIDL 129

Query: 131 RNQR-AMITATPSGINYFISNAENTSKKISDSSRHIQKII--ENIEK 174
           R  + A I + PS +   ++     +  + + S    K++  ENI++
Sbjct: 130 RKGKIAEIRSKPSQLETILNKVNGIAGSLEEISGKFNKMMSQENIQR 176


>gi|126666399|ref|ZP_01737378.1| hypothetical protein MELB17_12461 [Marinobacter sp. ELB17]
 gi|126629200|gb|EAZ99818.1| hypothetical protein MELB17_12461 [Marinobacter sp. ELB17]
          Length = 312

 Score = 53.5 bits (127), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 50/195 (25%), Positives = 88/195 (45%), Gaps = 19/195 (9%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSR-SNQYDGPMAEVIIRIPGSVDGLSTDSSVR 59
           ME + ++  +G+F +S    +     WL + SN+ +    EV      +V GLS  + V 
Sbjct: 1   MEPRAHHFLIGMFTISTAAAALVFALWLGKTSNEREWAWYEVAFDY--TVGGLSEGNPVL 58

Query: 60  FNGIPVGRIVGLFLDQEYPNHSLAKALIRPD--TPLYPSTTATIRTQGLAGITYIELSTL 117
           +NG+ VG +V L L +E P     + L+R D   P++  T A++    + G   IE S  
Sbjct: 59  YNGVDVGDVVSLRLVRENPGE--VRVLVRVDETIPMHEDTRASLVLANITGSMSIEFSG- 115

Query: 118 RKEKKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLT 177
              + +   I +  N   +I A  S ++  + N++    K     R+  ++  N      
Sbjct: 116 -GSQNSPLLIGSRENP-PIIDAQRSALSGLLDNSQILMNKADQLLRNANQLFSN------ 167

Query: 178 TTIANIETISTVLAN 192
               NIE +S +L+N
Sbjct: 168 ---DNIEQVSAILSN 179


>gi|311694461|gb|ADP97334.1| mammalian cell entry related domain protein [marine bacterium HP15]
          Length = 312

 Score = 53.5 bits (127), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 51/210 (24%), Positives = 94/210 (44%), Gaps = 31/210 (14%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIY--WLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSV 58
           ME + ++  +GLF  +IL F+   I+  WL++S+  D       I    +V GLS  + V
Sbjct: 1   MEPRAHHLIIGLF--TILAFAAALIFSLWLAKSS-ADREWGYYEIVFDHAVGGLSEGNPV 57

Query: 59  RFNGIPVGRIVGLFLDQEYPNHSLAKALIRPD--TPLYPSTTATIRTQGLAGITYIELST 116
            ++G+ +G +V + LD + P H   + L+R D   P+  +T A +    + G   ++ S 
Sbjct: 58  LYSGVQIGDVVEMKLDPDNPGH--VRVLVRVDQSVPIRENTKAGLVLANITGSMSVQFSG 115

Query: 117 LRKEKKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPL 176
              +K     +  + +   +I A PS     +SN E              +++   ++ L
Sbjct: 116 GSPDKPA---LQGDEDNPPVIIAEPSAFTSLLSNGE--------------QLLAKADQLL 158

Query: 177 TTTIA-----NIETISTVLANNISHIDKMM 201
           T+  A     NI+  S +L N     D ++
Sbjct: 159 TSATALLSADNIDNASAILENTREATDALL 188


>gi|218886598|ref|YP_002435919.1| hypothetical protein DvMF_1503 [Desulfovibrio vulgaris str.
           'Miyazaki F']
 gi|218757552|gb|ACL08451.1| Mammalian cell entry related domain protein [Desulfovibrio vulgaris
           str. 'Miyazaki F']
          Length = 307

 Score = 53.5 bits (127), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 47/213 (22%), Positives = 93/213 (43%), Gaps = 14/213 (6%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLS-RSNQYDGPMAEVIIRIPGSVDGLSTDSSVR 59
           ME +  Y  VG+F +  +  +   I W + R +  D  + +  I   G V GLS  + V 
Sbjct: 1   MEIRASYVLVGVFTLMAVVGALAFILWTAGRGSGVD--LVQYDINFTGHVSGLSVANDVL 58

Query: 60  FNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRK 119
           FNG+ VG +  + +    P     +  +  +TP+   + A++  +G+ G+T +++S    
Sbjct: 59  FNGVKVGSVKAITISPTDPGRVKVRVEMAANTPVREDSMASLEARGITGVTVVQISGGTA 118

Query: 120 EKKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKII-----ENIEK 174
               +     E      +   P+ ++   +        +SDS   IQ+I      EN  +
Sbjct: 119 TSPLLKPHPGEE-----VAVIPAQLSRLEALFAGLPAVVSDSRDLIQRIAGMADDEN-RR 172

Query: 175 PLTTTIANIETISTVLANNISHIDKMMHTTQVT 207
            L  T+ +++ ++  LA     +D+++    VT
Sbjct: 173 ALAQTLQSLDVLTARLAARADAMDRIIGNLDVT 205


>gi|319761113|ref|YP_004125050.1| mammalian cell entry related domain protein [Alicycliphilus
           denitrificans BC]
 gi|330822971|ref|YP_004386274.1| Mammalian cell entry related domain-containing protein
           [Alicycliphilus denitrificans K601]
 gi|317115674|gb|ADU98162.1| Mammalian cell entry related domain protein [Alicycliphilus
           denitrificans BC]
 gi|329308343|gb|AEB82758.1| Mammalian cell entry related domain protein [Alicycliphilus
           denitrificans K601]
          Length = 325

 Score = 53.1 bits (126), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 32/114 (28%), Positives = 61/114 (53%), Gaps = 3/114 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K++  + G+FV+ +         WL+R +Q    + E+  +   SV GL   + VR+
Sbjct: 1   MENKSHALAAGIFVIVVAALLAGLGMWLTR-DQTAYQIYELSSK--DSVSGLQPQAPVRY 57

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIEL 114
            G+ VG++  +  D E P + L +  +    P+  +T AT+  QG+ G+ +++L
Sbjct: 58  KGVAVGKVTRIGFDPEAPGNVLIRIAVNTTAPISTTTFATLGYQGVTGLAHVQL 111


>gi|170691588|ref|ZP_02882753.1| Mammalian cell entry related domain protein [Burkholderia graminis
           C4D1M]
 gi|170143793|gb|EDT11956.1| Mammalian cell entry related domain protein [Burkholderia graminis
           C4D1M]
          Length = 320

 Score = 53.1 bits (126), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 49/235 (20%), Positives = 109/235 (46%), Gaps = 16/235 (6%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K++    GLF + +L     + +  +       P  ++I R   +V GL TD++VR+
Sbjct: 1   MENKSHAFWAGLFTIVLLGAIATAAFLFNVDRAVRVPY-DLIART--NVTGLFTDAAVRY 57

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G+ VG++  +  D+ +P   + + L+    P+  ST  ++  QG+ GI +I+L    ++
Sbjct: 58  RGLDVGKVQSIKFDRAHPGQIVIRILVDTHAPITHSTFGSLGFQGVTGIAFIQLDDTGRD 117

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKII-ENIEKPLTTT 179
                 +A+   Q A +   P  ++      +   KK+   +  +  ++ + +   L  T
Sbjct: 118 PSP---LASSPKQVAQLPMRPGLLDQLQQRGDVLLKKLEKVTDDVDNLLSQEMVDQLHGT 174

Query: 180 IANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAI 234
            A+I+      A+ ++ +     T Q+ P +     T + +   + S +++I ++
Sbjct: 175 AASIQKA----ADGVATL-----TQQMAPAAGKLPATIDKLDRTLVSTNQLITSL 220


>gi|222823163|ref|YP_002574736.1| ABC transporter, periplasmic substrate-binding protein
           [Campylobacter lari RM2100]
 gi|222538384|gb|ACM63485.1| putative ABC transporter, periplasmic substrate-binding protein
           [Campylobacter lari RM2100]
          Length = 275

 Score = 53.1 bits (126), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 35/117 (29%), Positives = 58/117 (49%), Gaps = 4/117 (3%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++  Y  +G+FV  + F S F I W       +       I +  SV GLS  + V+F
Sbjct: 1   MENRANYILIGIFVSILFFISLFFIVWYGNLKD-EKTFKYYEIFMEESVAGLSVKAPVKF 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLY--PSTTATIRTQGLAGITYIELS 115
            G+ VG +  + +D    N    K L++ D+ L     T A+++ QG+ G  +I+L+
Sbjct: 60  LGVDVGSVENISIDSS-SNQLRVKILVKLDSNLVVKTDTYASLQIQGITGFKFIQLA 115


>gi|254374663|ref|ZP_04990144.1| conserved hypothetical protein [Francisella novicida GA99-3548]
 gi|151572382|gb|EDN38036.1| conserved hypothetical protein [Francisella novicida GA99-3548]
          Length = 241

 Score = 53.1 bits (126), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 40/167 (23%), Positives = 78/167 (46%), Gaps = 5/167 (2%)

Query: 11  GLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRFNGIPVGRIVG 70
           GLFV+ ++F   F  ++LS    +        +    S+ GL+  S V + G  +G++  
Sbjct: 12  GLFVIFMVFVMIFIGFFLSGG--FKDQHTTTFVTNFKSISGLNVGSDVSYKGFSIGKVSD 69

Query: 71  LFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKEKKTIFQ-IAT 129
           + +++  P        I    P+Y  T AT+++ G+ G + +ELS    EK T    I  
Sbjct: 70  ISINKNNPKLVSVYMKINSQIPIYKQTVATLQSMGITGQSKVELSLDIDEKNTSLDLIHI 129

Query: 130 ERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKII--ENIEK 174
           ++ Q   IT+ PS +   ++     +  + + S    K++  EN+++
Sbjct: 130 KKGQIPEITSKPSQLESIMNKVSAIASSLEEISGKFNKMMSPENLDR 176


>gi|78777723|ref|YP_394038.1| hypothetical protein Suden_1526 [Sulfurimonas denitrificans DSM
           1251]
 gi|78498263|gb|ABB44803.1| Mammalian cell entry related [Sulfurimonas denitrificans DSM 1251]
          Length = 300

 Score = 52.8 bits (125), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 31/90 (34%), Positives = 48/90 (53%), Gaps = 1/90 (1%)

Query: 26  YWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRFNGIPVGRIVGLFLDQEYPNHSLAKA 85
           YWL + +Q D  M    I    SV GL+ D+ V+F GI VG++  L ++       +   
Sbjct: 6   YWLLKPSQ-DIEMKTYAIYFEESVLGLNLDAPVKFRGISVGKVTSLSINPNNSEEVVVLV 64

Query: 86  LIRPDTPLYPSTTATIRTQGLAGITYIELS 115
            +   TP+  ST A + +QG+ G++YI LS
Sbjct: 65  SVLKSTPIKSSTMAQLTSQGITGLSYINLS 94


>gi|120609011|ref|YP_968689.1| hypothetical protein Aave_0308 [Acidovorax citrulli AAC00-1]
 gi|120587475|gb|ABM30915.1| Mammalian cell entry related domain protein [Acidovorax citrulli
           AAC00-1]
          Length = 326

 Score = 52.8 bits (125), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 33/115 (28%), Positives = 60/115 (52%), Gaps = 5/115 (4%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQ-YDGPMAEVIIRIPGSVDGLSTDSSVR 59
           ME+K++  + G+FVV +         WL+R    Y   + E+  R   SV GL   ++VR
Sbjct: 1   MENKSHALAAGIFVVVVAALLAALGLWLTRDRASYQ--LYELSTRE--SVGGLQPQAAVR 56

Query: 60  FNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIEL 114
           + G+ VG++  +  D + P + L +  +    P+ P+T A +  QG+ G+ ++ L
Sbjct: 57  YKGVAVGKVTRIGFDPDVPGNVLIRIAVNDQAPVTPATFAVLGYQGVTGLAHVLL 111


>gi|85707663|ref|ZP_01038729.1| ABC-type transport system periplasmic component [Erythrobacter sp.
           NAP1]
 gi|85689197|gb|EAQ29200.1| ABC-type transport system periplasmic component [Erythrobacter sp.
           NAP1]
          Length = 315

 Score = 52.4 bits (124), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 38/124 (30%), Positives = 63/124 (50%), Gaps = 3/124 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++  +  VG   +++L      I W++R NQ D  + E  I    SV GL+  S V +
Sbjct: 1   METRANHLWVGAVTLALLAAMAAFIVWIARLNQGD--VNEYDIFYAQSVSGLAQGSQVAY 58

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G+PVG++V + L ++ P     +  +R + P+   TTATI++    G++ I L   R  
Sbjct: 59  AGVPVGQVVDIALSEDDPEFVRVRIRVRDEVPILIGTTATIQSS-FTGVSTILLDGARGG 117

Query: 121 KKTI 124
              I
Sbjct: 118 APAI 121


>gi|89902674|ref|YP_525145.1| hypothetical protein Rfer_3915 [Rhodoferax ferrireducens T118]
 gi|89347411|gb|ABD71614.1| Mammalian cell entry related [Rhodoferax ferrireducens T118]
          Length = 321

 Score = 52.4 bits (124), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 35/118 (29%), Positives = 60/118 (50%), Gaps = 11/118 (9%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQ----YDGPMAEVIIRIPGSVDGLSTDS 56
           ME+K++  + G FV+ +L        WL+R  Q    Y+   A+       +V GL   +
Sbjct: 1   MENKSHALAAGAFVLVLLALLVALALWLTRDTQSQRIYELSSAQ-------AVTGLQPQA 53

Query: 57  SVRFNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIEL 114
           +VRF G+ VG++  +  D   P + L +  +    P+  ST AT+  QG+ G+ +I+L
Sbjct: 54  TVRFKGVNVGKVSAIGFDPLQPGNVLIRIAVDDKAPITQSTFATLGFQGVTGLAFIQL 111


>gi|307728303|ref|YP_003905527.1| Mammalian cell entry related domain-containing protein
           [Burkholderia sp. CCGE1003]
 gi|307582838|gb|ADN56236.1| Mammalian cell entry related domain protein [Burkholderia sp.
           CCGE1003]
          Length = 320

 Score = 52.0 bits (123), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 31/114 (27%), Positives = 62/114 (54%), Gaps = 3/114 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K++    GLF + +L     + +  +       P  ++I R   +V GL +D++VR+
Sbjct: 1   MENKSHAFWAGLFTIVLLAAIATAAFLFNVDRAVRVPY-DLIART--NVTGLFSDAAVRY 57

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIEL 114
            G+ VG++  +  D+++P   + + L+    P+  ST  ++  QG+ GI +I+L
Sbjct: 58  RGLDVGKVQSIKFDRDHPGQIVIRILVDTHAPITHSTYGSLGFQGVTGIAFIQL 111


>gi|162660706|gb|EDQ48497.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 313

 Score = 52.0 bits (123), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 50/259 (19%), Positives = 122/259 (47%), Gaps = 19/259 (7%)

Query: 9   SVGLFVVSILFFSFFSIYWLSR-SNQYDGPMAEVIIRIPGSVDGLSTDSSVRFNGIPVGR 67
           + G+FV+ +         WL+R + QY+    E  +     + GL   ++VR+ G+ VG+
Sbjct: 2   AAGIFVLVVAALLAGLAIWLTRDTRQYN----EYELSTKDGISGLQAQAAVRYKGVAVGK 57

Query: 68  IVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKEKKTIFQI 127
           +  +  D +   + L +  I  +TP+ P+T A +  QG+ G+ +++L    + +  +   
Sbjct: 58  VTQIGFDPQTNGNVLIRIAIGVNTPITPTTFAVLGYQGVTGLAHVQLDDADQPQPQLPPG 117

Query: 128 ATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIE-NIEKPLTTTIANIETI 186
            +    R  + ++P  ++      +   ++  + SR +  +++ + +K ++  + NI   
Sbjct: 118 PSGLP-RLPLRSSP--LSMLADQGQVLLERADEISRRLSDMLDTDNQKRVSQALENIAAA 174

Query: 187 STVLANNISHIDKMMHTTQVTPHSSDSKNTF-------NTITDLITSLDKMIKAIDLQKV 239
           +  +     ++D+ + +TQV   ++D+ NT        N  + + + L + ++ ++ Q  
Sbjct: 175 AAGVQQLTQNLDRTL-STQVPQLAADAHNTLQSLEKASNGASAVASELQQTVRRVNAQ-- 231

Query: 240 NQILENIQVSSNNFVKSSD 258
           +  LE I  S+    + +D
Sbjct: 232 DGPLEQIAQSTRALTRMAD 250


>gi|326315186|ref|YP_004232858.1| mammalian cell entry related domain-containing protein [Acidovorax
           avenae subsp. avenae ATCC 19860]
 gi|323372022|gb|ADX44291.1| Mammalian cell entry related domain protein [Acidovorax avenae
           subsp. avenae ATCC 19860]
          Length = 326

 Score = 52.0 bits (123), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 33/115 (28%), Positives = 60/115 (52%), Gaps = 5/115 (4%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQ-YDGPMAEVIIRIPGSVDGLSTDSSVR 59
           ME+K++  + G+FVV +         WL+R    Y   + E+  R   SV GL   ++VR
Sbjct: 1   MENKSHALAAGIFVVVVAALLAGLGLWLTRDRASYQ--LYELSTRE--SVGGLQPQAAVR 56

Query: 60  FNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIEL 114
           + G+ VG++  +  D + P + L +  +    P+ P+T A +  QG+ G+ ++ L
Sbjct: 57  YKGVAVGKVTRIGFDPDVPGNVLIRIAVNDQAPVTPATFAVLGYQGVTGLAHVLL 111


>gi|302342027|ref|YP_003806556.1| Mammalian cell entry related domain protein [Desulfarculus baarsii
           DSM 2075]
 gi|301638640|gb|ADK83962.1| Mammalian cell entry related domain protein [Desulfarculus baarsii
           DSM 2075]
          Length = 305

 Score = 52.0 bits (123), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 41/161 (25%), Positives = 73/161 (45%), Gaps = 6/161 (3%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M SK+    +GLFV+S +  +   + W+  +    G    V      SV GL  DS V++
Sbjct: 1   MSSKSSNVRLGLFVLSGITLAVVILVWMGAAKYMKGATTYVTF-FDESVQGLQIDSRVKY 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKAL--IRPDTPLYPSTTATIRTQGLAGITYIELSTLR 118
            G+ VGR+  +   +  P+  L + +  I  D  L     A ++T G+ GI ++EL   R
Sbjct: 60  RGVEVGRVTDV---RVAPDFRLIEVVMEIGFDGDLSHDMVAQLQTIGITGIMFVELDRQR 116

Query: 119 KEKKTIFQIATERNQRAMITATPSGINYFISNAENTSKKIS 159
              K    +     +  +I + PS ++  +   +  + +IS
Sbjct: 117 PGDKAESPVINFAAEHPIIPSKPSEMHRLLGVIDRITNQIS 157


>gi|305432466|ref|ZP_07401628.1| ABC superfamily ATP binding cassette transporter, periplasmic
           substrate-binding protein [Campylobacter coli JV20]
 gi|304444505|gb|EFM37156.1| ABC superfamily ATP binding cassette transporter, periplasmic
           substrate-binding protein [Campylobacter coli JV20]
          Length = 298

 Score = 51.6 bits (122), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 54/222 (24%), Positives = 104/222 (46%), Gaps = 15/222 (6%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K  Y  VGLFV  + F S   + WL   ++ +       I    SV GL   + VR 
Sbjct: 1   MENKANYFFVGLFVFGVFFASIGFMLWLGGYSKEE-SFEYYEIHTQESVAGLGIKAPVRL 59

Query: 61  NGIPVGRI--VGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELST-- 116
            G+ +G +  + ++  +    + L K  I+  TP+   T AT++ QG+ G+ +++L    
Sbjct: 60  LGVEIGNVENISIYDKENLGVNILIK--IKKGTPIKEDTFATLQFQGITGLKFVQLQGGS 117

Query: 117 -----LRKEKKTIFQ-IATERNQRAMITATPSGINYFISNAENTSKKI-SDSS-RHIQKI 168
                L+ + K  F  I  +    A I      I   I  A++ SK++ SD + ++++ +
Sbjct: 118 KNSPKLQVKGKEEFPVIQFKEGFFAAIDRQSEHIFSLIKRADDKSKELFSDKNIKNLEIL 177

Query: 169 IENIEKPLTTTIANIETISTVLANNISHIDKMMHTTQVTPHS 210
           ++N+ +  TT   + +T++  +AN    + +M     ++   
Sbjct: 178 LDNLAQLSTTLNKDSKTLNHNIANTSLKLGEMAENVSLSAKG 219


>gi|23011785|ref|ZP_00052044.1| COG1463: ABC-type transport system involved in resistance to
           organic solvents, periplasmic component
           [Magnetospirillum magnetotacticum MS-1]
          Length = 230

 Score = 51.6 bits (122), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 58/303 (19%), Positives = 108/303 (35%), Gaps = 88/303 (29%)

Query: 137 ITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTIANIETISTVLANNISH 196
           I A  S I   ++ A+  +++  D  + + K++   E  +  T+AN+E  S  LA     
Sbjct: 4   IFADSSDIQDMMAAAKQIAQRADDVLQRLDKVVAGNEGAINRTLANVEAFSKTLA----- 58

Query: 197 IDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVNQILENIQVSSNNFVKS 256
                   +  P                 S+  ++KA+D Q++N+++EN    S +  KS
Sbjct: 59  --------EAGP-----------------SIAGLVKAVDGQRLNRVIENADTFSASLAKS 93

Query: 257 SDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNMRSSIS 316
              +   +HD R           +ID +L         K    FL +             
Sbjct: 94  GPDIEAGLHDARVLAAKLSASADRIDGVL---------KGAEGFLGSA------------ 132

Query: 317 AIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNISALKENNSLFKDAQRAM 376
                                       S Q+ A   ++I      +E     +DA +A 
Sbjct: 133 ----------------------------SGQQGAGTFAEI------REAAISVRDAGKA- 157

Query: 377 HTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFERNPQDI 436
             FR  SE +++   +I  +    S +   +++ L    Q T+N       + ER+P  +
Sbjct: 158 --FRTLSENLDKRTANISTSFNRLSGTSRREVEALSTDGQRTLNTLSRAARSLERDPSQV 215

Query: 437 VWG 439
           ++G
Sbjct: 216 IFG 218


>gi|307720550|ref|YP_003891690.1| Mammalian cell entry related domain-containing protein
           [Sulfurimonas autotrophica DSM 16294]
 gi|306978643|gb|ADN08678.1| Mammalian cell entry related domain protein [Sulfurimonas
           autotrophica DSM 16294]
          Length = 320

 Score = 51.6 bits (122), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 36/119 (30%), Positives = 60/119 (50%), Gaps = 9/119 (7%)

Query: 1   MESKNYYTSVGLFV----VSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDS 56
           M +K  YT +GL V    VS+L F+    YW+ +  + +    + II    SV GL+ ++
Sbjct: 1   MNNKVNYTFIGLIVLLGIVSMLGFT----YWMLKPAKAE-ETQKYIIYFNESVLGLNLNA 55

Query: 57  SVRFNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELS 115
            V++ GI VG++  L ++            I   TP+   T A +  QG+ G++YI L+
Sbjct: 56  PVKYRGIKVGKVTRLRINPNNSEQVEVTVQILKTTPIKEDTVAKLTAQGITGLSYINLT 114


>gi|167627642|ref|YP_001678142.1| cell entry related family protein [Francisella philomiragia subsp.
           philomiragia ATCC 25017]
 gi|167597643|gb|ABZ87641.1| cell entry related family protein [Francisella philomiragia subsp.
           philomiragia ATCC 25017]
          Length = 243

 Score = 51.6 bits (122), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 40/167 (23%), Positives = 77/167 (46%), Gaps = 5/167 (2%)

Query: 11  GLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRFNGIPVGRIVG 70
           GLFV+ ++F   F  ++LS    +        +    S+ GL+  S V + G  +G++  
Sbjct: 12  GLFVIFMVFVMVFIGFFLSGG--FKNQDTTTFVTNFKSISGLNVGSDVSYKGFNIGKVSD 69

Query: 71  LFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKEKKTIFQIATE 130
           + +++E P        I    P+Y  T AT+++ G+ G + +ELS    EK T   +   
Sbjct: 70  ISINKENPKLVSVYMKINSQIPIYKQTVATLQSVGITGQSKVELSLDISEKNTSLDLIDL 129

Query: 131 RNQR-AMITATPSGINYFISNAENTSKKISDSSRHIQKII--ENIEK 174
           R  +   I + PS +   ++     +  + + S    K++  ENI++
Sbjct: 130 RKGKIPEIKSKPSQLETILNKVNGIAGSLEEISGKFNKMMSQENIQR 176


>gi|317010163|gb|ADU80743.1| ABC transport system substrate binding protein [Helicobacter pylori
           India7]
          Length = 271

 Score = 51.2 bits (121), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 41/192 (21%), Positives = 87/192 (45%), Gaps = 13/192 (6%)

Query: 5   NYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRFNGIP 64
           NY    GLF + ++    F I WL      DG   E ++     + G++T+S V + GI 
Sbjct: 6   NYTLIGGLFFLCLVCMVGF-ILWLGHLGLDDGKYYEYVVYTDKDLGGIATNSPVNYKGIQ 64

Query: 65  VGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKEKKTI 124
           VG ++ +   ++         +I+    +   +   + ++GL G+ ++ L     E+   
Sbjct: 65  VGNVIKVGFAKDKVGVVRLDLMIKSSVKIRKDSKVAVSSRGLMGLKFLALEQSHNEE--- 121

Query: 125 FQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKII--ENIEK------PL 176
           F  + ++ +R +I      I+    +A    +++  + +++ KI+  EN+EK       +
Sbjct: 122 FYGSGDKGERILIFKEGL-IDRLSVDANQAMQEVMKAIKNVNKILDDENVEKFKHILASV 180

Query: 177 TTTIANIETIST 188
              IAN+++  T
Sbjct: 181 DDLIANLDSRKT 192


>gi|308272472|emb|CBX29076.1| hypothetical protein N47_J00570 [uncultured Desulfobacterium sp.]
          Length = 325

 Score = 51.2 bits (121), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 65/291 (22%), Positives = 131/291 (45%), Gaps = 51/291 (17%)

Query: 21  SFFSIYWLSRSNQYD-GPMAEVIIRIPGSVDGLSTDSSVRFNGIPVGRIVGLFLDQEYPN 79
           +F +I W+  S+ ++ G +         SV GLS DS V+F G+ +GR+  + +    P+
Sbjct: 21  AFLAIIWVGMSHYFEQGRLYSAYFN--DSVQGLSKDSPVKFRGVTIGRVSEIAV---APD 75

Query: 80  HSLAKALIRPDTPLYP--STTATIRTQGLAGITYIELSTLRKEKKTIFQIATERNQRAMI 137
             L + +++ ++ + P  +  A +R+ G+ GI ++EL   +  +  +        +   I
Sbjct: 76  GKLIEVVLKIESDMKPDENIVAQLRSVGITGIMFVELDLKKNGESNLSPPLGFVPKHTAI 135

Query: 138 TATPSGINYFISNAENTSKKISDSSRHIQKI-IENIEKPLTTTI---------ANIETIS 187
              PS I  F+ +       ISD    I K+  E +      T+         A IE  S
Sbjct: 136 NTKPSEITRFMDS-------ISDVITQINKVDFEGLSVKTKATLDKINSAVNEAKIENFS 188

Query: 188 TVLANNISHIDKMMHTTQVTPHSSDSK----NTFNTITDL---ITSLDKMIK------AI 234
           + +  ++   +  +  T V   +   K    NT NT+++L   +T +D +I       A 
Sbjct: 189 SDIKESLEKWNTAI--TSVGDAAGVFKTFTLNTDNTVSNLNNAVTKIDAIITGNKDSVAQ 246

Query: 235 DLQKVNQILENIQ---VSSNNFVKSSD--------QVINTVHDVRETTQTF 274
            ++ +N  +EN +   +    F+++SD        Q+++T+  + +T++T 
Sbjct: 247 AIKNLNHAVENAESLVIDGKEFIRNSDQNFSSMQQQILSTMQSLEKTSETL 297


>gi|255020878|ref|ZP_05292934.1| hypothetical protein ACA_1100 [Acidithiobacillus caldus ATCC 51756]
 gi|254969669|gb|EET27175.1| hypothetical protein ACA_1100 [Acidithiobacillus caldus ATCC 51756]
          Length = 313

 Score = 51.2 bits (121), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 34/109 (31%), Positives = 55/109 (50%), Gaps = 5/109 (4%)

Query: 46  PGSVDGLSTDSSVRFNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQG 105
           P SV GL + ++VRF G+ VG +  +  D + P     +  +  DTP+  +T A ++ QG
Sbjct: 43  PYSVSGLQSQAAVRFKGVKVGEVQSIGFDPKNPRLVRVRIRVARDTPITRATFAELQPQG 102

Query: 106 LAGITYIELSTLRKEKKTIFQ-IATERNQRAMITATPSGINYFISNAEN 153
           + G++Y+ LS    +  T F  IA    +  +I   PS I     N E+
Sbjct: 103 VTGLSYLSLS----DSGTDFAPIAHPSGEPPVIPMHPSFIEALSRNGES 147


>gi|261838739|gb|ACX98505.1| ABC transport system substrate binding protein [Helicobacter pylori
           51]
 gi|317182669|dbj|BAJ60453.1| ABC transport system substrate binding protein [Helicobacter pylori
           F57]
          Length = 271

 Score = 51.2 bits (121), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 40/189 (21%), Positives = 86/189 (45%), Gaps = 13/189 (6%)

Query: 5   NYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRFNGIP 64
           NY    GLF + ++    F I WL      DG   E ++     + G++T+S V + GI 
Sbjct: 6   NYTLIGGLFFLCLVCMVGF-ILWLGHLGLDDGKYYEYVVYTDKDLGGIATNSPVNYKGIQ 64

Query: 65  VGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKEKKTI 124
           VG ++ +   ++         +I+    +   +   + ++GL G+ ++ L     E+   
Sbjct: 65  VGNVIKVGFAKDKVGVVRLDLMIKSSVKIRKDSKVAVSSRGLMGLKFLALEQSHNEE--- 121

Query: 125 FQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKII--ENIEK------PL 176
           F  + ++ +R +I      I+    +A    +++  + +++ KI+  EN+EK       +
Sbjct: 122 FYGSGDKGERILIFKEGL-IDRLSVDANQAMQEVMKAIKNVNKILDDENVEKFKHILASI 180

Query: 177 TTTIANIET 185
              IAN+++
Sbjct: 181 DDLIANLDS 189


>gi|317178168|dbj|BAJ55957.1| ABC transport system substrate binding protein [Helicobacter pylori
           F16]
          Length = 271

 Score = 50.8 bits (120), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 40/189 (21%), Positives = 86/189 (45%), Gaps = 13/189 (6%)

Query: 5   NYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRFNGIP 64
           NY    GLF + ++    F I WL      DG   E ++     + G++T+S V + GI 
Sbjct: 6   NYTLIGGLFFLCLVCMVGF-ILWLGHLGLDDGKYYEYVVYTDKDLGGIATNSPVNYKGIQ 64

Query: 65  VGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKEKKTI 124
           VG ++ +   ++         +I+    +   +   + ++GL G+ ++ L     E+   
Sbjct: 65  VGNVIKVGFAKDKVGVVRLDLMIKSSVKIRKDSKVAVSSRGLMGLKFLALEQSHNEE--- 121

Query: 125 FQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKII--ENIEK------PL 176
           F  + ++ +R +I      I+    +A    +++  + +++ KI+  EN+EK       +
Sbjct: 122 FYGSGDKGERILIFKEGL-IDRLSVDANQAMQEVMKAIKNVNKILDDENVEKFKHILASI 180

Query: 177 TTTIANIET 185
              IAN+++
Sbjct: 181 DDLIANLDS 189


>gi|270014771|gb|EFA11219.1| hypothetical protein TcasGA2_TC005184 [Tribolium castaneum]
          Length = 1755

 Score = 50.8 bits (120), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 53/229 (23%), Positives = 94/229 (41%), Gaps = 27/229 (11%)

Query: 224  ITSLDKMIKAI--DLQKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKI 281
            +T +D +I+A   DL++VN++ EN + +  N  K      +    +  TT         I
Sbjct: 1526 LTDIDPIIEATKDDLRRVNRLRENAEYAKTNASKILTDAADVTSTLENTTIAQDNAQSAI 1585

Query: 282  D------HLLSDFSSKMKSKETSA--FLENIADSTSNMRSSISAI-REITDQRQKIISTI 332
            D      ++++D   ++ SK  SA     N AD    +   ++ + R ITD        +
Sbjct: 1586 DTAWNDINIVNDRLKQIGSKTQSAQKKTNNTADDLKKLEEQLNQLQRNITDNGIYANRVV 1645

Query: 333  NTIENITSNLNDSSQKFAELMSKINNI------------SALKENNSLFKDAQRAMHTFR 380
            N   NI      +   F EL ++ + +            S+    N LFK A   +    
Sbjct: 1646 NESSNILEKARTTYDDFNELQAQYSKVQRNLTTSLDKVQSSKDRANDLFKRAWELVAKVT 1705

Query: 381  DTSEKINRYIPSIGN----NLQNFSQSGLNDIQNLVRKLQETVNHFDDC 425
             T E+I++   S       NL+N  Q  +  +    +K+QE V+++  C
Sbjct: 1706 STEEEISKLENSSQQATLTNLENILQDLIRRMNGYNQKIQERVHYYKQC 1754


>gi|91095063|ref|XP_972560.1| PREDICTED: similar to AGAP001381-PA [Tribolium castaneum]
          Length = 1759

 Score = 50.8 bits (120), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 53/229 (23%), Positives = 94/229 (41%), Gaps = 27/229 (11%)

Query: 224  ITSLDKMIKAI--DLQKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKI 281
            +T +D +I+A   DL++VN++ EN + +  N  K      +    +  TT         I
Sbjct: 1530 LTDIDPIIEATKDDLRRVNRLRENAEYAKTNASKILTDAADVTSTLENTTIAQDNAQSAI 1589

Query: 282  D------HLLSDFSSKMKSKETSA--FLENIADSTSNMRSSISAI-REITDQRQKIISTI 332
            D      ++++D   ++ SK  SA     N AD    +   ++ + R ITD        +
Sbjct: 1590 DTAWNDINIVNDRLKQIGSKTQSAQKKTNNTADDLKKLEEQLNQLQRNITDNGIYANRVV 1649

Query: 333  NTIENITSNLNDSSQKFAELMSKINNI------------SALKENNSLFKDAQRAMHTFR 380
            N   NI      +   F EL ++ + +            S+    N LFK A   +    
Sbjct: 1650 NESSNILEKARTTYDDFNELQAQYSKVQRNLTTSLDKVQSSKDRANDLFKRAWELVAKVT 1709

Query: 381  DTSEKINRYIPSIGN----NLQNFSQSGLNDIQNLVRKLQETVNHFDDC 425
             T E+I++   S       NL+N  Q  +  +    +K+QE V+++  C
Sbjct: 1710 STEEEISKLENSSQQATLTNLENILQDLIRRMNGYNQKIQERVHYYKQC 1758


>gi|89256084|ref|YP_513446.1| cell entry (mce) related family protein [Francisella tularensis
           subsp. holarctica LVS]
 gi|115314560|ref|YP_763283.1| ABC transporter ATP-binding protein [Francisella tularensis subsp.
           holarctica OSU18]
 gi|167010769|ref|ZP_02275700.1| probable ABC superfamily ATP binding cassette transporter,
           ABC/membrane protein [Francisella tularensis subsp.
           holarctica FSC200]
 gi|169656564|ref|YP_001428166.2| hypothetical protein FTA_0734 [Francisella tularensis subsp.
           holarctica FTNF002-00]
 gi|254367413|ref|ZP_04983439.1| cell entry (MCE) related family protein [Francisella tularensis
           subsp. holarctica 257]
 gi|254369092|ref|ZP_04985104.1| conserved hypothetical protein [Francisella tularensis subsp.
           holarctica FSC022]
 gi|290954530|ref|ZP_06559151.1| hypothetical protein FtulhU_10156 [Francisella tularensis subsp.
           holarctica URFT1]
 gi|295312046|ref|ZP_06802861.1| hypothetical protein FtulhU_10143 [Francisella tularensis subsp.
           holarctica URFT1]
 gi|89143915|emb|CAJ79134.1| cell entry (mce) related family protein [Francisella tularensis
           subsp. holarctica LVS]
 gi|115129459|gb|ABI82646.1| probable ABC superfamily ATP binding cassette transporter,
           ABC/membrane protein [Francisella tularensis subsp.
           holarctica OSU18]
 gi|134253229|gb|EBA52323.1| cell entry (MCE) related family protein [Francisella tularensis
           subsp. holarctica 257]
 gi|157122042|gb|EDO66182.1| conserved hypothetical protein [Francisella tularensis subsp.
           holarctica FSC022]
 gi|164551632|gb|ABU61210.2| mammalian cell entry (mce) related protein [Francisella tularensis
           subsp. holarctica FTNF002-00]
          Length = 241

 Score = 50.8 bits (120), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 39/167 (23%), Positives = 77/167 (46%), Gaps = 5/167 (2%)

Query: 11  GLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRFNGIPVGRIVG 70
           GLFV+ ++F   F  ++LS    +        +    S+ GL+  S V + G  +G++  
Sbjct: 12  GLFVIFMVFVMIFIGFFLSGG--FKDQHTTTFVTNFKSISGLNVGSDVSYKGFSIGKVSD 69

Query: 71  LFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKEKKTIFQ-IAT 129
           + +++  P        I    P+Y  T AT+++ G+ G + +ELS     K T    I  
Sbjct: 70  ISINKNNPKLVSVYMKINSQIPIYKQTVATLQSMGITGQSKVELSLDIDAKNTSLDLIHI 129

Query: 130 ERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKII--ENIEK 174
           ++ Q   IT+ PS +   ++     +  + + S    K++  EN+++
Sbjct: 130 KKGQIPEITSKPSQLESIMNKVSAIASSLEEISGKFNKMMSPENLDR 176


>gi|239813316|ref|YP_002942226.1| hypothetical protein Vapar_0297 [Variovorax paradoxus S110]
 gi|239799893|gb|ACS16960.1| Mammalian cell entry related domain protein [Variovorax paradoxus
           S110]
          Length = 323

 Score = 50.8 bits (120), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 33/118 (27%), Positives = 56/118 (47%), Gaps = 11/118 (9%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRS----NQYDGPMAEVIIRIPGSVDGLSTDS 56
           ME+K +  + G FV+ ++      + W +R     N Y     E+  R P  V GL   +
Sbjct: 1   MENKAHAIAAGAFVLGLIAVLVGLVVWFTRDSTVRNTY-----ELSTRDP--VSGLQPQA 53

Query: 57  SVRFNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIEL 114
            VR+ GI VG++  +  D +   +   +  +    PL  S+ AT+  QG+ G+ +I L
Sbjct: 54  MVRYRGIAVGKVTSIDFDPKTKGNVRVRITVDQRVPLTTSSFATLSYQGVTGLAFIAL 111


>gi|187931807|ref|YP_001891792.1| hypothetical protein FTM_1117 [Francisella tularensis subsp.
           mediasiatica FSC147]
 gi|187712716|gb|ACD31013.1| conserved hypothetical protein [Francisella tularensis subsp.
           mediasiatica FSC147]
          Length = 241

 Score = 50.8 bits (120), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 39/167 (23%), Positives = 77/167 (46%), Gaps = 5/167 (2%)

Query: 11  GLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRFNGIPVGRIVG 70
           GLFV+ ++F   F  ++LS    +        +    S+ GL+  S V + G  +G++  
Sbjct: 12  GLFVIFMVFVMIFIGFFLSGG--FKDQHTTTFVTNFKSISGLNVGSDVSYKGFSIGKVSD 69

Query: 71  LFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKEKKTIFQ-IAT 129
           + +++  P        I    P+Y  T AT+++ G+ G + +ELS     K T    I  
Sbjct: 70  ISINKNNPKLVSVYMKINSQIPIYKQTVATLQSMGITGQSKVELSLDIDAKNTSLDLIHI 129

Query: 130 ERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKII--ENIEK 174
           ++ Q   IT+ PS +   ++     +  + + S    K++  EN+++
Sbjct: 130 KKGQIPEITSKPSQLESIMNKVSAIASSLEEISGKFNKMMSPENLDR 176


>gi|56708311|ref|YP_170207.1| cell entry (mce) related family protein [Francisella tularensis
           subsp. tularensis SCHU S4]
 gi|110670782|ref|YP_667339.1| cell entry (mce) related family protein [Francisella tularensis
           subsp. tularensis FSC198]
 gi|224457431|ref|ZP_03665904.1| cell entry (mce) related family protein [Francisella tularensis
           subsp. tularensis MA00-2987]
 gi|254370794|ref|ZP_04986799.1| conserved hypothetical protein [Francisella tularensis subsp.
           tularensis FSC033]
 gi|254875131|ref|ZP_05247841.1| conserved hypothetical protein [Francisella tularensis subsp.
           tularensis MA00-2987]
 gi|56604803|emb|CAG45882.1| mycobacterial cell entry (mce) related family protein [Francisella
           tularensis subsp. tularensis SCHU S4]
 gi|110321115|emb|CAL09265.1| mycobacterial cell entry (mce) related family protein [Francisella
           tularensis subsp. tularensis FSC198]
 gi|151569037|gb|EDN34691.1| conserved hypothetical protein [Francisella tularensis subsp.
           tularensis FSC033]
 gi|254841130|gb|EET19566.1| conserved hypothetical protein [Francisella tularensis subsp.
           tularensis MA00-2987]
 gi|282159542|gb|ADA78933.1| mycobacterial cell entry (mce) related family protein [Francisella
           tularensis subsp. tularensis NE061598]
          Length = 241

 Score = 50.8 bits (120), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 39/167 (23%), Positives = 77/167 (46%), Gaps = 5/167 (2%)

Query: 11  GLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRFNGIPVGRIVG 70
           GLFV+ ++F   F  ++LS    +        +    S+ GL+  S V + G  +G++  
Sbjct: 12  GLFVIFMVFVMIFIGFFLSGG--FKDQHTTTFVTNFKSISGLNVGSDVSYKGFSIGKVSD 69

Query: 71  LFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKEKKTIFQ-IAT 129
           + +++  P        I    P+Y  T AT+++ G+ G + +ELS     K T    I  
Sbjct: 70  ISINKNNPKLVSVYMKINSQIPIYKQTVATLQSMGITGQSKVELSLDIDAKNTSLDLIHI 129

Query: 130 ERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKII--ENIEK 174
           ++ Q   IT+ PS +   ++     +  + + S    K++  EN+++
Sbjct: 130 KKGQIPEITSKPSQLESIMNKVSAIASSLEEISGKFNKMMSPENLDR 176


>gi|54113085|gb|AAV29176.1| NT02FT0131 [synthetic construct]
          Length = 241

 Score = 50.8 bits (120), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 39/167 (23%), Positives = 77/167 (46%), Gaps = 5/167 (2%)

Query: 11  GLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRFNGIPVGRIVG 70
           GLFV+ ++F   F  ++LS    +        +    S+ GL+  S V + G  +G++  
Sbjct: 12  GLFVIFMVFVMIFIGFFLSGG--FKDQHTTTFVTNFKSISGLNVGSDVSYKGFSIGKVSD 69

Query: 71  LFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKEKKTIFQ-IAT 129
           + +++  P        I    P+Y  T AT+++ G+ G + +ELS     K T    I  
Sbjct: 70  ISINKNNPKLVSVYMKINSQIPIYKQTVATLQSMGITGQSKVELSLDIDAKNTSLDLIHI 129

Query: 130 ERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKII--ENIEK 174
           ++ Q   IT+ PS +   ++     +  + + S    K++  EN+++
Sbjct: 130 KKGQIPEITSKPSQLESIMNKVSAIASSLEEISGKFNKMMSPENLDR 176


>gi|118497853|ref|YP_898903.1| hypothetical protein FTN_1268 [Francisella tularensis subsp.
           novicida U112]
 gi|134301735|ref|YP_001121703.1| hypothetical protein FTW_0695 [Francisella tularensis subsp.
           tularensis WY96-3418]
 gi|194323826|ref|ZP_03057602.1| mycobacterial cell entry [Francisella tularensis subsp. novicida
           FTE]
 gi|208779917|ref|ZP_03247261.1| mycobacterial cell entry [Francisella novicida FTG]
 gi|254373208|ref|ZP_04988697.1| conserved hypothetical protein [Francisella tularensis subsp.
           novicida GA99-3549]
 gi|118423759|gb|ABK90149.1| conserved protein of unknown function [Francisella novicida U112]
 gi|134049512|gb|ABO46583.1| mammalian cell entry (mce) related protein [Francisella tularensis
           subsp. tularensis WY96-3418]
 gi|151570935|gb|EDN36589.1| conserved hypothetical protein [Francisella novicida GA99-3549]
 gi|194322190|gb|EDX19672.1| mycobacterial cell entry [Francisella tularensis subsp. novicida
           FTE]
 gi|208744372|gb|EDZ90672.1| mycobacterial cell entry [Francisella novicida FTG]
          Length = 241

 Score = 50.8 bits (120), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 39/167 (23%), Positives = 77/167 (46%), Gaps = 5/167 (2%)

Query: 11  GLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRFNGIPVGRIVG 70
           GLFV+ ++F   F  ++LS    +        +    S+ GL+  S V + G  +G++  
Sbjct: 12  GLFVIFMVFVMIFIGFFLSGG--FKDQHTTTFVTNFKSISGLNVGSDVSYKGFSIGKVSD 69

Query: 71  LFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKEKKTIFQ-IAT 129
           + +++  P        I    P+Y  T AT+++ G+ G + +ELS     K T    I  
Sbjct: 70  ISINKNNPKLVSVYMKINSQIPIYKQTVATLQSMGITGQSKVELSLDIDAKNTSLDLIHI 129

Query: 130 ERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKII--ENIEK 174
           ++ Q   IT+ PS +   ++     +  + + S    K++  EN+++
Sbjct: 130 KKGQIPEITSKPSQLESIMNKVSAIASSLEEISGKFNKMMSPENLDR 176


>gi|326388335|ref|ZP_08209931.1| hypothetical protein Y88_3218 [Novosphingobium nitrogenifigens DSM
           19370]
 gi|326207067|gb|EGD57888.1| hypothetical protein Y88_3218 [Novosphingobium nitrogenifigens DSM
           19370]
          Length = 312

 Score = 50.4 bits (119), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 68/335 (20%), Positives = 141/335 (42%), Gaps = 54/335 (16%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSN-----QYDGPMAEVIIRIPGSVDGLSTD 55
           ME++  +  VG   + +L        W++R N     QYD       I    SV+G++  
Sbjct: 1   METRANHIWVGAVTLFLLVGVAALAIWIARLNHPEQRQYD-------IFFKQSVEGVAKG 53

Query: 56  SSVRFNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQG-LAGITYIEL 114
           S+V F+G+P G++  + L ++ P     +  I    P+   TTA++  QG   G+T I+L
Sbjct: 54  STVSFSGVPAGQVADISLWEKDPEFVRVRIRIDRKVPILIGTTASL--QGSFTGVTTIQL 111

Query: 115 STLRKEKKTIFQIATERNQRA--MITATPSGINYFISNAENTSKKISDSSRHIQKII--E 170
           S   +    I    TE+      +I    SG+   +S+A     +++  +  +  ++  +
Sbjct: 112 SGAVRGAPPI----TEKGPAGVPVIPTKRSGLGELLSSAPVLLDRLAGLTDRLSMLVSDQ 167

Query: 171 NIEKPLTTTIANIETISTVLANNISHIDKMMHTTQVTPHSSD-SKNTFNTITDLITSLDK 229
           NI K +   + N E ++  LA     +   +   Q T   ++ +  +F  ++D       
Sbjct: 168 NI-KAVDHILGNTERMTGSLAQAAPEVKATLAELQATIRQANYTLASFEKLSD------- 219

Query: 230 MIKAIDLQKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFS 289
                              S+N+ + + D+    V  +RET ++       +  ++ D  
Sbjct: 220 -------------------STNDSINNPDK--GVVRQLRETLKSANAAANSLQGMVDDAR 258

Query: 290 SKMKSKETSAFLENIADSTSNMRSSISAIREITDQ 324
             M+ +     L     +  +++++  ++R++TDQ
Sbjct: 259 PGMR-RLNDRTLPAAESALRDLQTTTRSLRDLTDQ 292


>gi|317179640|dbj|BAJ57428.1| ABC transport system substrate binding protein [Helicobacter pylori
           F30]
 gi|317181147|dbj|BAJ58933.1| ABC transport system substrate binding protein [Helicobacter pylori
           F32]
          Length = 271

 Score = 50.4 bits (119), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 39/189 (20%), Positives = 86/189 (45%), Gaps = 13/189 (6%)

Query: 5   NYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRFNGIP 64
           NY    GLF + ++    F I WL      DG   E ++     + G++T+S V + GI 
Sbjct: 6   NYTLIGGLFFLCLVCMVGF-ILWLGHLGLDDGKYYEYVVYTDKDLGGIATNSPVNYKGIQ 64

Query: 65  VGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKEKKTI 124
           VG ++ +   ++         +I+    +   +   + ++GL G+ ++ L     E+   
Sbjct: 65  VGNVIKVGFAKDKVGVVRLDLMIKSSVKIRKDSKVAVSSRGLMGLKFLALEQSHNEE--- 121

Query: 125 FQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKII--ENIEK------PL 176
           F  + ++ +R +I      I+    +A    +++  + +++ K++  EN+EK       +
Sbjct: 122 FYGSGDKGERILIFKEGL-IDRLSVDANQAMQEVMKAIKNVNKVLDDENVEKFKHILASI 180

Query: 177 TTTIANIET 185
              IAN+++
Sbjct: 181 DDLIANLDS 189


>gi|85375832|ref|YP_459894.1| ABC-type transport system periplasmic component [Erythrobacter
           litoralis HTCC2594]
 gi|84788915|gb|ABC65097.1| ABC-type transport system periplasmic component [Erythrobacter
           litoralis HTCC2594]
          Length = 281

 Score = 50.4 bits (119), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 48/209 (22%), Positives = 102/209 (48%), Gaps = 15/209 (7%)

Query: 1   MESKNYYTSVGLFVVSILFFS--FFSIYWL-SRSNQYDGPMAEVIIRIPGSVDGLSTDSS 57
           ME+   ++ VG ++  IL  +   F++ ++  + NQ        ++R   SV+GL   S+
Sbjct: 1   METSANFSVVG-WIGGILMLTTIAFAVCFIDPKPNQ-----GTYLVRFDRSVEGLQPGST 54

Query: 58  VRFNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTL 117
           V  +G+PVGR+  + L +  P + L    + P         ATI T  + G   + L   
Sbjct: 55  VTLSGVPVGRVTSVRLAENGPENVLVVLTLDPSAAKVLGLEATISTNLITGEAALVLEG- 113

Query: 118 RKEKKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIE-NIEKPL 176
           R+ ++ I+   T+++ + +I A       F  +A  T + +++S R + + +E   ++ +
Sbjct: 114 RRGRQGIY---TDKSGKKIIPAADE-TGLFGRDATATVETVANSIRALNEGLEPEKQRVI 169

Query: 177 TTTIANIETISTVLANNISHIDKMMHTTQ 205
           T+ +  +   +T LA++    D+ + +T+
Sbjct: 170 TSDLVRLRVTTTALASDAEGWDEQLASTK 198


>gi|332184387|gb|AEE26641.1| ABC-type transport system protein [Francisella cf. novicida 3523]
          Length = 241

 Score = 50.4 bits (119), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 35/133 (26%), Positives = 63/133 (47%), Gaps = 3/133 (2%)

Query: 11  GLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRFNGIPVGRIVG 70
           GLFV+ ++F   F  ++LS    +        +    S+ GL+  S V + G  +G++  
Sbjct: 12  GLFVIFMVFVMIFIGFFLSGG--FKDQDTTTFVTNFKSISGLNVGSDVSYKGFSIGKVSD 69

Query: 71  LFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKEKKTIFQ-IAT 129
           + ++++ P        I    P+Y  T AT+++ G+ G + +ELS    EK T    I  
Sbjct: 70  ISINKDNPKLVSVYMKINSQIPIYKQTVATLQSMGITGQSKVELSLDIDEKNTSLDLINI 129

Query: 130 ERNQRAMITATPS 142
           ++ Q   I + PS
Sbjct: 130 KKGQIPEIKSKPS 142


>gi|322378618|ref|ZP_08053054.1| ABC transport system substrate binding protein [Helicobacter suis
           HS1]
 gi|322380553|ref|ZP_08054719.1| ABC transport system substrate-binding protein [Helicobacter suis
           HS5]
 gi|321147015|gb|EFX41749.1| ABC transport system substrate-binding protein [Helicobacter suis
           HS5]
 gi|321148925|gb|EFX43389.1| ABC transport system substrate binding protein [Helicobacter suis
           HS1]
          Length = 291

 Score = 50.4 bits (119), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 40/206 (19%), Positives = 93/206 (45%), Gaps = 14/206 (6%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME    YT +G   ++ +      I WL   +  D      ++     ++G+  ++ + +
Sbjct: 1   MERHVNYTLIGGIFLACMVCMVVFILWLGHFDLEDKDYMGYVMYTDKDLNGIGANTPINY 60

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            GI +G +  +  D+ +         I+   P++  ++  + +QGL G+ Y  LS ++ +
Sbjct: 61  KGIQIGSVRHVAFDKGHLGMVKLDLRIQSRVPIHKDSSLKVESQGLVGLKY--LSLIQSD 118

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKP----- 175
            K  +   ++ +   ++    S    F+    +++  IS+   +I K IE I  P     
Sbjct: 119 SKEFY---SKNDSERVLRYEQS----FLEKLTSSAGHISNEVLYIIKSIEQILSPQNIDN 171

Query: 176 LTTTIANIETISTVLANNISHIDKMM 201
           ++ TIA+I+ ++  L N    +++++
Sbjct: 172 ISKTIASIQKVTGGLDNTRLALERLL 197


>gi|315585853|gb|ADU40234.1| ABC superfamily ATP binding cassette transporter substrate binding
           protein [Helicobacter pylori 35A]
          Length = 271

 Score = 50.4 bits (119), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 39/189 (20%), Positives = 86/189 (45%), Gaps = 13/189 (6%)

Query: 5   NYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRFNGIP 64
           NY    GLF + ++    F I WL      DG   E ++     + G++T+S V + GI 
Sbjct: 6   NYTLIGGLFFLCLVCMVGF-ILWLGHLGLDDGKYYEYVVYTDKDLGGIATNSPVNYKGIQ 64

Query: 65  VGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKEKKTI 124
           VG ++ +   ++         +I+    +   +   + ++GL G+ ++ L     E+   
Sbjct: 65  VGNVIKVGFAKDKVGVVRLDLMIKSSVKIRKDSKVAVSSRGLMGLKFLALEQSHNEE--- 121

Query: 125 FQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKII--ENIEK------PL 176
           F  + ++ +R +I      I+    +A    +++  + +++ K++  EN+EK       +
Sbjct: 122 FYGSGDKGERILIFKEGL-IDRLSVDANQAMQEVMKAIKNVNKVLDDENVEKFKHILASI 180

Query: 177 TTTIANIET 185
              IAN+++
Sbjct: 181 DDLIANLDS 189


>gi|207091859|ref|ZP_03239646.1| ABC transport system substrate binding protein [Helicobacter pylori
           HPKX_438_AG0C1]
          Length = 271

 Score = 50.4 bits (119), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 40/192 (20%), Positives = 87/192 (45%), Gaps = 13/192 (6%)

Query: 5   NYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRFNGIP 64
           NY    GLF + ++    F I WL      DG   E ++     + G++T+S V + GI 
Sbjct: 6   NYTLIGGLFFLCLVCMVGF-ILWLGHLGLDDGKYYEYVVYTDKDLGGIATNSPVNYKGIQ 64

Query: 65  VGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKEKKTI 124
           VG ++ +   ++         +I+    +   +   + ++GL G+ ++ L     E+   
Sbjct: 65  VGNVIKVGFAKDKVGVVRLDLMIKSSVKIRKDSKVAVSSRGLMGLKFLALEQSHNEE--- 121

Query: 125 FQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKII--ENIEK------PL 176
           F  + ++ +R +I      ++    +A    +++  + +++ KI+  EN+EK       +
Sbjct: 122 FYGSGDKGERILIFKEGL-MDRLSVDANQAMQEVMKAIKNVNKILDDENVEKFKHILASV 180

Query: 177 TTTIANIETIST 188
              IAN+++  T
Sbjct: 181 NDLIANLDSRKT 192


>gi|226942632|ref|YP_002797705.1| MCE domain-containing protein [Azotobacter vinelandii DJ]
 gi|226717559|gb|ACO76730.1| MCE domain protein [Azotobacter vinelandii DJ]
          Length = 312

 Score = 50.4 bits (119), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 72/355 (20%), Positives = 147/355 (41%), Gaps = 61/355 (17%)

Query: 1   MESKNYYTSVGLF-VVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVR 59
           ME++ ++  +GLF VV+++     +++    S   +    EV+     SV GL+  S V 
Sbjct: 1   METRAHHVLIGLFTVVAVIAALLLALWLSKSSLDREFDHYEVLFNH--SVSGLAVGSPVE 58

Query: 60  FNGIPVGRIVGLFLDQEYPNHSLAKALIRPD--TPLYPSTTATIRTQGLAGITYIELSTL 117
           ++GI VG +  L+LD + P   +A+ALIR D  TP+   T   +    + G   I+L   
Sbjct: 59  YSGIRVGDVEQLWLDPQDPR--MARALIRIDSGTPIKQDTRVRLLLANITGARSIQLFGG 116

Query: 118 RKEKKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLT 177
             +     ++  E  +  +I A PS +N  +   E+                      + 
Sbjct: 117 TPQSP---RLEREGGKPPLIVADPSPLNTLLDEGED----------------------VM 151

Query: 178 TTIANIETISTVL--ANNISHIDKMM-HTTQVTPHSSDSKNTFNTITDLITSLDKMIKAI 234
           ++I +I T +++L  A+N+  +  ++ H  Q T   +  +N        +  L +    +
Sbjct: 152 SSINSILTGASLLFSADNVGRLGHILEHLEQATGAIAAQRNELGQTVRQLNQLGRQTGTL 211

Query: 235 DLQKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKS 294
            L+++ ++  N    +N  +    + +  +   + +    +    ++D LL         
Sbjct: 212 -LEEITRLARN----ANGLLDGDGRKL--LASAQRSMSALERSTSRLDRLL--------- 255

Query: 295 KETSAFLENIADSTSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKF 349
           +E    L N  D  + +  +IS +R          +T+  +  +T +L D    F
Sbjct: 256 EENQQALHNGMDGIAELGPAISELR----------TTLGGLRRVTRHLEDDPSGF 300


>gi|297578324|gb|ADI46647.1| laminin alpha 5 [Danio rerio]
          Length = 3664

 Score = 50.1 bits (118), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 44/224 (19%), Positives = 102/224 (45%), Gaps = 18/224 (8%)

Query: 149  SNAENTSKKISDSSRHIQKIIENIEKPLTTTIANIETISTVLANNISHIDKMMHTTQVTP 208
            SN +N  ++  ++SR    II ++ +  TT +   ET S  L  NI   D       +  
Sbjct: 2488 SNQDNFIQRALNASRAYTNIINSVLEAETTALKANETASMAL-ENIRDKDLPAQAAALKN 2546

Query: 209  HSSDSKNTFNTITDLITSLDKMIKAIDL------QKVNQILENIQVSSNNFVKSSDQVIN 262
             S++   +   + +   SL   +  I +      +K  ++L++++   N    S D ++N
Sbjct: 2547 QSTELLKSAEELNNSSQSLKPRVDTIKMSLLDAEKKKEKMLQDLKDIQNKLNVSRDDIVN 2606

Query: 263  TVHDVRETTQTFQEVGQKIDHLLSDFSSKMKS-----KETSAFLENIADSTSNMRSSISA 317
            ++   +   +        +  +L+    +++       +++A  E+I  + ++  +S++A
Sbjct: 2607 SISAAKSAVEQANNTVANVSGVLAPIQKQLEEWQKQYGDSNATSEDINKALNDANTSVAA 2666

Query: 318  IREITDQRQKIISTINTIENIT---SNLNDSSQKFAELMSKINN 358
            +   +D   K+I  ++ + N T   SN++DS Q+  +L+ +  N
Sbjct: 2667 L---SDTLPKLIKKLDRLHNTTFQPSNISDSIQRIRQLIEQARN 2707


>gi|85677493|ref|NP_001034260.1| laminin subunit alpha-5 [Danio rerio]
 gi|81171109|gb|ABB58781.1| laminin alpha 5 [Danio rerio]
          Length = 3664

 Score = 50.1 bits (118), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 44/224 (19%), Positives = 102/224 (45%), Gaps = 18/224 (8%)

Query: 149  SNAENTSKKISDSSRHIQKIIENIEKPLTTTIANIETISTVLANNISHIDKMMHTTQVTP 208
            SN +N  ++  ++SR    II ++ +  TT +   ET S  L  NI   D       +  
Sbjct: 2488 SNQDNFIQRALNASRAYTNIINSVLEAETTALKANETASMAL-ENIRDKDLPAQAAALKN 2546

Query: 209  HSSDSKNTFNTITDLITSLDKMIKAIDL------QKVNQILENIQVSSNNFVKSSDQVIN 262
             S++   +   + +   SL   +  I +      +K  ++L++++   N    S D ++N
Sbjct: 2547 QSTELLKSAEELNNSSQSLKPRVDTIKMSLLDAEKKKEKMLQDLKDIQNKLNVSRDDIVN 2606

Query: 263  TVHDVRETTQTFQEVGQKIDHLLSDFSSKMKS-----KETSAFLENIADSTSNMRSSISA 317
            ++   +   +        +  +L+    +++       +++A  E+I  + ++  +S++A
Sbjct: 2607 SISAAKSAVEQANNTVANVSGVLAPIQKQLEEWQKQYGDSNATSEDINKALNDANTSVAA 2666

Query: 318  IREITDQRQKIISTINTIENIT---SNLNDSSQKFAELMSKINN 358
            +   +D   K+I  ++ + N T   SN++DS Q+  +L+ +  N
Sbjct: 2667 L---SDTLPKLIKKLDRLHNTTFQPSNISDSIQRIRQLIEQARN 2707


>gi|46579024|ref|YP_009832.1| hypothetical protein DVU0610 [Desulfovibrio vulgaris str.
           Hildenborough]
 gi|120603387|ref|YP_967787.1| hypothetical protein Dvul_2344 [Desulfovibrio vulgaris DP4]
 gi|46448437|gb|AAS95091.1| conserved hypothetical protein [Desulfovibrio vulgaris str.
           Hildenborough]
 gi|120563616|gb|ABM29360.1| Mammalian cell entry related domain protein [Desulfovibrio vulgaris
           DP4]
 gi|311232874|gb|ADP85728.1| Mammalian cell entry related domain protein [Desulfovibrio vulgaris
           RCH1]
          Length = 306

 Score = 50.1 bits (118), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 30/115 (26%), Positives = 58/115 (50%), Gaps = 1/115 (0%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++  Y  VG+F +  +  +   + W +   +    MA   +   G+V GLS  S V F
Sbjct: 1   METRASYILVGVFTLLAVTGALAFVLWTAGRGEGKA-MAAYDVHFSGNVMGLSVASDVFF 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELS 115
           NG+ VG +  + L+ + P     +  I   TP+   + A++  +GL G++ ++++
Sbjct: 60  NGVKVGAVKQITLNPDDPAKVKVRIEIDATTPVREDSVASLEGRGLTGVSVVQIT 114


>gi|108563876|ref|YP_628192.1| ABC transport system substrate binding protein [Helicobacter pylori
           HPAG1]
 gi|107837649|gb|ABF85518.1| ABC transport system substrate binding protein [Helicobacter pylori
           HPAG1]
          Length = 271

 Score = 50.1 bits (118), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 40/192 (20%), Positives = 87/192 (45%), Gaps = 13/192 (6%)

Query: 5   NYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRFNGIP 64
           NY    GLF + ++    F I WL      DG   E ++     + G++T+S V + GI 
Sbjct: 6   NYTLIGGLFFLCLVCMVGF-ILWLGHLGLDDGKYYEYVVYTDKDLGGIATNSPVNYKGIQ 64

Query: 65  VGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKEKKTI 124
           VG ++ +   ++         +I+    +   +   + ++GL G+ ++ L     E+   
Sbjct: 65  VGNVIKVGFAKDKVGVVRLDLMIKSSVKIRKDSKVAVSSRGLMGLKFLALEQSHNEE--- 121

Query: 125 FQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKII--ENIEK------PL 176
           F  + ++ +R +I      ++    +A    +++  + R++ +I+  EN+EK       +
Sbjct: 122 FYGSGDKGERILIFKEGL-MDRLSVDANQVMQEVMRAIRNVNRILDDENVEKFKHILASV 180

Query: 177 TTTIANIETIST 188
              IAN+++  T
Sbjct: 181 DDLIANLDSRKT 192


>gi|298735567|ref|YP_003728088.1| putative ABC transport system substrate-binding protein
           [Helicobacter pylori B8]
 gi|298354752|emb|CBI65624.1| putative ABC transport system substrate-binding protein
           [Helicobacter pylori B8]
          Length = 271

 Score = 49.7 bits (117), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 39/192 (20%), Positives = 86/192 (44%), Gaps = 13/192 (6%)

Query: 5   NYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRFNGIP 64
           NY    GLF + ++    F I WL      DG   E ++     + G++T+S V + GI 
Sbjct: 6   NYTLIGGLFFLCLVCMVGF-ILWLGHLGLDDGKYYEYVVYTDKDLGGIATNSPVNYKGIQ 64

Query: 65  VGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKEKKTI 124
           VG ++ +   ++         +I+    +   +   + ++G  G+ ++ L     E+   
Sbjct: 65  VGNVIKVGFAKDKVGVVRLDLMIKSSVKIRKDSKVAVSSRGFMGLKFLALEQSHNEE--- 121

Query: 125 FQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKII--ENIEK------PL 176
           F  + ++ +R +I      ++    +A    +++  + R++ +I+  EN+EK       +
Sbjct: 122 FYGSGDKGERILIFKEGL-MDRLSGDANQVVQEVMKAIRNVNRILDDENVEKFKHILASV 180

Query: 177 TTTIANIETIST 188
              IAN+++  T
Sbjct: 181 DDLIANLDSRKT 192


>gi|207109055|ref|ZP_03243217.1| ABC transport system substrate binding protein [Helicobacter pylori
           HPKX_438_CA4C1]
          Length = 182

 Score = 49.7 bits (117), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 36/172 (20%), Positives = 79/172 (45%), Gaps = 7/172 (4%)

Query: 5   NYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRFNGIP 64
           NY    GLF + ++    F I WL      DG   E ++     + G++T+S V + GI 
Sbjct: 6   NYTLIGGLFFLCLVCMVGF-ILWLGHLGLDDGKYYEYVVYTDKDLGGIATNSPVNYKGIQ 64

Query: 65  VGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKEKKTI 124
           VG ++ +   ++         +I+    +   +   + ++GL G+ ++ L     E+   
Sbjct: 65  VGNVIKVGFAKDKVGVVRLDLMIKSSVKIRKDSKVAVSSRGLMGLKFLALEQSHNEE--- 121

Query: 125 FQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKII--ENIEK 174
           F  + ++ +R +I      ++    +A    +++  + +++ KI+  EN+EK
Sbjct: 122 FYGSGDKGERILIFKEGL-MDRLSVDANQAMQEVMKAIKNVNKILDDENVEK 172


>gi|78355068|ref|YP_386517.1| organic solvents resistance ABC transporter periplasmic
           protein-like protein [Desulfovibrio desulfuricans subsp.
           desulfuricans str. G20]
 gi|78217473|gb|ABB36822.1| ABC-type transport system involved in resistance to organic
           solvents periplasmic component-like protein
           [Desulfovibrio desulfuricans subsp. desulfuricans str.
           G20]
          Length = 313

 Score = 49.7 bits (117), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 46/221 (20%), Positives = 89/221 (40%), Gaps = 25/221 (11%)

Query: 9   SVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRFNGIPVGRI 68
           ++GL V+ +   +F    +  + + Y        IR   +V  LS    V++ GI +GR+
Sbjct: 19  TLGLAVLGLFIVAFGGHRFWEKLDTYH-------IRFL-TVKDLSVGRPVKYAGINIGRV 70

Query: 69  VGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELS-TLRKEKKTIFQI 127
           + + +D+  P        ++ D  +Y  T A+I  +GL G  Y+ LS   R  +K   Q 
Sbjct: 71  LDISVDKMDPGQVHVTIGVQQDFAVYQGTVASITQKGLVGDNYVLLSLKARPGQKLPVQS 130

Query: 128 ATERNQRAMITATPSGINYFISNAENTSKKISDS----------------SRHIQKIIEN 171
               +    I    + + + +        +I+DS                +R++  ++ N
Sbjct: 131 EIPADTSTSIFEAAASVGHLVQELHPKLVRIADSLDILLATINSQDMAGVTRNMNAVLHN 190

Query: 172 IEKPLTTTIANIETISTVLANNISHIDKMMHTTQVTPHSSD 212
             + + T    I+ +S      I     +M T Q + H +D
Sbjct: 191 AAQGIKTMTTEIQAVSGDARQGIREARNVMRTVQGSAHKAD 231


>gi|296160363|ref|ZP_06843180.1| Mammalian cell entry related domain protein [Burkholderia sp.
           Ch1-1]
 gi|295889344|gb|EFG69145.1| Mammalian cell entry related domain protein [Burkholderia sp.
           Ch1-1]
          Length = 320

 Score = 49.7 bits (117), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 40/66 (60%)

Query: 49  VDGLSTDSSVRFNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAG 108
           V GL TD++VR+ G+ VG++  +  D ++P   L + L+    P+  ST  ++  QG+ G
Sbjct: 46  VTGLYTDAAVRYRGLDVGKVQSIKFDPDHPGQILIRILVDTHAPITHSTFGSLGFQGVTG 105

Query: 109 ITYIEL 114
           I +I+L
Sbjct: 106 IAFIQL 111


>gi|283852494|ref|ZP_06369762.1| Mammalian cell entry related domain protein [Desulfovibrio sp.
           FW1012B]
 gi|283572102|gb|EFC20094.1| Mammalian cell entry related domain protein [Desulfovibrio sp.
           FW1012B]
          Length = 304

 Score = 49.7 bits (117), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 65/278 (23%), Positives = 115/278 (41%), Gaps = 43/278 (15%)

Query: 48  SVDGLSTDSSVRFNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLA 107
           SV  LS   +V++ G+ +GR+  + LD E P+    +  +R D PL+  T A I  +GL 
Sbjct: 51  SVKDLSPGRTVKYAGLDIGRVKSIDLDPEDPHFISVRIDVRKDFPLFEGTVARIGQKGLV 110

Query: 108 GITYIELSTLRKEKKTIFQIATERNQRAMITATPSGINYFISN--AENTSKKISDSSRHI 165
           G  Y+ L  LR +     Q        AM+ A    +N       A      + D    I
Sbjct: 111 GDYYV-LLELRGQPGARLQPG------AMLPA----VNTMDMQELAAKAGDLLDDIRPKI 159

Query: 166 QKIIENIEKPLTTTIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLIT 225
           ++I +NI +  T    N E +   L            T Q+      + N F T    ++
Sbjct: 160 KEIADNIARLFTEE--NTEALRRALEG----------TPQLVEDLRRAANDFRTNWATLS 207

Query: 226 SLDKMIKAIDLQKVNQILENIQVSSNNFVKSSDQVINTVH-DVRETTQTFQEVGQKIDHL 284
           +  K  KA D   ++Q L  I           D+ + +V  ++ +T  T++  G+ +  L
Sbjct: 208 A--KGGKAAD--SLDQSLRRI-----------DKAVGSVEKELNKTLVTYRNQGEHVGAL 252

Query: 285 LSDFSSKM--KSKETSAFLENIADSTSNMRSSISAIRE 320
           + D         +     L+N+  ++ +++  +S +RE
Sbjct: 253 IKDVRQGFNYDQENLEVILKNLNRTSRDLKELMSRLRE 290


>gi|120554122|ref|YP_958473.1| hypothetical protein Maqu_1195 [Marinobacter aquaeolei VT8]
 gi|120323971|gb|ABM18286.1| Mammalian cell entry related domain protein [Marinobacter aquaeolei
           VT8]
          Length = 312

 Score = 49.7 bits (117), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 42/192 (21%), Positives = 82/192 (42%), Gaps = 13/192 (6%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME K ++  +G F ++ +  +     WL +S+  D   A   I     V GL+  + V +
Sbjct: 1   MEPKAHHVIIGFFTLAAVIAALLFALWLGKSST-DTNWAYYRIGFDHPVGGLAKGNPVLY 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G+PVG ++ L L  + P H      +  D P+  +T A +    + G   I+ +    +
Sbjct: 60  TGVPVGDVLDLTLAPDNPAHVRVLVRVNQDIPVRENTRAGLVLANITGSMSIQFTGGTPD 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
                 +   +    +I A PS  +  ++N E    K        ++++EN  + ++   
Sbjct: 120 SPI---LEGHKANPPLIAAEPSAFSNLLTNGEAMLGK-------AEQLLENANRLMSED- 168

Query: 181 ANIETISTVLAN 192
            N+  I+ +L N
Sbjct: 169 -NLSNIAEILEN 179


>gi|188993116|ref|YP_001905126.1| conserved putative secreted protein [Xanthomonas campestris pv.
           campestris str. B100]
 gi|167734876|emb|CAP53088.1| conserved putative secreted protein [Xanthomonas campestris pv.
           campestris]
          Length = 308

 Score = 49.3 bits (116), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 43/145 (29%), Positives = 70/145 (48%), Gaps = 8/145 (5%)

Query: 48  SVDGLSTDSSVRFNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLA 107
           +V GLS  S V++NGI VG I  L L    P   +A   +   TP+   T A +    L 
Sbjct: 47  AVTGLSVGSPVQYNGIAVGSITELTLAPNDPRQVVAHVRVNSTTPIKSDTRAKLAITSLT 106

Query: 108 GITYIELSTLRKEKKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQK 167
           G + I+LS    E  ++  I  +++   +I  TPS +     N  +T+ +I +  R  Q 
Sbjct: 107 GPSIIQLSGGTPEAPSLTTI--DKSDAPIIQTTPSALQ----NITDTANRIVE--RMDQM 158

Query: 168 IIENIEKPLTTTIANIETISTVLAN 192
           + +     +T T+ N+E IS  +A+
Sbjct: 159 LSDKNVASITATLQNLEKISGGIAD 183


>gi|188528236|ref|YP_001910923.1| ABC transport system substrate binding protein [Helicobacter pylori
           Shi470]
 gi|188144476|gb|ACD48893.1| ABC transport system substrate binding protein [Helicobacter pylori
           Shi470]
 gi|308064223|gb|ADO06110.1| ABC transport system substrate binding protein [Helicobacter pylori
           Sat464]
          Length = 271

 Score = 49.3 bits (116), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 38/189 (20%), Positives = 85/189 (44%), Gaps = 13/189 (6%)

Query: 5   NYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRFNGIP 64
           NY    GLF + ++    F I WL      DG   E ++     + G++T+S V + GI 
Sbjct: 6   NYTLIGGLFFLCLVCMVGF-ILWLGHLGLEDGKYYEYVVYTDKDLGGIATNSPVNYKGIQ 64

Query: 65  VGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKEKKTI 124
           VG ++ +   ++         +I+    +   +   + ++G  G+ ++ L     E+   
Sbjct: 65  VGNVIKVGFAKDKVGVVRLDLMIKSSVKIRKDSKVAVSSRGFMGLKFLALEQSHNEE--- 121

Query: 125 FQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKII--ENIEK------PL 176
           F  + ++ +R +I      ++    +A    +++  + +++ KI+  EN+EK       +
Sbjct: 122 FYGSGDKGERILIF-KEGFMDRLSVDANQVMQEVMKAIKNVNKILDDENVEKFKHILVSV 180

Query: 177 TTTIANIET 185
              IAN+++
Sbjct: 181 DDLIANLDS 189


>gi|91781623|ref|YP_556829.1| ABC transporter, periplasmic ligand binding protein [Burkholderia
           xenovorans LB400]
 gi|91685577|gb|ABE28777.1| ABC transporter, periplasmic ligand binding protein [Burkholderia
           xenovorans LB400]
          Length = 320

 Score = 49.3 bits (116), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 40/66 (60%)

Query: 49  VDGLSTDSSVRFNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAG 108
           V GL TD++VR+ G+ VG++  +  D ++P   L + L+    P+  ST  ++  QG+ G
Sbjct: 46  VTGLYTDAAVRYRGLDVGKVQSIKFDPDHPGQILIRILVDTHAPITHSTFGSLGFQGVTG 105

Query: 109 ITYIEL 114
           I +I+L
Sbjct: 106 IAFIQL 111


>gi|21230108|ref|NP_636025.1| hypothetical protein XCC0633 [Xanthomonas campestris pv. campestris
           str. ATCC 33913]
 gi|66769901|ref|YP_244663.1| hypothetical protein XC_3601 [Xanthomonas campestris pv. campestris
           str. 8004]
 gi|21111636|gb|AAM39949.1| conserved hypothetical protein [Xanthomonas campestris pv.
           campestris str. ATCC 33913]
 gi|66575233|gb|AAY50643.1| conserved hypothetical protein [Xanthomonas campestris pv.
           campestris str. 8004]
          Length = 308

 Score = 49.3 bits (116), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 43/145 (29%), Positives = 70/145 (48%), Gaps = 8/145 (5%)

Query: 48  SVDGLSTDSSVRFNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLA 107
           +V GLS  S V++NGI VG I  L L    P   +A   +   TP+   T A +    L 
Sbjct: 47  AVTGLSVGSPVQYNGIAVGSITELTLAPNDPRQVVAHVRVNSTTPIKSDTRAKLAITSLT 106

Query: 108 GITYIELSTLRKEKKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQK 167
           G + I+LS    E  ++  I  +++   +I  TPS +     N  +T+ +I +  R  Q 
Sbjct: 107 GPSIIQLSGGTPEAPSLTTI--DKSDAPIIQTTPSALQ----NITDTANRIVE--RMDQM 158

Query: 168 IIENIEKPLTTTIANIETISTVLAN 192
           + +     +T T+ N+E IS  +A+
Sbjct: 159 LSDKNVASITATLQNLEKISGGIAD 183


>gi|85858834|ref|YP_461036.1| organic solvents resistance ABC transporter periplasmic protein
           [Syntrophus aciditrophicus SB]
 gi|85721925|gb|ABC76868.1| ABC-type transport system involved in resistance to organic
           solvents, periplasmic component [Syntrophus
           aciditrophicus SB]
          Length = 493

 Score = 49.3 bits (116), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 88/358 (24%), Positives = 141/358 (39%), Gaps = 85/358 (23%)

Query: 10  VGLFV-VSILFFSFFSIYWLSRSNQYD-----GPMAEVIIRIPGSVDGLSTDSSVRFNGI 63
           VGLFV V ++   + S     R  Q       G   EV      +V GL  D+SV+  G+
Sbjct: 10  VGLFVLVGLIILGYMSF----RVGQQGFGLKKGYRVEVAFD---NVSGLEKDASVQIAGV 62

Query: 64  PVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKEKKT 123
            +GR+  + L       ++    I PD  L     A+I+T G+ G  YIELS   K +  
Sbjct: 63  EMGRVESIRLKD---GKAMVTLRINPDVKLERDVMASIKTHGVLGDKYIELSPGTKGEGY 119

Query: 124 IF---QIA-TER--------NQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIEN 171
           I    QIA  ER         Q A+I      ++  +S               I  IIEN
Sbjct: 120 IAPGGQIAVAERAADIDRLLQQFALIADDVKAVSGALSKVLGGQA----GEESIGAIIEN 175

Query: 172 IEKPLTTTIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMI 231
             + LT        ++ V+ NN  ++  M+  T+                +L  +L+ M+
Sbjct: 176 T-RQLTC------NLNKVVLNNEENLRTMLENTR----------------ELTGNLNSMV 212

Query: 232 KAIDLQKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSK 291
              D + V Q++E+++ +S                 RE  +TF          LSD S  
Sbjct: 213 TRND-ENVTQMIESLKSAS-----------------REMEKTFAA--------LSDISEG 246

Query: 292 MKSKETSAFL----ENIADSTSNMRSSISAIREITDQRQKIISTINTIENITSNLNDS 345
           MK  E +       + +A+  +   +S+ ++ E  DQ +  I  +   +    NLN+S
Sbjct: 247 MKRGEGTMGQLLTDKTMAEKLNRTMTSLESVAEKIDQGKGTIGKLVNEQETVDNLNES 304


>gi|303246827|ref|ZP_07333104.1| Mammalian cell entry related domain protein [Desulfovibrio
           fructosovorans JJ]
 gi|302491844|gb|EFL51724.1| Mammalian cell entry related domain protein [Desulfovibrio
           fructosovorans JJ]
          Length = 302

 Score = 49.3 bits (116), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 65/282 (23%), Positives = 112/282 (39%), Gaps = 37/282 (13%)

Query: 5   NYYTSVGLFVVSILFFSFFSI------YWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSV 58
           +Y  + G  ++ +     F +      +W+    +YD      +IR   SV  LS   +V
Sbjct: 11  DYLKAYGTLLLGLCILGAFMVVLGGNWFWV----KYD----HYLIRFT-SVKDLSPGRTV 61

Query: 59  RFNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLR 118
           ++ G+ +GR+  + LD   P++   +  IR   PLY  T A I  +GL G  Y+ L    
Sbjct: 62  KYAGLDIGRVASIDLDPTDPHYIAVEIDIRQGFPLYTGTVARIAQKGLVGDYYVLLDLRG 121

Query: 119 KEKKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTT 178
              + +    T       I + P+        A      + D    I  I +NI+K  + 
Sbjct: 122 APGERLAPGGT-------IPSLPT--MDLQELAAKAGDLLDDIRPKINDIADNIDKLFSK 172

Query: 179 TIANIETISTVLANNISHIDKMMHTTQVTPHSSD--SKNTFNTITDLITSLDKMIKAID- 235
              N E++   L N    ++ +         + D  S         L  SL +M KA+  
Sbjct: 173 E--NTESLRRALENTPKLVEDLRRAANDFRTNWDRLSAKGGKAAETLDASLRRMAKAVAS 230

Query: 236 -LQKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQE 276
             +++ + L+NIQ       + +D +   V DVR+     QE
Sbjct: 231 VEKELVKTLQNIQ-------RKTDGIGGLVTDVRQGFNYDQE 265


>gi|15612422|ref|NP_224075.1| hypothetical protein jhp1357 [Helicobacter pylori J99]
 gi|308183563|ref|YP_003927690.1| ABC transport system substrate binding protein [Helicobacter pylori
           PeCan4]
 gi|308185232|ref|YP_003929365.1| ABC transport system substrate binding protein [Helicobacter pylori
           SJM180]
 gi|4155969|gb|AAD06933.1| putative [Helicobacter pylori J99]
 gi|307638117|gb|ADN80567.1| ABC transporter periplasmic substrate-binding protein [Helicobacter
           pylori 908]
 gi|308061152|gb|ADO03048.1| ABC transport system substrate binding protein [Helicobacter pylori
           SJM180]
 gi|308065748|gb|ADO07640.1| ABC transport system substrate binding protein [Helicobacter pylori
           PeCan4]
 gi|317014878|gb|ADU82314.1| ABC transport system substrate binding protein [Helicobacter pylori
           Gambia94/24]
 gi|325996717|gb|ADZ52122.1| ABC transport system substrate binding protein [Helicobacter pylori
           2018]
          Length = 271

 Score = 49.3 bits (116), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 38/192 (19%), Positives = 86/192 (44%), Gaps = 13/192 (6%)

Query: 5   NYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRFNGIP 64
           NY    GLF + ++    F I WL      DG   E ++     + G++T+S + + GI 
Sbjct: 6   NYTLIGGLFFLCLVCMVGF-ILWLGHLGLDDGKYYEYVVYTDKDLGGIATNSPINYKGIQ 64

Query: 65  VGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKEKKTI 124
           VG ++ +   ++         +I+    +   +   + ++G  G+ ++ L     E+   
Sbjct: 65  VGNVIKVGFAKDKVGVVRLDLMIKSSVKIRKDSKVAVSSRGFMGLKFLALEQSHNEE--- 121

Query: 125 FQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKII--ENIEK------PL 176
           F  + ++ +R +I      ++    +A    +++  + R++ +I+  EN+EK       +
Sbjct: 122 FYGSGDKGERILIFKEGL-MDRLSGDANQVVQEVMKAIRNVNRILDDENVEKFKHILASV 180

Query: 177 TTTIANIETIST 188
              IAN+++  T
Sbjct: 181 DDLIANLDSRKT 192


>gi|15646073|ref|NP_208255.1| hypothetical protein HP1464 [Helicobacter pylori 26695]
 gi|254779976|ref|YP_003058083.1| ABC-type transport system, periplasmic component [Helicobacter
           pylori B38]
 gi|2314641|gb|AAD08505.1| conserved hypothetical secreted protein [Helicobacter pylori 26695]
 gi|254001889|emb|CAX30139.1| ABC-type transport system, periplasmic component [Helicobacter
           pylori B38]
          Length = 271

 Score = 49.3 bits (116), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 40/199 (20%), Positives = 89/199 (44%), Gaps = 13/199 (6%)

Query: 5   NYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRFNGIP 64
           NY    GLF + ++    F I WL      DG   E ++     + G++T+S + + GI 
Sbjct: 6   NYTLIGGLFFLCLVCMVGF-ILWLGHLGLDDGKYYEYVVYTDKDLGGIATNSPINYKGIQ 64

Query: 65  VGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKEKKTI 124
           VG ++ +   ++         +I+    +   +   + ++G  G+ ++ L     E+   
Sbjct: 65  VGNVIKVGFAKDKVGVVRLDLMIKSSVKIRKDSKVAVSSRGFMGLKFLALEQSHNEE--- 121

Query: 125 FQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKII--ENIEK------PL 176
           F  + ++ +R +I      ++    +A    +++  + R++ +I+  EN+EK       +
Sbjct: 122 FYGSGDKGERILIFKEGL-MDRLSGDANQVVQEVMKAIRNVNRILDDENVEKFKHILASV 180

Query: 177 TTTIANIETISTVLANNIS 195
              IAN+++  T   + IS
Sbjct: 181 DDLIANLDSRKTQFDSLIS 199


>gi|223940092|ref|ZP_03631956.1| Mammalian cell entry related domain protein [bacterium Ellin514]
 gi|223891277|gb|EEF57774.1| Mammalian cell entry related domain protein [bacterium Ellin514]
          Length = 324

 Score = 49.3 bits (116), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 49/218 (22%), Positives = 92/218 (42%), Gaps = 44/218 (20%)

Query: 5   NYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRFNGIP 64
             +  +GL V+    F+F +  +  +   ++         + G V GL+  S V+  G+ 
Sbjct: 11  GLFVIIGLGVLIAGLFAFGARGYFQQQRVFE-------TYVTGEVQGLAVGSPVKLRGVT 63

Query: 65  VGRIVGL-FLDQEYPNHSLAKALIRPDTP----LYP----------------STTATIRT 103
           +G++  + F+  EYP + +   LIR + P    L P                   A ++ 
Sbjct: 64  IGKVTYIGFIWNEYPQYKIDYVLIRFEVPKETSLLPPPDMNFQTLIDREIARGLRARVQG 123

Query: 104 QGLAGITYIELSTLRKEKKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSR 163
           QG+ G + + L  L            +RN    +  TP   +Y+I +A     ++  S  
Sbjct: 124 QGITGSSIVALDYLDP----------KRNPPLQVPWTPK--HYYIPSAPGQFTEVVAS-- 169

Query: 164 HIQKIIENIEKP-LTTTIANIETISTVLANNISHIDKM 200
            IQKI+  +E+  L+ T+A  +T+       + H+D+M
Sbjct: 170 -IQKILAKLEELNLSNTVARADTLMESADLLVKHVDRM 206


>gi|325923306|ref|ZP_08184979.1| ABC-type transport system involved in resistance to organic
           solvents, periplasmic component [Xanthomonas gardneri
           ATCC 19865]
 gi|325546233|gb|EGD17414.1| ABC-type transport system involved in resistance to organic
           solvents, periplasmic component [Xanthomonas gardneri
           ATCC 19865]
          Length = 308

 Score = 48.9 bits (115), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 54/193 (27%), Positives = 91/193 (47%), Gaps = 11/193 (5%)

Query: 1   MESKNYYTSVGLF-VVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVR 59
           ME+K  Y  +G F +V+ L    F ++    S+        V+ R   +V GL+  S V+
Sbjct: 1   METKANYVLIGAFTIVAGLALLLFGLWAAKYSSDRTWQQYRVVFR--EAVTGLTVGSPVQ 58

Query: 60  FNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRK 119
           +NGI VG I  L L    P   +A   +   TP+   T A +    L G + I+LS    
Sbjct: 59  YNGIAVGSITELTLAPNDPRQVVAHVRVNSTTPIKSDTRAKLAITSLTGPSIIQLSGGTP 118

Query: 120 EKKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTT 179
           E  ++  I  +++   +I  TPS +     N  +T+ +I +  R  Q + +     +T T
Sbjct: 119 EAPSLTTI--DKSDAPIIQTTPSALQ----NITDTANRIVE--RMDQMLSDKNVASITAT 170

Query: 180 IANIETISTVLAN 192
           + N+E IS+ +A+
Sbjct: 171 LQNLEKISSGIAD 183


>gi|74316267|ref|YP_314007.1| ABC-type transport system periplasmic component [Thiobacillus
           denitrificans ATCC 25259]
 gi|74055762|gb|AAZ96202.1| ABC-type transport system periplasmic component [Thiobacillus
           denitrificans ATCC 25259]
          Length = 315

 Score = 48.9 bits (115), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 46/215 (21%), Positives = 89/215 (41%), Gaps = 26/215 (12%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++  YT VG  V+++L     +I WL+         +  I     S+DGL+  S+V+ 
Sbjct: 1   METEGRYTLVGSLVLAVLASMTLAIVWLAGGADKIAYQSYTIYFRHQSLDGLAVGSAVKM 60

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            GI VG + G              A I  D P++    A I+   + GI  +E       
Sbjct: 61  RGIKVGVVEGFRFADGDDEAVRVTARIDEDVPVHAGAAAYIKRNLVTGIAAVE------- 113

Query: 121 KKTIFQIATERNQRAMITATPSGINYFI-----SNAENTSKKISDSSRHIQKIIENI--- 172
                 I     +  +++  P+G  Y +     S+ +  +  +S  +    ++++ +   
Sbjct: 114 ------IDNGPGKGPLLSEPPAGERYPVIAEGSSDLDKVATAVSKLAVSGAQVLDKMNTL 167

Query: 173 -----EKPLTTTIANIETISTVLANNISHIDKMMH 202
                ++ ++ T+AN+  +S  LA N   +D  + 
Sbjct: 168 LSDENQRSVSRTLANLNELSGHLAANKQSLDAAVQ 202


>gi|330998667|ref|ZP_08322397.1| hypothetical protein HMPREF9439_00010 [Parasutterella
           excrementihominis YIT 11859]
 gi|329576528|gb|EGG58036.1| hypothetical protein HMPREF9439_00010 [Parasutterella
           excrementihominis YIT 11859]
          Length = 336

 Score = 48.9 bits (115), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 76/310 (24%), Positives = 138/310 (44%), Gaps = 47/310 (15%)

Query: 48  SVDGLSTDSSVRFNGIPVGRIVGLFLDQE-YPNHSLAKALIRPDTPLYPSTTATIRTQGL 106
           SV+GLS  + V+F GI +G++  + L  + YP+  +  +L  PD     ++ A +R    
Sbjct: 49  SVNGLSPGAPVKFKGIDIGKVTEISLSSKVYPDDHI--SLFSPD-----ASVAVVRM--- 98

Query: 107 AGITYIELSTLRKEKKTIFQIATERNQRAMITATPSGINYFISNAENTS---KKISDSSR 163
             I YI+ + L+++   + Q    R Q  +   T  G  Y  +N  N +    +I D   
Sbjct: 99  --IVYIDENQLKEQLPDLIQKGL-RFQTELAGVT--GTIYLAANFLNPTLYPPEIKDVPW 153

Query: 164 HIQKIIENIEKPLTTTI-ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITD 222
             + I       LT  I  NI+     L N  + ID       VTP +  +++T     +
Sbjct: 154 KPKYIYVPATISLTNEILENIQHFLATLQNIKTKID------DVTPDAVKTQST----KE 203

Query: 223 LITSLDKMIKAIDLQKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKID 282
           L+T+L+  +  +D  K++ +L N    + N+V SS  +++ V   R            ++
Sbjct: 204 LLTTLNNTVSMLDPDKLHTLLSN----AENYVNSSHSILSKVDVAR------------VN 247

Query: 283 HLLSDFSSKMKSKETSAFLENIADSTSNMRSSIS-AIREITDQRQKIISTINTIENITSN 341
            LLS+ +   +   T+      +   + +  +IS A + I D R  I   I  +++I+ N
Sbjct: 248 SLLSELTKTTEKLNTTLHETKGSGLVTQLNKTISGADQAIVDNRYNIRELILNLKDISDN 307

Query: 342 LNDSSQKFAE 351
           L   S+  A+
Sbjct: 308 LKILSESLAQ 317


>gi|208435332|ref|YP_002266998.1| ABC transport system substrate binding protein [Helicobacter pylori
           G27]
 gi|208433261|gb|ACI28132.1| ABC transport system substrate binding protein [Helicobacter pylori
           G27]
          Length = 267

 Score = 48.9 bits (115), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 38/192 (19%), Positives = 86/192 (44%), Gaps = 13/192 (6%)

Query: 5   NYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRFNGIP 64
           NY    GLF + ++    F I WL      DG   E ++     + G++T+S + + GI 
Sbjct: 2   NYTLIGGLFFLCLVCMVGF-ILWLGHLGLDDGKYYEYVVYTDKDLGGIATNSPINYKGIQ 60

Query: 65  VGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKEKKTI 124
           VG ++ +   ++         +I+    +   +   + ++G  G+ ++ L     E+   
Sbjct: 61  VGNVIKVGFAKDKVGVVRLDLMIKSSVKIRKDSKVAVSSRGFMGLKFLALEQSHNEE--- 117

Query: 125 FQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKII--ENIEK------PL 176
           F  + ++ +R +I      ++    +A    +++  + R++ +I+  EN+EK       +
Sbjct: 118 FYGSGDKGERILIFKEGL-MDRLSGDANQVVQEVMKAIRNVNRILDDENVEKFKHILASV 176

Query: 177 TTTIANIETIST 188
              IAN+++  T
Sbjct: 177 DDLIANLDSRKT 188


>gi|198283901|ref|YP_002220222.1| Mammalian cell entry related domain-containing protein
           [Acidithiobacillus ferrooxidans ATCC 53993]
 gi|218665999|ref|YP_002426535.1| mce-related protein [Acidithiobacillus ferrooxidans ATCC 23270]
 gi|198248422|gb|ACH84015.1| Mammalian cell entry related domain protein [Acidithiobacillus
           ferrooxidans ATCC 53993]
 gi|218518212|gb|ACK78798.1| mce-related protein [Acidithiobacillus ferrooxidans ATCC 23270]
          Length = 312

 Score = 48.5 bits (114), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 33/115 (28%), Positives = 55/115 (47%), Gaps = 3/115 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           MES+ +   V L  +++L      +       Q  G   +VI R   SV GL+  + VRF
Sbjct: 1   MESRAHAL-VALIFLAVLGIGMVVVGLWMHHRQRPGVTFDVISRY--SVAGLTLQAPVRF 57

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELS 115
            G+ VG +  + LD   P     +  +   TP+  +T A +  QG+ G++Y+ L+
Sbjct: 58  KGVRVGEVTAIGLDPANPRMIRVRIKVDEATPVTRATFAELAPQGVTGLSYLSLT 112


>gi|237751538|ref|ZP_04582018.1| predicted protein [Helicobacter bilis ATCC 43879]
 gi|229372904|gb|EEO23295.1| predicted protein [Helicobacter bilis ATCC 43879]
          Length = 255

 Score = 48.5 bits (114), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 51/233 (21%), Positives = 96/233 (41%), Gaps = 32/233 (13%)

Query: 1   MESKNYYTSVGLF--VVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSV 58
           ME    YT +GL   +++I   +F  I+W+ R    D  +    +     V G+S ++ V
Sbjct: 1   MERNINYTLIGLIFCILTIAMIAF--IFWIGRFGIDDRRVKIYHVYTQDEVGGISVNTPV 58

Query: 59  RFNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLR 118
           ++ GI VG +  +   ++          I    P+   +   I + G  G++Y++L   +
Sbjct: 59  KYKGISVGSVTHMGFKKDDVGVVQIDVAINKKIPVREGSELVIDSDGFVGMSYLKLK--Q 116

Query: 119 KEKKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTT 178
            EK  I +   E    A +    + I   + NA+  +  I D                  
Sbjct: 117 NEKGNIIKDEDE----ATLYLAKNAIGKLLENAQGMTNDIQD------------------ 154

Query: 179 TIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMI 231
            ++N++ I+   + NI  I  M+ + + T  + D   T N+   L+  LDK +
Sbjct: 155 IVSNVKNITD--SKNIEDIRNMLISLEGTKQNLDK--TLNSADKLLRDLDKAL 203


>gi|58580427|ref|YP_199443.1| hypothetical protein XOO0804 [Xanthomonas oryzae pv. oryzae
           KACC10331]
 gi|84622389|ref|YP_449761.1| hypothetical protein XOO_0732 [Xanthomonas oryzae pv. oryzae MAFF
           311018]
 gi|188578636|ref|YP_001915565.1| ABC transporter substrate-binding protein [Xanthomonas oryzae pv.
           oryzae PXO99A]
 gi|58425021|gb|AAW74058.1| conserved hypothetical protein [Xanthomonas oryzae pv. oryzae
           KACC10331]
 gi|84366329|dbj|BAE67487.1| conserved hypothetical protein [Xanthomonas oryzae pv. oryzae MAFF
           311018]
 gi|188523088|gb|ACD61033.1| ABC transporter substrate-binding protein [Xanthomonas oryzae pv.
           oryzae PXO99A]
          Length = 308

 Score = 48.5 bits (114), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 45/153 (29%), Positives = 72/153 (47%), Gaps = 11/153 (7%)

Query: 48  SVDGLSTDSSVRFNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLA 107
           +V GLS  S V++NGI VG I  L L    P   +A   +   TP+   T A +    L 
Sbjct: 47  AVTGLSVGSPVQYNGIAVGSITELTLAPNDPRQVVALVRVNSTTPIKSDTRAKLAITSLT 106

Query: 108 GITYIELSTLRKEKKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQK 167
           G + I+LS    E   +  I  +++   +I  TPS +     N  +T+ +I +  R  Q 
Sbjct: 107 GPSIIQLSGGTPEAPALTTI--DKSDAPIIQTTPSALQ----NITDTANRIVE--RMDQM 158

Query: 168 IIENIEKPLTTTIANIETISTVLANNISHIDKM 200
           + +     ++ T+ N+E IS  +A+   H D M
Sbjct: 159 LSDKNVASISATLQNLEKISGGIAD---HDDGM 188


>gi|210135631|ref|YP_002302070.1| ABC transporter substrate binding protein [Helicobacter pylori P12]
 gi|210133599|gb|ACJ08590.1| ABC transporter substrate binding protein [Helicobacter pylori P12]
          Length = 271

 Score = 48.5 bits (114), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 38/192 (19%), Positives = 86/192 (44%), Gaps = 13/192 (6%)

Query: 5   NYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRFNGIP 64
           NY    GLF + ++    F I WL      DG   E ++     + G++T+S + + GI 
Sbjct: 6   NYTLIGGLFFLCLVCMVGF-ILWLGHLGLDDGKYYEYVVYTDKDLGGIATNSPINYKGIQ 64

Query: 65  VGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKEKKTI 124
           VG ++ +   ++         +I+    +   +   + ++G  G+ ++ L     E+   
Sbjct: 65  VGNVIKVGFAKDKVGVVRLDLMIKSSVKIRKDSKVAVSSRGFMGLKFLALEQSHNEE--- 121

Query: 125 FQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKII--ENIEK------PL 176
           F  + ++ +R +I      ++    +A    +++  + R++ +I+  EN+EK       +
Sbjct: 122 FYGSGDKGERILIFKEGL-MDRLSGDANQVVQEVMRAIRNVNRILDDENVEKFKHILASV 180

Query: 177 TTTIANIETIST 188
              IAN+++  T
Sbjct: 181 DDLIANLDSRKT 192


>gi|303258322|ref|ZP_07344325.1| putative ABC-type transport system, periplasmic component
           [Burkholderiales bacterium 1_1_47]
 gi|302858768|gb|EFL81856.1| putative ABC-type transport system, periplasmic component
           [Burkholderiales bacterium 1_1_47]
          Length = 323

 Score = 48.5 bits (114), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 76/310 (24%), Positives = 138/310 (44%), Gaps = 47/310 (15%)

Query: 48  SVDGLSTDSSVRFNGIPVGRIVGLFLDQE-YPNHSLAKALIRPDTPLYPSTTATIRTQGL 106
           SV+GLS  + V+F GI +G++  + L  + YP+  +  +L  PD     ++ A +R    
Sbjct: 36  SVNGLSPGAPVKFKGIDIGKVTEISLSSKVYPDDHI--SLFSPD-----ASVAVVRM--- 85

Query: 107 AGITYIELSTLRKEKKTIFQIATERNQRAMITATPSGINYFISNAENTS---KKISDSSR 163
             I YI+ + L+++   + Q    R Q  +   T  G  Y  +N  N +    +I D   
Sbjct: 86  --IVYIDENQLKEQLPDLIQKGL-RFQTELAGVT--GTIYLAANFLNPTLYPPEIKDVPW 140

Query: 164 HIQKIIENIEKPLTTTI-ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITD 222
             + I       LT  I  NI+     L N  + ID       VTP +  +++T     +
Sbjct: 141 KPKYIYVPATISLTNEILENIQHFLATLQNIKTKID------DVTPDAVKTQST----KE 190

Query: 223 LITSLDKMIKAIDLQKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKID 282
           L+T+L+  +  +D  K++ +L N    + N+V SS  +++ V   R            ++
Sbjct: 191 LLTTLNNTVSMLDPDKLHTLLSN----AENYVNSSHSILSKVDVAR------------VN 234

Query: 283 HLLSDFSSKMKSKETSAFLENIADSTSNMRSSIS-AIREITDQRQKIISTINTIENITSN 341
            LLS+ +   +   T+      +   + +  +IS A + I D R  I   I  +++I+ N
Sbjct: 235 SLLSELTKTTEKLNTTLHETKGSGLVTQLNKTISGADQAIVDNRYNIRELILNLKDISDN 294

Query: 342 LNDSSQKFAE 351
           L   S+  A+
Sbjct: 295 LKILSESLAQ 304


>gi|114799224|ref|YP_761597.1| virulence factor Mce-like protein [Hyphomonas neptunium ATCC 15444]
 gi|114739398|gb|ABI77523.1| virulence factor Mce homolog [Hyphomonas neptunium ATCC 15444]
          Length = 317

 Score = 48.1 bits (113), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 32/117 (27%), Positives = 63/117 (53%), Gaps = 4/117 (3%)

Query: 1   MESK-NYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVR 59
           ME++ NY    GL +++    + F + WL +S +++    +  I   G V  L    +VR
Sbjct: 1   METRANYALIGGLVILAAALVAGF-VLWLGQS-EFNRDYKDYDIVFEGPVS-LEEGGAVR 57

Query: 60  FNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELST 116
           + GI VG +  + +D+  P+   A+  +  +TP+   ++A+I+  G+ G T+I++S 
Sbjct: 58  YIGIKVGEVATVRIDRADPSKVRARIRVSRETPIREDSSASIQLAGITGTTFIQISA 114


>gi|148263114|ref|YP_001229820.1| hypothetical protein Gura_1041 [Geobacter uraniireducens Rf4]
 gi|146396614|gb|ABQ25247.1| Mammalian cell entry related domain protein [Geobacter
           uraniireducens Rf4]
          Length = 150

 Score = 48.1 bits (113), Expect = 0.003,   Method: Composition-based stats.
 Identities = 34/116 (29%), Positives = 57/116 (49%), Gaps = 3/116 (2%)

Query: 1   MESKNYYTSVGLFV-VSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVR 59
           M+     T VG+FV + IL  ++ SI  L +   + G    V      SV GL + +SV 
Sbjct: 1   MKKAGLETIVGIFVLIGILCLAYLSIK-LGKMELFGGDYYTVTANF-DSVSGLKSGASVE 58

Query: 60  FNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELS 115
             G+ VGR+  + LD +  + +     IR    ++    A +RT+G+ G  +I+L+
Sbjct: 59  IAGVEVGRVERIILDPKGNDRAKVYLRIRSGVKMFDDVIAAVRTRGIIGDKFIQLN 114


>gi|261840138|gb|ACX99903.1| ABC transport system substrate binding protein [Helicobacter pylori
           52]
          Length = 271

 Score = 48.1 bits (113), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 36/189 (19%), Positives = 85/189 (44%), Gaps = 13/189 (6%)

Query: 5   NYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRFNGIP 64
           NY    GLF + ++    F I WL      DG   E ++     + G++T+S + + GI 
Sbjct: 6   NYTLIGGLFFLCLVCMVGF-ILWLGHLGLDDGKYYEYVVYTDKDLGGIATNSPINYKGIQ 64

Query: 65  VGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKEKKTI 124
           VG ++ +   ++         +I+    +   +   + ++G  G+ ++ L     E+   
Sbjct: 65  VGNVIKVGFAKDKVGVVRLDLMIKSSVKIRKDSKVAVSSRGFMGLKFLALEQSHNEE--- 121

Query: 125 FQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKII--ENIEK------PL 176
           F  + ++ +R +I      ++    +A    +++  + +++ +I+  EN+EK       +
Sbjct: 122 FYGSGDKGERILIFKEGL-MDRLSGDANQAVQEVMKAIKNVNRILDDENVEKFKHILASI 180

Query: 177 TTTIANIET 185
              IAN+++
Sbjct: 181 DDLIANLDS 189


>gi|317013232|gb|ADU83840.1| ABC transport system substrate binding protein [Helicobacter pylori
           Lithuania75]
          Length = 271

 Score = 48.1 bits (113), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 38/192 (19%), Positives = 86/192 (44%), Gaps = 13/192 (6%)

Query: 5   NYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRFNGIP 64
           NY    GLF + ++    F I WL      DG   E ++     + G++T+S + + GI 
Sbjct: 6   NYTLIGGLFFLCLVCMVGF-ILWLGHLGLDDGKYYEYVVYTDKDLGGIATNSPINYKGIQ 64

Query: 65  VGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKEKKTI 124
           VG ++ +   ++         +I+    +   +   + ++G  G+ ++ L     E+   
Sbjct: 65  VGNVIKVGFAKDKVGVVRLDLMIKSSVKIRKDSKVAVSSRGFMGLKFLALEQSHNEE--- 121

Query: 125 FQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKII--ENIEK------PL 176
           F  + ++ +R +I      ++    +A    +++  + +++ KI+  EN+EK       +
Sbjct: 122 FYGSGDKGERILIFKEGL-MDRLSVDANQAMQEVMKAIKNVNKILDDENVEKFKHILASV 180

Query: 177 TTTIANIETIST 188
              IAN+++  T
Sbjct: 181 NDLIANLDSRKT 192


>gi|296134760|ref|YP_003642002.1| Mammalian cell entry related domain protein [Thiomonas intermedia
           K12]
 gi|295794882|gb|ADG29672.1| Mammalian cell entry related domain protein [Thiomonas intermedia
           K12]
          Length = 322

 Score = 48.1 bits (113), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 74/327 (22%), Positives = 139/327 (42%), Gaps = 36/327 (11%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           MESK  YT+VGLFVV +        +WL+   +        +I    +V GL TDS+V +
Sbjct: 1   MESKVNYTAVGLFVVLLGALLGGLGWWLATGGKQTA-TRPYLIYATDNVSGLKTDSNVLY 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G+ VG++  + +D + P     K  I    P+   T A +   G+ G++ + L  +   
Sbjct: 60  RGVTVGKVASIEIDPKNPALIRIKVEIDSAVPVRNDTVAQLSPLGVTGLSAVNL--IGGA 117

Query: 121 KKTIFQIATERNQRAMITATPSG-----INYFISNAENTSKKISDSSRHIQKIIENIEKP 175
             T                TP G     I Y  S        I+D++  + +I + ++  
Sbjct: 118 SSTPL-------------PTPPGEPDPVIPYKPSVFTQIEGGINDAAITLARISQRVDAL 164

Query: 176 LTT--------TIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSL 227
           L+         T+ N++T+S  LA N ++I++M    + T  S++        + L+   
Sbjct: 165 LSPANVQSISDTLRNLQTLSASLAANQNNINQMFANARQT--SANLTQMSAQGSALMLQS 222

Query: 228 DKMIKAIDL--QKVNQILENIQVSSNNFVKSSDQVIN-TVHDVRETTQTFQEVGQKIDHL 284
             ++K +D    ++  ++  I  ++N+  ++ D     T   V+  TQ       ++D L
Sbjct: 223 QALVKRLDGVSAQLGGLMPQIGAAANSVAQAGDTTTAFTQAGVQAMTQLQTRTLPEVDAL 282

Query: 285 LSDFSSKMKSKETSAFLENIADSTSNM 311
             +   +  S +  A  EN+  + S +
Sbjct: 283 ARNL--QQLSSQLGALTENLKANPSQL 307


>gi|78049253|ref|YP_365428.1| ABC transporter substrate-binding protein [Xanthomonas campestris
           pv. vesicatoria str. 85-10]
 gi|325928562|ref|ZP_08189750.1| ABC-type transport system involved in resistance to organic
           solvents, periplasmic component [Xanthomonas perforans
           91-118]
 gi|78037683|emb|CAJ25428.1| ABC transporter substrate-binding protein [Xanthomonas campestris
           pv. vesicatoria str. 85-10]
 gi|325541101|gb|EGD12655.1| ABC-type transport system involved in resistance to organic
           solvents, periplasmic component [Xanthomonas perforans
           91-118]
          Length = 308

 Score = 48.1 bits (113), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 42/145 (28%), Positives = 69/145 (47%), Gaps = 8/145 (5%)

Query: 48  SVDGLSTDSSVRFNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLA 107
           +V GLS  S V++NGI VG I  L L    P   +A   +   TP+   T A +    L 
Sbjct: 47  AVTGLSVGSPVQYNGIAVGSITELTLAPNDPRQVVAHVRVNSTTPIKSDTRAKLAITSLT 106

Query: 108 GITYIELSTLRKEKKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQK 167
           G + I+LS    E   +  I  +++   +I  TPS +     N  +T+ +I +  R  Q 
Sbjct: 107 GPSIIQLSGGTPEAPALTSI--DKSDAPIIQTTPSALQ----NITDTANRIVE--RMDQM 158

Query: 168 IIENIEKPLTTTIANIETISTVLAN 192
           + +     ++ T+ N+E IS  +A+
Sbjct: 159 LSDKNVASISATLQNLEKISGGIAD 183


>gi|289662618|ref|ZP_06484199.1| ABC transporter substrate-binding protein [Xanthomonas campestris
           pv. vasculorum NCPPB702]
 gi|289668437|ref|ZP_06489512.1| ABC transporter substrate-binding protein [Xanthomonas campestris
           pv. musacearum NCPPB4381]
          Length = 308

 Score = 48.1 bits (113), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 42/145 (28%), Positives = 69/145 (47%), Gaps = 8/145 (5%)

Query: 48  SVDGLSTDSSVRFNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLA 107
           +V GLS  S V++NGI VG I  L L    P   +A   +   TP+   T A +    L 
Sbjct: 47  AVTGLSVGSPVQYNGIAVGSITELTLAPNDPRQVVAHVRVNSTTPIKSDTRAKLAITSLT 106

Query: 108 GITYIELSTLRKEKKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQK 167
           G + I+LS    E   +  I  +++   +I  TPS +     N  +T+ +I +  R  Q 
Sbjct: 107 GPSIIQLSGGTPEAPALTAI--DKSDAPIIQTTPSALQ----NITDTANRIVE--RMDQM 158

Query: 168 IIENIEKPLTTTIANIETISTVLAN 192
           + +     ++ T+ N+E IS  +A+
Sbjct: 159 LSDKNVASISATLQNLEKISGGIAD 183


>gi|297380680|gb|ADI35567.1| ABC transport system substrate binding protein [Helicobacter pylori
           v225d]
          Length = 271

 Score = 47.8 bits (112), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 37/189 (19%), Positives = 85/189 (44%), Gaps = 13/189 (6%)

Query: 5   NYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRFNGIP 64
           NY    GLF + ++    F I WL      DG   E ++     + G++T+S + + GI 
Sbjct: 6   NYTLIGGLFFLCLVCMVGF-ILWLGHLGLEDGKYYEYVVYTDKDLGGIATNSPINYKGIQ 64

Query: 65  VGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKEKKTI 124
           VG ++ +   ++         +I+    +   +   + ++G  G+ ++ L     E+   
Sbjct: 65  VGNVIKVGFAKDKVGVVRLDLMIKSSVKIRKDSKVAVSSRGFMGLKFLALEQSHNEE--- 121

Query: 125 FQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKII--ENIEK------PL 176
           F  + ++ +R +I      ++    +A    +++  + +++ KI+  EN+EK       +
Sbjct: 122 FYGSGDKGERILIF-KEGFMDRLSVDANQVMQEVMKAIKNVNKILDDENVEKFKHILVSV 180

Query: 177 TTTIANIET 185
              IAN+++
Sbjct: 181 DDLIANLDS 189


>gi|149186603|ref|ZP_01864915.1| ABC-type transport system periplasmic component [Erythrobacter sp.
           SD-21]
 gi|148829830|gb|EDL48269.1| ABC-type transport system periplasmic component [Erythrobacter sp.
           SD-21]
          Length = 316

 Score = 47.8 bits (112), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 63/302 (20%), Positives = 134/302 (44%), Gaps = 33/302 (10%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSI-YWL--SRSNQ--YDGPMAEVIIRIPGSVDGLSTD 55
           ME+   ++ V  ++V IL  +  +   WL   R NQ  Y        I+   SV+GL + 
Sbjct: 1   METNANFSLVA-WIVGILMLTTIAFAMWLIDPRPNQETYQ-------IKFDRSVEGLQSG 52

Query: 56  SSVRFNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELS 115
           S+V  +G+PVG++  + L +  P + +    + P         ATI T  + G   + L 
Sbjct: 53  STVTLSGVPVGQVTSVRLAENEPENVVVVLTLDPSAAKVHGLEATISTDLITGEAALVLE 112

Query: 116 TLRKEKKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIE-NIEK 174
             R+ ++ I+   T+++ + +I A          +A  T + +++S R + + +E   ++
Sbjct: 113 G-RRGRQGIY---TDKSGKKIIPAADE-TGLLGRDATATVETVANSIRALNEGLEPEKQR 167

Query: 175 PLTTTIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMI--- 231
            +T+ +  +   +  LA++    D+ + +T+      D         + +   D+ I   
Sbjct: 168 VITSDLVRLRVTTAALASDAEGWDERLASTK--GRLLDLGQRVGGWGNNLRDADRRISGR 225

Query: 232 --KAIDLQKVNQILENIQVSSNNF--VKSS-----DQVINTVHDVRETTQTFQEVGQKID 282
              AI  +++ Q  E +Q + N    ++S      D ++    D+RE ++    + +KI+
Sbjct: 226 SASAIAQRRLRQFREGVQNAENKLSQIRSGIPAVEDSLVEGETDLRELSRELAPLSEKIE 285

Query: 283 HL 284
            +
Sbjct: 286 DI 287


>gi|158521032|ref|YP_001528902.1| hypothetical protein Dole_1015 [Desulfococcus oleovorans Hxd3]
 gi|158509858|gb|ABW66825.1| Mammalian cell entry related domain protein [Desulfococcus
           oleovorans Hxd3]
          Length = 321

 Score = 47.8 bits (112), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 69/336 (20%), Positives = 133/336 (39%), Gaps = 85/336 (25%)

Query: 48  SVDGLSTDSSVRFNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPST--TATIRTQG 105
           SV GL+ DS V++ G+ +G++  + + +   +  L + ++R D    P T   A +++ G
Sbjct: 47  SVQGLNKDSPVKYRGVSIGQVHDIRISK---DDRLIEVMLRIDPDWKPGTDTIAQLKSIG 103

Query: 106 LAGITYIELSTLRKEKKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHI 165
           + GI ++EL   +  +  +       +   +I   PS I   +                +
Sbjct: 104 ITGIMFVELDLKKPGESVLLPTPAHASTYPVIPTRPSDIRELLGG--------------V 149

Query: 166 QKIIENIEKPLTTTIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLIT 225
            +++E ++        ++ TIS  L   ++ I+K +   QV            TI+D   
Sbjct: 150 TEVVEQLKG------LDLATISDGLKETLAAINKTLADAQV-----------KTISD--- 189

Query: 226 SLDKMIKAIDLQKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLL 285
            LD  I  ++  +V    E+     N     + Q    V D+                  
Sbjct: 190 RLDTAI--LNANRVISSFESAAPGLNRLTSRASQAATRVDDL------------------ 229

Query: 286 SDFSSKMKSKETSAFLENIADSTSNMRSSISAIREIT----------DQR-----QKIIS 330
                       +A  + ++D+ +NM++++  IREIT          D R      +++ 
Sbjct: 230 -----------ITANEKELSDAIANMKAAMIQIREITTTGTAMMGRADTRIDTFESRLLV 278

Query: 331 TINTIENITSNLNDSSQKFAELMSKINNISALKENN 366
           TI  +E I+SNL   + K A   S++   + L E N
Sbjct: 279 TIGHLEEISSNLRQMTAKGASQPSQLFFAAPLPEKN 314


>gi|166713441|ref|ZP_02244648.1| hypothetical protein Xoryp_18880 [Xanthomonas oryzae pv. oryzicola
           BLS256]
          Length = 308

 Score = 47.8 bits (112), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 42/154 (27%), Positives = 72/154 (46%), Gaps = 8/154 (5%)

Query: 48  SVDGLSTDSSVRFNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLA 107
           +V GLS  S V++NGI VG I  L L    P   +A   +   TP+   T A +    L 
Sbjct: 47  AVTGLSVGSPVQYNGIAVGSITELTLAPNDPRQVVAHVRVNSTTPIKSDTRAKLAITSLT 106

Query: 108 GITYIELSTLRKEKKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQK 167
           G + I+LS    E   +  I  +++   +I  TPS +     N  +T+ +I +  R  Q 
Sbjct: 107 GPSIIQLSGGTPEAPALTTI--DKSDAPIIQTTPSALQ----NITDTANRIVE--RMDQM 158

Query: 168 IIENIEKPLTTTIANIETISTVLANNISHIDKMM 201
           + +     ++ T+ N+E IS  +A+    +  ++
Sbjct: 159 LSDKNVASISATLQNLEKISGGIADRDDGVQALI 192


>gi|21244297|ref|NP_643879.1| hypothetical protein XAC3572 [Xanthomonas axonopodis pv. citri str.
           306]
 gi|294624129|ref|ZP_06702867.1| conserved hypothetical protein [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 11122]
 gi|294663968|ref|ZP_06729388.1| conserved hypothetical protein [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 10535]
 gi|21109947|gb|AAM38415.1| conserved hypothetical protein [Xanthomonas axonopodis pv. citri
           str. 306]
 gi|292601574|gb|EFF45573.1| conserved hypothetical protein [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 11122]
 gi|292606263|gb|EFF49494.1| conserved hypothetical protein [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 10535]
          Length = 308

 Score = 47.8 bits (112), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 42/145 (28%), Positives = 69/145 (47%), Gaps = 8/145 (5%)

Query: 48  SVDGLSTDSSVRFNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLA 107
           +V GLS  S V++NGI VG I  L L    P   +A   +   TP+   T A +    L 
Sbjct: 47  AVTGLSVGSPVQYNGIAVGSITELTLAPNDPRQVVAHVRVNSTTPIKSDTRAKLAITSLT 106

Query: 108 GITYIELSTLRKEKKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQK 167
           G + I+LS    E   +  I  +++   +I  TPS +     N  +T+ +I +  R  Q 
Sbjct: 107 GPSIIQLSGGTPEAPALTTI--DKSDAPIIQTTPSALQ----NITDTANRIVE--RMDQM 158

Query: 168 IIENIEKPLTTTIANIETISTVLAN 192
           + +     ++ T+ N+E IS  +A+
Sbjct: 159 LSDKNVASISATLQNLEKISGGIAD 183


>gi|71906847|ref|YP_284434.1| hypothetical protein Daro_1208 [Dechloromonas aromatica RCB]
 gi|71846468|gb|AAZ45964.1| Mammalian cell entry related protein [Dechloromonas aromatica RCB]
          Length = 308

 Score = 47.4 bits (111), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 42/163 (25%), Positives = 73/163 (44%), Gaps = 7/163 (4%)

Query: 26  YWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRFNGIPVGRIVGLFLDQEYPNHSLAKA 85
           YWLS S        + I+    ++ GL+  + VR+ GI VG++  + LD +  ++ L   
Sbjct: 26  YWLSGSRDAS---RDYIVVTKQNIGGLNPQAQVRYRGIRVGKVSDIRLDPDDYSNILVTI 82

Query: 86  LIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKEKKTIFQIATERNQRAMITATPSGIN 145
            +  D PL   T A +  QG+ G+ +I    L +  K +  +  + ++   IT  PS ++
Sbjct: 83  SVNEDVPLTTGTVAKLNYQGVTGLAHI---LLLETGKDMAPLEPDGDKLPRITMIPSLLD 139

Query: 146 YFISNAENTSKKISDSSRHIQKII-ENIEKPLTTTIANIETIS 187
                   T K+          ++ E     LT T+AN+E  S
Sbjct: 140 ELGETGAATLKQARQMMASANALLSEENRTHLTATLANLEAAS 182


>gi|149374948|ref|ZP_01892721.1| hypothetical protein MDG893_07820 [Marinobacter algicola DG893]
 gi|149360837|gb|EDM49288.1| hypothetical protein MDG893_07820 [Marinobacter algicola DG893]
          Length = 312

 Score = 47.4 bits (111), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 53/205 (25%), Positives = 92/205 (44%), Gaps = 11/205 (5%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRS-NQYDGPMAEVIIRIPGSVDGLSTDSSVR 59
           ME + ++  +GLF +  L  +     WL ++ N  D    E+I      V GLS  S V+
Sbjct: 1   MEPRAHHVLIGLFTLVALAGALAFALWLGQAGNDRDYAWYEIIFDR--GVSGLSEGSPVK 58

Query: 60  FNGIPVGRIVGLFLDQEYPNHSLAKALIR--PDTPLYPSTTATIRTQGLAGITYIELSTL 117
           ++GI VG +  L LD   P +   +ALIR   D P+   T A +    + G   +EL   
Sbjct: 59  YSGIEVGDVAELSLDPSDPRN--VRALIRVYDDVPIKEDTRAGLALTNITGSMNVELKGG 116

Query: 118 RKEKKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKII-ENIEKPL 176
               +   ++   R     I A PS     ++++E    K+     +   ++ E   + L
Sbjct: 117 TPGSR---KLTGSRESPPTIQAEPSAFTTLMASSEELFAKLDQFLSNANAMVSEENSRNL 173

Query: 177 TTTIANIETISTVLANNISHIDKMM 201
           T ++ NIE +S+ L +  S +  ++
Sbjct: 174 TRSLKNIEAVSSGLMDQRSELSNLV 198



 Score = 45.1 bits (105), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 38/167 (22%), Positives = 79/167 (47%), Gaps = 9/167 (5%)

Query: 275 QEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNMRSSISAIREITDQRQKIISTINT 334
           +E+  K+D  LS+ ++ M S+E S    N+  S  N+ +  S +    DQR ++ + + +
Sbjct: 148 EELFAKLDQFLSN-ANAMVSEENS---RNLTRSLKNIEAVSSGL---MDQRSELSNLVTS 200

Query: 335 IENITSNLNDSSQKFAELMSKINNISALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIG 394
            + ++     + + F    +  NN+   KE   L   AQ AM +    + ++        
Sbjct: 201 FDQLSVQTEATLETFRRFGNTANNLLD-KEGRQLMTTAQSAMDSLETATARLEALTARNE 259

Query: 395 NNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFERNPQDIVWGRE 441
            +L    Q G+ ++   +R+L+ T+ + D  ++  E +P  ++ GRE
Sbjct: 260 GSLDQGMQ-GIGELAPAMRELRSTLKNLDSLIHRLEDDPTGLLLGRE 305


>gi|303327743|ref|ZP_07358183.1| toluene tolerance ABC transporter, periplasmic substrate-binding
           protein [Desulfovibrio sp. 3_1_syn3]
 gi|302862104|gb|EFL85038.1| toluene tolerance ABC transporter, periplasmic substrate-binding
           protein [Desulfovibrio sp. 3_1_syn3]
          Length = 149

 Score = 47.4 bits (111), Expect = 0.005,   Method: Composition-based stats.
 Identities = 39/116 (33%), Positives = 56/116 (48%), Gaps = 4/116 (3%)

Query: 8   TSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRFNGIPVGR 67
           T+VG+FV+  L    +    L R   +     E+  R   S  GL   + V   G+PVGR
Sbjct: 7   TAVGIFVLLGLICVAYLAIKLGRMEFFANQGFELSARF-DSASGLRVGADVELAGVPVGR 65

Query: 68  IVGLFLDQEYPNHSLAKALIRPDTPLYPS--TTATIRTQGLAGITYIELSTLRKEK 121
           +V + LD + P  + A   +R D  L  S  + A+I+T GL G  Y+ LS    EK
Sbjct: 66  VVAISLDPD-PLRTQAVVHLRLDKNLRLSDDSIASIKTSGLIGDKYVSLSRGGSEK 120


>gi|212703463|ref|ZP_03311591.1| hypothetical protein DESPIG_01507 [Desulfovibrio piger ATCC 29098]
 gi|212673123|gb|EEB33606.1| hypothetical protein DESPIG_01507 [Desulfovibrio piger ATCC 29098]
          Length = 149

 Score = 47.4 bits (111), Expect = 0.005,   Method: Composition-based stats.
 Identities = 33/109 (30%), Positives = 51/109 (46%), Gaps = 2/109 (1%)

Query: 8   TSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRFNGIPVGR 67
           T+VG+FV+  L    +    L +   +D    E++     SV GL   + V   G+PVGR
Sbjct: 7   TAVGIFVLLGLVCVAYLTIKLGKMEVFDSKGFELVANF-NSVSGLRVGADVEMAGVPVGR 65

Query: 68  IVGLFLDQEYPNHSLAKALI-RPDTPLYPSTTATIRTQGLAGITYIELS 115
           +  + LD +         LI   D  L   T A+++T GL G  Y+ L+
Sbjct: 66  VASIKLDDDLSRRQARVVLILDKDLQLPADTIASVKTSGLIGDKYVNLT 114


>gi|320536071|ref|ZP_08036128.1| methyl-accepting chemotaxis protein signaling domain protein
           [Treponema phagedenis F0421]
 gi|320147071|gb|EFW38630.1| methyl-accepting chemotaxis protein signaling domain protein
           [Treponema phagedenis F0421]
          Length = 714

 Score = 47.0 bits (110), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 64/289 (22%), Positives = 133/289 (46%), Gaps = 53/289 (18%)

Query: 152 ENTSKKISDSSRHIQKIIENIEKPLTTTIANIETISTVLANNISHIDKMMHTTQVTPHSS 211
           EN +  +++SS  I++++           ANIE I+  L    S I+K+      T  ++
Sbjct: 446 ENQATSVAESSSSIEQMV-----------ANIEAITQTLEKTNSSIEKL------TSATA 488

Query: 212 DSKNTFNTITDLITSLDKMIKAIDLQKVNQILENIQVSSNNFVKSSDQVINTVHDVRETT 271
           D K+T  T T ++  + +  ++  L + +Q++++I   +N  + + +  I   H   ++ 
Sbjct: 489 DGKDTVATATHIMQQITE--ESGGLLEASQVIQHIASQTN--LLAMNAAIEAAH-AGDSG 543

Query: 272 QTFQEVGQKIDHLLSDFSSKMKS-----KETSAFLENIADSTSNMRSSISAIREITDQRQ 326
           + F  V  +I  L  + S + KS     K  S  +EN+A S   +    + I E++ Q Q
Sbjct: 544 KGFAVVADEIRKLAEESSVQGKSITATLKTLSGEIENLAGSAHTVGEKFNVIFELSGQVQ 603

Query: 327 ------------------KIISTINTIENITSNLNDSSQKFAELMSKINNIS-ALKENNS 367
                             +++  I  I NIT+ + D S   AE++    +++  +++ +S
Sbjct: 604 NMSNRLMEAMQEQKNGSAEVLQAIKEINNITTEVKDGS---AEMLIGGKSVAEEMQKLDS 660

Query: 368 LFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQ 416
           L +    +M+     +E+IN  I  +       ++   N I+NLV++++
Sbjct: 661 LTRVITDSMNEMASGAEQINTAIQEV----NKITEKNKNSIENLVKEVK 705


>gi|188996339|ref|YP_001930590.1| Mammalian cell entry related domain protein [Sulfurihydrogenibium
           sp. YO3AOP1]
 gi|188931406|gb|ACD66036.1| Mammalian cell entry related domain protein [Sulfurihydrogenibium
           sp. YO3AOP1]
          Length = 515

 Score = 47.0 bits (110), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 64/266 (24%), Positives = 113/266 (42%), Gaps = 47/266 (17%)

Query: 51  GLSTDSSVRFNGIPVGRIVGLFLDQEYPNHSLAKAL-IRPDTPLYPSTTATIRTQGLAGI 109
           GLS  + V+  G+  GR+     D  + N  +   L I+ + PLY + T +IRT GL G 
Sbjct: 46  GLSKGADVQVLGVKAGRVE----DIAFENGKVKALLKIKEEIPLYKNATVSIRTYGLMGD 101

Query: 110 TYIELSTLRKEKKTIFQIATERNQRAMITATPSGINY-------FISNAENTSKKISDSS 162
            YI +         + +    +NQ A + +T   IN        F    +N +K + D  
Sbjct: 102 KYIYIDPGSPNAGNLAENQVIQNQ-AKVASTEEMINQVQISAQKFAQLMDNLNKALGDD- 159

Query: 163 RHIQKIIENIEKPLTTT--------------IANIETIST----VLANNISHIDKMMHTT 204
             ++K+IE+ +K  + T              IANI  I+      L + I ++DK +  T
Sbjct: 160 -RLKKLIEDFDKFASNTNDVVVENKEDIRQSIANIRQITADIRQQLPSIIQNLDKTLENT 218

Query: 205 Q--VTPHSSDSKNTFNTITDL-----------ITSLDKMIKAIDLQKVNQILENIQVSSN 251
           +     +  D +     + DL           + S+DK    I+ Q V++  +++++S  
Sbjct: 219 KNITAENREDMRKLIANLKDLSVALKEKAPKTLDSVDKAATQIE-QAVSENRQDLKLSIE 277

Query: 252 NFVKSSDQVINTVHDVRETTQTFQEV 277
           N  K+S  +   +  V E   T  ++
Sbjct: 278 NIRKASQNLNELLAKVNEGKGTLGKL 303


>gi|121603101|ref|YP_980430.1| hypothetical protein Pnap_0184 [Polaromonas naphthalenivorans CJ2]
 gi|120592070|gb|ABM35509.1| Mammalian cell entry related domain protein [Polaromonas
           naphthalenivorans CJ2]
          Length = 310

 Score = 47.0 bits (110), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 39/67 (58%)

Query: 48  SVDGLSTDSSVRFNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLA 107
           ++ GL   + VRF G+PVG++  +  D +   + L +  I    P+  ST AT+ +QG+ 
Sbjct: 45  TISGLQPQAVVRFRGVPVGKVERIGFDDKVKGNVLIRVSIDRAAPMMQSTFATVASQGVT 104

Query: 108 GITYIEL 114
           G+ +I+L
Sbjct: 105 GLGFIQL 111


>gi|308062728|gb|ADO04616.1| ABC transport system substrate binding protein [Helicobacter pylori
           Cuz20]
          Length = 271

 Score = 47.0 bits (110), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 36/189 (19%), Positives = 85/189 (44%), Gaps = 13/189 (6%)

Query: 5   NYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRFNGIP 64
           NY    GLF + ++    F I WL      DG   E ++     + G++T+S + + GI 
Sbjct: 6   NYTLIGGLFFLCLVCMVGF-ILWLGHLGLEDGKYYEYVVYTDKDLGGIATNSPINYKGIQ 64

Query: 65  VGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKEKKTI 124
           VG ++ +   ++         +I+    +   +   + ++G  G+ ++ L     E+   
Sbjct: 65  VGNVIKVGFAKDKVGVVRLDLMIKSSVKIRKDSKVAVSSRGFMGLKFLALEQSHNEE--- 121

Query: 125 FQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKII--ENIEK------PL 176
           F  + ++ +R ++      ++    +A    +++  + +++ KI+  EN+EK       +
Sbjct: 122 FYGSGDKGERILLF-KEGFMDRLSVDANQVMQEVMKAIKNVNKILDDENVEKFKHILVSV 180

Query: 177 TTTIANIET 185
              IAN+++
Sbjct: 181 DDLIANLDS 189


>gi|332178186|gb|AEE13875.1| Mammalian cell entry related domain protein [Thermodesulfobium
           narugense DSM 14796]
          Length = 422

 Score = 47.0 bits (110), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 74/338 (21%), Positives = 133/338 (39%), Gaps = 79/338 (23%)

Query: 10  VGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRFNGIPVGRIV 69
           VG+FV++ L     SI W    + +  PM  ++   P  V GLS D+ V + G+ VGRI 
Sbjct: 9   VGIFVLATLILLAGSILWFQ--SDFLKPMYRIVAYFP-DVSGLSVDAPVYYMGVKVGRIK 65

Query: 70  GLFLDQEYPNHSLAKA-----LIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKEKKTI 124
            +         +L K      LI  D  +   +  +I T GL G  +I ++         
Sbjct: 66  SI-------TPTLYKGVETVILINKDVLIPKGSYFSIGTYGLVGDKFISIT--------- 109

Query: 125 FQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTIANIE 184
                           P  +         T + +SD +  I       E  L  T     
Sbjct: 110 ---------------PPKSL---------TKEYLSDGATVIGTSPPTYEDILNET----- 140

Query: 185 TISTVLANNISHIDKMMHTTQVTPHSSDS-KNTFNTITDLITSLDKMIKAI-DLQ----- 237
              +VL   +S + K +H T + P S +S K T    + + T++D+  + + DL      
Sbjct: 141 ---SVLLVRVSDLTKDLHDTLLNPESKESIKKTLFLASSIATNIDRFTRVLSDLAYKNES 197

Query: 238 KVNQILENIQVSSNNFVKSSDQVINTVHD------VRETTQTFQEVGQKIDHLLSDFSSK 291
            VNQ + N++  S   +  S  +   + D      ++       E  + + +L ++ +  
Sbjct: 198 DVNQTISNLRGFSEYLLAISKNIDKGLSDPELFPSIKSALLNINEASKNVANLAANLNDI 257

Query: 292 MKSKETSAFLENIADSTSNMRSSISAIREITDQRQKII 329
           +K K+T             ++ +IS   EIT++ +K++
Sbjct: 258 VKDKKTK----------EEIKQTISNASEITERSKKVL 285


>gi|16329641|ref|NP_440369.1| hypothetical protein sll1002 [Synechocystis sp. PCC 6803]
 gi|1652124|dbj|BAA17049.1| ycf22 [Synechocystis sp. PCC 6803]
          Length = 456

 Score = 47.0 bits (110), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 23/64 (35%), Positives = 33/64 (51%), Gaps = 2/64 (3%)

Query: 9  SVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRFNGIPVGRI 68
          SVGLF +  LF     + WL R   +  P  EV+++      GL    +VR+ G+PVGR+
Sbjct: 11 SVGLFALLGLFIIGGIVLWL-RGGAFGNPGYEVLVQFD-DASGLQVGGAVRYRGVPVGRV 68

Query: 69 VGLF 72
            L 
Sbjct: 69 AKLI 72


>gi|325915746|ref|ZP_08178048.1| ABC-type transport system involved in resistance to organic
           solvents, periplasmic component [Xanthomonas vesicatoria
           ATCC 35937]
 gi|325538010|gb|EGD09704.1| ABC-type transport system involved in resistance to organic
           solvents, periplasmic component [Xanthomonas vesicatoria
           ATCC 35937]
          Length = 308

 Score = 47.0 bits (110), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 40/147 (27%), Positives = 68/147 (46%), Gaps = 12/147 (8%)

Query: 48  SVDGLSTDSSVRFNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLA 107
           +V GLS  S V++NGI VG I  L L    P   +A   +   TP+   T A +    L 
Sbjct: 47  AVTGLSVGSPVQYNGIAVGSITELTLAPNDPRQVVAHVRVNSTTPIKSDTRAKLAITSLT 106

Query: 108 GITYIELSTLRKEKKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISD--SSRHI 165
           G + I+LS    E  ++  I  +++   +I  TPS +      A    +++ +  S +++
Sbjct: 107 GPSIIQLSGGTPEAPSLTTI--DKSDAPIIQTTPSALQNITDTANRIVERMDEMLSDKNV 164

Query: 166 QKIIENIEKPLTTTIANIETISTVLAN 192
             I        + T+ N+E IS  +A+
Sbjct: 165 ASI--------SATLQNLEKISGGIAD 183


>gi|327439721|dbj|BAK16086.1| methyl-accepting chemotaxis protein [Solibacillus silvestris
           StLB046]
          Length = 492

 Score = 46.6 bits (109), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 41/186 (22%), Positives = 93/186 (50%), Gaps = 15/186 (8%)

Query: 142 SGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTIANIETISTVLANNISHIDKMM 201
           +G NY +        K+   ++  +++ + + + LT+ +  I+  S  LA NI+H+++ +
Sbjct: 151 TGCNYLLYRLTQWGNKLVKDAQEKERVAKELLENLTSVLNKIDEGSIQLAQNITHVNENV 210

Query: 202 HTTQVTPHSSDSKNTFNTITDLITSLDKMIKAI--DLQKVNQILENIQVSSNNFVKSSDQ 259
            T  V   +            ++ S ++M  AI  + + + QI E I +S  N VK+ + 
Sbjct: 211 GTLNVASET------------ILQSSNQMAAAIHNEAEMIQQINEQIILSHENMVKTKES 258

Query: 260 VINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKE-TSAFLENIADSTSNMRSSISAI 318
             +TV D  E  +  +   +++  + +D ++   S + T+  ++N+ +S +N+ + ++ I
Sbjct: 259 SKSTVKDSNEVQEAIERSWKQVHIVTADMATLSDSIDLTTTTIDNMQESLANVNNLLNGI 318

Query: 319 REITDQ 324
           + I DQ
Sbjct: 319 KAIADQ 324


>gi|94498326|ref|ZP_01304885.1| Mammalian cell entry related protein [Sphingomonas sp. SKA58]
 gi|94422206|gb|EAT07248.1| Mammalian cell entry related protein [Sphingomonas sp. SKA58]
          Length = 313

 Score = 46.6 bits (109), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 65/310 (20%), Positives = 121/310 (39%), Gaps = 43/310 (13%)

Query: 1   MESKNYYTSV----GLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDS 56
           ME+++ +  V    GL + +++ F+     WL +S + DG   EV  +   SVDG+   S
Sbjct: 1   METRSNWLKVSLVVGLLIAAVIGFTL----WLIQSREADGATYEVQFKQ--SVDGVQIGS 54

Query: 57  SVRFNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELST 116
            V   G+PVG++  + L    P   + + ++  D  L+   TA+I      G   I L+ 
Sbjct: 55  GVNLLGVPVGKVTQVRLQPSNPGTVMVRFVLTKDILLHRGVTASIDKSFFDGSAEISLAG 114

Query: 117 LRKEK----------------KTIFQIATERNQRAMITATPSGINYFISNAENTSKKISD 160
             K +                KT   ++ + N   MI    SG       AE+ SKK+  
Sbjct: 115 SNKREPALTVQAGQPFPLVPVKTGGLLSGDLNPGEMIAKISSG-------AESISKKLDP 167

Query: 161 SSRHIQKIIENIEKPLTTTIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFN-- 218
           +    Q+ IE     L     + ++ ++ +A  +   D++     V   + D        
Sbjct: 168 AG---QRSIEERLGQLALRSRDWKSDASQIAAEVLQEDRIHSLGNVMARAGDDAERLRLR 224

Query: 219 ---TITDLITSLDKMIKAID--LQKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQT 273
              +   L  SL + +   +   + +   + + +         + Q+  T   VRE  + 
Sbjct: 225 LEASRGGLRDSLGRPLHDAEGKARSLGLSIAHARPRIRQLEGDAQQIAETARSVREPVRR 284

Query: 274 FQEVGQKIDH 283
             +  +KID 
Sbjct: 285 VGDAAKKIDR 294


>gi|311278287|ref|YP_003940518.1| methyl-accepting chemotaxis sensory transducer [Enterobacter
           cloacae SCF1]
 gi|308747482|gb|ADO47234.1| methyl-accepting chemotaxis sensory transducer [Enterobacter
           cloacae SCF1]
          Length = 643

 Score = 46.6 bits (109), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 46/205 (22%), Positives = 96/205 (46%), Gaps = 22/205 (10%)

Query: 170 ENIEKPLTTTIANIETISTVLANNISHIDKMMH-TTQVTPHSSDSKNTFNTITDLITSLD 228
           E     +  T A++E IS  + NN  +  K  H T++    +   +   N + D+IT +D
Sbjct: 422 EEQAAAIVQTAASMEEISVTVKNNADNAHKATHLTSKAADIAGRGEVLVNEVVDVITRID 481

Query: 229 KMIKAIDLQKVNQILENIQVSSN--------NFVKSSDQ---VINTVHDVRETTQTFQEV 277
           +  + I   ++N I++ I   +N           ++ +Q         +VR   Q   + 
Sbjct: 482 ESARKIG--EINSIVDGIAFQTNILALNAAVEAARAGEQGRGFAVVAGEVRNLAQRSADA 539

Query: 278 GQKIDHLLSDFSSKMKSK-----ETSAFLENIADSTSNMRSSISAIREITDQRQKIISTI 332
            ++I  L+ + SS++        ET   ++ I D+ S++R  I+ I +  D++ + I+ +
Sbjct: 540 AKEISQLIGESSSRVSKGVELVHETGGMMKQIIDAVSSVRLVINDIVQALDEQTRGINQV 599

Query: 333 NTIENITSNLNDSSQKFAELMSKIN 357
           +T  N    L+ ++Q+ A L+ +I+
Sbjct: 600 STAVN---QLDSTTQQNASLVQQIS 621


>gi|294338721|emb|CAZ87053.1| putative ABC-type transport system involved in resistance to
           organic solvents, periplasmic component [Thiomonas sp.
           3As]
          Length = 322

 Score = 46.6 bits (109), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 65/291 (22%), Positives = 121/291 (41%), Gaps = 40/291 (13%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           MESK  YT+VGLFVV +        +WL+   +        +I    +V GL TDS+V +
Sbjct: 1   MESKVNYTAVGLFVVLLGALLGGLGWWLATGGKQTA-TRPYLIYATDNVSGLKTDSNVLY 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G+ VG++  + +D + P     K  I    P+   T A +   G+ G++ + L  +   
Sbjct: 60  RGVTVGKVASIEIDPKNPALIRIKVEIDSAVPVRSDTVAQLSPLGVTGLSAVNL--IGGA 117

Query: 121 KKTIFQIATERNQRAMITATPSG-----INYFISNAENTSKKISDSSRHIQKIIENIEKP 175
             T                TP G     I Y  S        I+D++  + +I + ++  
Sbjct: 118 SSTPL-------------PTPPGEPDPVIPYKPSVFTQIEGGINDAAITLARISQRVDAL 164

Query: 176 LTT--------TIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSL 227
           L+         T+ N++T+S  LA N ++I++M          ++++ T   +T +    
Sbjct: 165 LSPANVQSISDTLRNLQTLSASLAANQNNINQMF---------ANARQTSANLTQMSAQG 215

Query: 228 DKMIKAIDLQKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVG 278
             ++  +  Q + + L+ +       +       N+V    +TT  F + G
Sbjct: 216 SALM--LQSQALVKRLDGVSAQLGGSMPQIGAAANSVAQAGDTTTAFTQAG 264


>gi|317011597|gb|ADU85344.1| ABC transport system substrate binding protein [Helicobacter pylori
           SouthAfrica7]
          Length = 271

 Score = 46.2 bits (108), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 38/199 (19%), Positives = 89/199 (44%), Gaps = 13/199 (6%)

Query: 5   NYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRFNGIP 64
           NY    GLF + ++    F I WL      DG   E ++     + G++T+S + + GI 
Sbjct: 6   NYTLIGGLFFLCLVCMVGF-ILWLGHLGLDDGKYYEYVVYTDKDLGGIATNSPINYKGIQ 64

Query: 65  VGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKEKKTI 124
           VG ++ +   ++         +I+    +   +   + ++G  G+ ++ L     E+   
Sbjct: 65  VGNVIKVGFAKDKVGVVRLDLMIKSSVKIRKDSKVAVSSRGFMGLKFLALEQSHNEE--- 121

Query: 125 FQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKII--ENIEK------PL 176
           F  + ++ +R +I      ++    +A    +++  + +++ +I+  +N+EK       +
Sbjct: 122 FYGSGDKGERILIFKEGL-MDRLSGDANQVMQEVMKAIKNVNRILDDQNVEKFKHILASV 180

Query: 177 TTTIANIETISTVLANNIS 195
              IAN+++  T   + IS
Sbjct: 181 DDLIANLDSRKTQFDSLIS 199


>gi|325998311|gb|ADZ50519.1| putative ABC transporter periplasmic substrate-binding protein
           [Helicobacter pylori 2017]
          Length = 271

 Score = 46.2 bits (108), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 38/192 (19%), Positives = 86/192 (44%), Gaps = 13/192 (6%)

Query: 5   NYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRFNGIP 64
           NY    GLF + ++    F I WL      DG   E ++     + G++T+S + + GI 
Sbjct: 6   NYTLIGGLFFLCLVCMVGF-ILWLGPLGFDDGEDYEYVVYTDKDLGGIATNSPINYKGIQ 64

Query: 65  VGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKEKKTI 124
           VG ++ +   ++         +I+    +   +   + ++G  G+ ++ L     E+   
Sbjct: 65  VGNVIKVGFAKDKVGVVRLDLMIKSSVKIRKDSKVAVSSRGFMGLKFLALEQSHNEE--- 121

Query: 125 FQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKII--ENIEK------PL 176
           F  + ++ +R +I      ++    +A    +++  + R++ +I+  EN+EK       +
Sbjct: 122 FYGSGDKGERILIFKEGL-MDRLSGDANQVVQEVMKAIRNVNRILDDENVEKFKHILASV 180

Query: 177 TTTIANIETIST 188
              IAN+++  T
Sbjct: 181 DDLIANLDSRKT 192


>gi|319791001|ref|YP_004152641.1| mammalian cell entry related domain protein [Variovorax paradoxus
           EPS]
 gi|315593464|gb|ADU34530.1| Mammalian cell entry related domain protein [Variovorax paradoxus
           EPS]
          Length = 318

 Score = 46.2 bits (108), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 32/114 (28%), Positives = 56/114 (49%), Gaps = 3/114 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K +  + G FV+ +L      + W +R N     + E+  R   +V GL   + VR+
Sbjct: 1   MENKAHALAAGAFVLGLLAVLVGLVIWFTRDNTVRN-VYELSTR--DAVSGLQPQAMVRY 57

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIEL 114
            GI VG++  +  D +   +   +  +    PL  S+ AT+  QG+ G+ +I L
Sbjct: 58  RGIAVGKVASIDFDPKVKGNVRVRITVDQRVPLTTSSFATLSYQGVTGLAFIAL 111


>gi|256828279|ref|YP_003157007.1| Mammalian cell entry related domain protein [Desulfomicrobium
           baculatum DSM 4028]
 gi|256577455|gb|ACU88591.1| Mammalian cell entry related domain protein [Desulfomicrobium
           baculatum DSM 4028]
          Length = 337

 Score = 46.2 bits (108), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 32/121 (26%), Positives = 57/121 (47%), Gaps = 12/121 (9%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSN-QYDGPMAEVIIRIPGSVDGLSTDSSVR 59
           M S     SVGLF+ + L  +  ++ WL  ++    G +   +     SV GL  DS V+
Sbjct: 1   MASARVNFSVGLFMTAGLALATLAVIWLGMTSFLRKGEL--FVTYFDESVQGLGVDSPVK 58

Query: 60  FNGIPVGRIVGLFLDQEYPNHSLAKALI------RPDTPLYPSTTATIRTQGLAGITYIE 113
           + G+PVGR+  + +    P++ L + +I        D   +  + A I   G+ G  ++E
Sbjct: 59  YRGVPVGRVQAIRI---APDYHLIEVVILIDDEHADDENRFVDSVAAISNVGITGAMFVE 115

Query: 114 L 114
           +
Sbjct: 116 I 116


>gi|325982945|ref|YP_004295347.1| Mammalian cell entry related domain-containing protein
           [Nitrosomonas sp. AL212]
 gi|325532464|gb|ADZ27185.1| Mammalian cell entry related domain protein [Nitrosomonas sp.
           AL212]
          Length = 298

 Score = 45.8 bits (107), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 61/295 (20%), Positives = 132/295 (44%), Gaps = 41/295 (13%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++ +    G+FV+ +         W S ++       + ++    SV GL+  S+V +
Sbjct: 1   MENRAHALIAGIFVILLSISVALVAMWFSGNSTK---RTDYLVVTKESVSGLNPQSAVHY 57

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELS--TLR 118
            G+ +G++  +  D + P+  L +  +  +  L  S  A +  QG+ G+ YI+L+   + 
Sbjct: 58  RGVNIGKVEKIQFDPDNPHQILIQIAVNENVTLRKSVYAQLGYQGVTGLAYIQLNDDGVN 117

Query: 119 KEKKTIFQIATERNQRAMITATPSGINYFISNAENTSKKI-----SDSSRHIQKIIENIE 173
            E  +  +I   R+    +T +   +   +SN      K+       +  HI +I++NI+
Sbjct: 118 NEILSDERIPMRRSLLDEVTGSGQDL---LSNVNKLVLKMHHLLNEQNQNHISQILQNID 174

Query: 174 KPLTTTIANIETISTVLANNISHIDKMMHT-TQVTPHSSDSKNTFNTITDLITSLDKMIK 232
           K       N + I+        H+  ++++ T++T  S            L+  LD+++ 
Sbjct: 175 K----ATKNFDGIA-------GHLQPVLNSFTELTIESG----------TLVKRLDQLLG 213

Query: 233 AIDL--QKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLL 285
            ++L   K NQ  E I    ++  +SS ++  T+ ++R+ + +       +D +L
Sbjct: 214 ELNLTVAKANQK-EGI---FDSLSQSSQELATTIPELRKLSHSLLRNSSNLDKVL 264


>gi|328952597|ref|YP_004369931.1| Mammalian cell entry related domain protein [Desulfobacca
           acetoxidans DSM 11109]
 gi|328452921|gb|AEB08750.1| Mammalian cell entry related domain protein [Desulfobacca
           acetoxidans DSM 11109]
          Length = 328

 Score = 45.8 bits (107), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 26/67 (38%), Positives = 34/67 (50%), Gaps = 3/67 (4%)

Query: 48  SVDGLSTDSSVRFNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLA 107
           SV GL+ +  V   G+ VGRI  + L       +L   L+RP   L     A IRT+G+ 
Sbjct: 51  SVSGLAENGRVEIAGVEVGRIKAIHLSD---GRALVDLLLRPGLDLRQDAQARIRTKGML 107

Query: 108 GITYIEL 114
           G  YIEL
Sbjct: 108 GEKYIEL 114


>gi|46579655|ref|YP_010463.1| hypothetical protein DVU1244 [Desulfovibrio vulgaris str.
           Hildenborough]
 gi|120602862|ref|YP_967262.1| hypothetical protein Dvul_1818 [Desulfovibrio vulgaris DP4]
 gi|46449070|gb|AAS95722.1| conserved hypothetical protein [Desulfovibrio vulgaris str.
           Hildenborough]
 gi|120563091|gb|ABM28835.1| Mammalian cell entry related domain protein [Desulfovibrio vulgaris
           DP4]
 gi|311233453|gb|ADP86307.1| Mammalian cell entry related domain protein [Desulfovibrio vulgaris
           RCH1]
          Length = 148

 Score = 45.8 bits (107), Expect = 0.016,   Method: Composition-based stats.
 Identities = 24/68 (35%), Positives = 37/68 (54%), Gaps = 1/68 (1%)

Query: 48  SVDGLSTDSSVRFNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLA 107
           SV GL   + V   G+PVGR+  + LD+E+P  ++    I     L     A+++T GL 
Sbjct: 47  SVTGLRVGAEVEIAGVPVGRVASITLDREHP-LAVVGLRINEGVKLTDDVIASVKTSGLI 105

Query: 108 GITYIELS 115
           G  Y++LS
Sbjct: 106 GDKYVKLS 113


>gi|302341644|ref|YP_003806173.1| Mammalian cell entry related domain protein [Desulfarculus baarsii
           DSM 2075]
 gi|301638257|gb|ADK83579.1| Mammalian cell entry related domain protein [Desulfarculus baarsii
           DSM 2075]
          Length = 500

 Score = 45.4 bits (106), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 70/336 (20%), Positives = 140/336 (41%), Gaps = 36/336 (10%)

Query: 10  VGLFV-VSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRFNGIPVGRI 68
           VG+FV V+I    + ++       Q   P    +  +  S  GL  ++ V   GI +G++
Sbjct: 10  VGVFVMVAIALLGYMTLRL--GDFQIGEPAGYEVWALFDSASGLKLNAPVEMAGITIGKV 67

Query: 69  VGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKEKKTIFQIA 128
            G+ LDQ     +L    I  D  L     A IRT+G+ G  ++ +     E  +     
Sbjct: 68  AGVSLDQGRARITLR---INEDVHLPADVQALIRTRGVLGDKFVSI-----EGGSPAAPP 119

Query: 129 TERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTIANIETIST 188
            E  QR    + P+ ++  +S     ++ I             I   L  +IA+ E+   
Sbjct: 120 LENGQRLARASVPTDLDQVMSRIGQVAEDIG-----------AITSSLKMSIASPESQRN 168

Query: 189 VLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVNQILENIQV 248
           + A ++S+I ++  T +V    + ++     + ++I +LD   + I  Q  ++    +  
Sbjct: 169 I-AQSLSNIKELTDTLKVVIGDNQAR-----LDNIIANLDNFSENIS-QLSDENRSALTS 221

Query: 249 SSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAFLENIADST 308
           +  NF K+S  +  T+H +        +    I  L+++  +      T A L  ++D  
Sbjct: 222 TIQNFAKASANMEQTMHSLNSVLAKIDDGKGTIGQLVNNDQTVRDLNSTLASLRQVSDKI 281

Query: 309 SNMRSSISAIREITDQRQKIISTINTIENITSNLND 344
           +  + ++   R + D      +TI+ I+   + +ND
Sbjct: 282 NQGKGTLG--RLVNDD-----ATIDKIDQALTGIND 310


>gi|327266246|ref|XP_003217917.1| PREDICTED: laminin subunit beta-1-like [Anolis carolinensis]
          Length = 1827

 Score = 45.4 bits (106), Expect = 0.018,   Method: Composition-based stats.
 Identities = 68/320 (21%), Positives = 131/320 (40%), Gaps = 54/320 (16%)

Query: 155  SKKISDSSRHIQKIIENIEKPLTTTIANIETISTVLANNISHIDKMMHTTQ-----VTPH 209
            S K  D++++I   +E   K L T  + ++ I  +  +  +H  + +   Q     V   
Sbjct: 1472 SAKALDTAQNISLQLETTLKQLGTISSKVQEIQELAQDARNHAQETLGQAQGARSRVEKS 1531

Query: 210  SSDSKNTFNTITDLITSLDKMIKAIDLQKVNQILENI-------QVSS-----NNFVKSS 257
            ++  +     I D +       ++I+L  V Q + NI       Q+SS     ++ +   
Sbjct: 1532 TAKLREFIQKIKDFLAEEGADPESIEL--VAQQVLNISLPGSPGQISSLIKEIHDRIGEL 1589

Query: 258  DQVI----NTVHDVRETTQTFQEVGQ-KIDHLLSDFSSKMKSK-----------ETSAFL 301
            D V     NTVH++    +   E  + K  H+ S F S+ +++           E S   
Sbjct: 1590 DGVDIILNNTVHNLTRARELLAEAEEAKCHHIFSSFMSRERAEGVEAIIAETRAELSGVR 1649

Query: 302  ENIADSTSNMRSSISAIREITD---QRQKIISTINTIEN-ITSNLNDSSQKFAELMSKIN 357
            E ++ +   M+S+  AIR +     Q ++ + T+ + E+ + S L D +Q  A+L  K  
Sbjct: 1650 EQVSAAERAMKSAKEAIRSVEGRIRQAERQLQTLVSKESQVESRLGDLAQDVADLQKKSQ 1709

Query: 358  NISALKEN------------NSLFKDAQRAMHTFRDTSEKINRYIPSIG---NNLQNFSQ 402
                L +               L  D ++ M  ++   +K+      +     NL++ +Q
Sbjct: 1710 ANQQLAQEAKGKAEHATAAAGRLENDVEKVMQGYQKLQDKLGELPQDVLFKLKNLRDEAQ 1769

Query: 403  SGLNDIQNLVRKLQETVNHF 422
            + LN   +  RKL+E    F
Sbjct: 1770 NLLNKANDSKRKLEELEERF 1789


>gi|195952558|ref|YP_002120848.1| Mammalian cell entry related domain protein [Hydrogenobaculum sp.
           Y04AAS1]
 gi|195932170|gb|ACG56870.1| Mammalian cell entry related domain protein [Hydrogenobaculum sp.
           Y04AAS1]
          Length = 305

 Score = 45.4 bits (106), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 60/262 (22%), Positives = 122/262 (46%), Gaps = 25/262 (9%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           +E K  YT +G F+V  +     +IY+ S S   +  +    I    SV GLS  S V++
Sbjct: 2   IEGKPRYTLIGFFIVFGIGVVVATIYF-STSFFKNRNLNTYYIFTKYSVAGLSIGSPVKY 60

Query: 61  NGIPVGRI--VGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLR 118
            G+ VG++  + +  DQE     ++   +  +  L     A++   G+ G++YI+L    
Sbjct: 61  KGVDVGKVNAIKIAKDQETIKIKIS---VERNLDLKKDVIASLGITGITGLSYIDL---- 113

Query: 119 KEKKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTT 178
           + +K +     +  +  +I   PS     +    N   +I  S+ ++ K + N+     T
Sbjct: 114 EHEKGVKAFYDKDLEAYVIPMKPSE----LQQISNYIPQILYSAYNLIKNLNNL-----T 164

Query: 179 TIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQK 238
           +  N +   T L +NI+   K +++        DSKN+ +    ++T+ +K I  +D++ 
Sbjct: 165 SYKNTKKFDT-LFDNINDTIKNLNSL-----IKDSKNSLSNTNKVLTAFNKKINELDVKD 218

Query: 239 VNQILENIQVSSNNFVKSSDQV 260
           +N  +E   + ++N  K + ++
Sbjct: 219 INNTVEKYNLLADNLNKETTKL 240


>gi|218885957|ref|YP_002435278.1| hypothetical protein DvMF_0854 [Desulfovibrio vulgaris str.
           'Miyazaki F']
 gi|218756911|gb|ACL07810.1| Mammalian cell entry related domain protein [Desulfovibrio vulgaris
           str. 'Miyazaki F']
          Length = 148

 Score = 45.4 bits (106), Expect = 0.019,   Method: Composition-based stats.
 Identities = 36/116 (31%), Positives = 56/116 (48%), Gaps = 4/116 (3%)

Query: 1   MESKNYYTSVGLFV-VSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVR 59
           M+  +  TSVG+FV + +L   + +I  L R          V  R   S+ GL   + V 
Sbjct: 1   MKKYSRETSVGIFVLIGLLCVGYLTIK-LGRMELLSDKGYTVHARFT-SITGLRVGAEVE 58

Query: 60  FNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELS 115
             G+PVGR+ G+ L  + P  ++    +R    L     A+++T GL G  YI+LS
Sbjct: 59  IAGVPVGRVAGINLAPDKPV-AVVSLRMREGVHLTDDVIASVKTSGLIGDKYIKLS 113


>gi|237756548|ref|ZP_04585073.1| mce related protein [Sulfurihydrogenibium yellowstonense SS-5]
 gi|237691291|gb|EEP60374.1| mce related protein [Sulfurihydrogenibium yellowstonense SS-5]
          Length = 515

 Score = 45.4 bits (106), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 69/283 (24%), Positives = 122/283 (43%), Gaps = 48/283 (16%)

Query: 51  GLSTDSSVRFNGIPVGRIVGLFLDQEYPNHSLAKAL-IRPDTPLYPSTTATIRTQGLAGI 109
           GLS  + V+  G+  GR+     D  + N  +   L I+ + PLY + T +IRT GL G 
Sbjct: 46  GLSKGADVQVLGVKAGRVE----DISFENGKVKAILKIKKEIPLYKNATVSIRTYGLMGD 101

Query: 110 TYIELSTLRKEKKTIFQIATERNQRAMITATPSGINY-------FISNAENTSKKISDSS 162
            YI ++        + +    +NQ A I +T   IN        F    +N +K   D  
Sbjct: 102 KYIYINPGSPNTGNLAENQVIQNQ-AKIASTEEMINQINVAAQKFAQLMDNLNKATGDD- 159

Query: 163 RHIQKIIENIEKPLTTT--------------IANIETIST----VLANNISHIDKMMHTT 204
             ++K+IE+ +K  + T              IANI  I+      L + I ++DK +  T
Sbjct: 160 -RLKKLIEDFDKFASNTNDVVVENKEDIRQSIANIRQITADIRQQLPSIIQNLDKTLENT 218

Query: 205 Q--VTPHSSDSKNTFNTITDL-----------ITSLDKMIKAIDLQKVNQILENIQVSSN 251
           +     +  D +     + DL           + S+DK    I+ Q V++  +++++S  
Sbjct: 219 KNITAENREDIRKLIANLKDLSIALKEKAPKTLDSVDKAATQIE-QAVSENRQDLKLSIE 277

Query: 252 NFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKS 294
           N  K+S  +   +  V E   T  ++  + D L ++ +  +KS
Sbjct: 278 NIKKASQNLNELLAKVNEGKGTLGKLVNQ-DDLYNNVNEGVKS 319


>gi|328717115|ref|XP_001944333.2| PREDICTED: laminin subunit gamma-1-like isoform 3 [Acyrthosiphon
            pisum]
          Length = 1631

 Score = 45.1 bits (105), Expect = 0.021,   Method: Composition-based stats.
 Identities = 61/323 (18%), Positives = 130/323 (40%), Gaps = 47/323 (14%)

Query: 147  FISNAENTSKKI---SDSSRHIQKIIENIEKPLTTTIANIETISTVLANNISHIDKMMHT 203
            F+++ E   +K+   ++ +RH+     NI +       NI      L   ++++   ++T
Sbjct: 1202 FLASKEEEMEKMRVTAEKARHVSLEAYNITRDAVNQQKNISDELKSLDTEVNYVKDKLNT 1261

Query: 204  TQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN--QILENIQVSSNNFVKSSDQVI 261
              +   +++++     + +   ++ + I AI+L  VN   + ENI    +N    S+Q+ 
Sbjct: 1262 --IITSANEAQELVTMVNNDSLTIYRDIYAINLPDVNVAALKENI----SNLNAESEQIK 1315

Query: 262  NTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKE-TSAFLENIADSTSNMRSSISAIRE 320
            N +          QE    I  L+ D + +++  E T A  E    +  N  +  +A  E
Sbjct: 1316 NDL--------KIQETDLNISKLIKDVADELQQSEITLAQGEQQQRTRENYLAQANASYE 1367

Query: 321  ITDQRQKI--------ISTINTIENITSNLNDSSQKFAELMSKINNISALKE--NNSLFK 370
              DQ  K+          T++T++     + DS +   E + +++ I  L E  N+   +
Sbjct: 1368 KADQAVKLGVKILEEAQQTLSTLQAFDKQVQDSKKNATEALGQVSQIRQLIEEANDKTIR 1427

Query: 371  -----------------DAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVR 413
                              A+ A  T+ D + + +  I   G NL +      ++    ++
Sbjct: 1428 AQQALAGAELSAIHARDTAKEAQQTYADQASEDSNKIKKAGENLASEVHKLFDESMGQIK 1487

Query: 414  KLQETVNHFDDCLNNFERNPQDI 436
            ++  T     D    FE++ + I
Sbjct: 1488 RVGHTAERLKDAEIQFEQDQKSI 1510


>gi|291287313|ref|YP_003504129.1| Mammalian cell entry related domain protein [Denitrovibrio
           acetiphilus DSM 12809]
 gi|290884473|gb|ADD68173.1| Mammalian cell entry related domain protein [Denitrovibrio
           acetiphilus DSM 12809]
          Length = 545

 Score = 45.1 bits (105), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 85/397 (21%), Positives = 166/397 (41%), Gaps = 77/397 (19%)

Query: 10  VGLFVVS-ILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRFNGIPVGRI 68
           VG+FVV  +L  S  S+  +  S  +       +  I     GL+ DS V F+G+ VG+I
Sbjct: 9   VGVFVVGCLLLISAMSLRLVDFS--FSDSAGVKVTTILNDAAGLTKDSPVIFSGVEVGKI 66

Query: 69  VGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKEKKTIFQ-- 126
             + L+      ++A+ LI     L  +    +R++G  G  Y E        + I +  
Sbjct: 67  REIKLENR---KAVAELLINDQYELPANLKVLVRSKGFLGEKYAEFQLDGDIAQGILKDG 123

Query: 127 -IATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTT------- 178
            I T+ N+   I              +  + K+   +  +Q I  ++ + L T       
Sbjct: 124 DILTQGNEGTDI--------------DQLTNKLGGIADDVQAITASLREVLATDQAKANM 169

Query: 179 --TIANI----ETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIK 232
             TI+NI    ++++ ++ NN   ID ++ + +                 L T L ++  
Sbjct: 170 SVTISNIRDITDSVNKLVQNNEQRIDTIIMSMET----------------LTTKLSEITV 213

Query: 233 AIDLQKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKM 292
           A + Q +N I+ NI   + + +K+   +I+   ++R  T++ +  G  I       +S +
Sbjct: 214 A-NTQNINDIMANINAITTD-LKAQTPLIS--ENLRVVTESLKNDGPTI-------ASNV 262

Query: 293 KSKETSAFLENIADSTSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAEL 352
           +S  T    E ++    N++ +I  I E++D   K+  T++ +  IT  +N        L
Sbjct: 263 RSI-TDDVDEVMSSQKENLKKAIENIAEVSD---KLGKTVDNLNEITGKVNSGEGTIGRL 318

Query: 353 MSKINNISALKENNSLFKDAQRAMHTFRDTSEKINRY 389
           ++  + +  L            A+   RDT  KI+++
Sbjct: 319 VNDEDTVDNL----------NGALTGLRDTLGKIDQF 345


>gi|303256381|ref|ZP_07342395.1| putative ABC-type transport system, periplasmic component
           [Burkholderiales bacterium 1_1_47]
 gi|302859872|gb|EFL82949.1| putative ABC-type transport system, periplasmic component
           [Burkholderiales bacterium 1_1_47]
          Length = 331

 Score = 45.1 bits (105), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 83/321 (25%), Positives = 143/321 (44%), Gaps = 41/321 (12%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M  K  Y  +GLFVV+ +  +  +   +        P AE+      S+ GL   + V+F
Sbjct: 1   MGVKTNYFRLGLFVVAAIAAAI-ASILILLGPSLGKPYAEMETYFQFSISGLEVGAPVKF 59

Query: 61  NGIPVGRIVGLFLDQE-YPNHSL-------AKALIRPDTPL-----------YPSTTATI 101
            GI VG++  + L  E YP+ S        A A++R    L           Y +    I
Sbjct: 60  RGIQVGQVQEILLSTEAYPSSSQEILSETKAVAVVRMRMELAGKEVESHLQDYINHGLRI 119

Query: 102 RTQGLAGIT---YIELSTLRKEKKTIFQIATERNQRAM-ITATPSGINYFISNAENTSKK 157
           +TQ LAGIT   Y+ +  L  +K    ++  +   + + I + PS  N  + N +     
Sbjct: 120 QTQ-LAGITGSLYLSVDFLDPKKYPADRVPFDWKPKYLFIPSAPSLSNEIVENVKGFLAS 178

Query: 158 ISDSSRHIQKIIENIEKPLTTTIANIETISTVLANNI--SHIDKMMHTTQVTPHSSDSK- 214
           +   S +I K ++     + + IAN+E I    AN I  S  +K+  +     + +D+K 
Sbjct: 179 L--DSLNINKDLQETVPVIQSLIANLERI----ANGIDPSSFNKLGSSLSNLLNQADNKI 232

Query: 215 NTF--NTITDLITSLDKMIKAIDLQKVNQILENIQVSSN--NFVKSSDQVI-NTVHDVRE 269
           N F  N +  LI  LDK  + I    ++Q  E  Q+ +N  N  ++ +Q++ N  +DV  
Sbjct: 233 NQFDINQLNTLIAQLDKSAEQIG--NLSQKAETKQLVTNLTNLSRNLNQMVSNNGYDVTV 290

Query: 270 TTQTFQEVGQKIDHLLSDFSS 290
           T     ++ Q + +L ++ S 
Sbjct: 291 TLMNLSKIAQNLKNLTNNISG 311


>gi|331001493|ref|ZP_08325111.1| hypothetical protein HMPREF9439_02782 [Parasutterella
           excrementihominis YIT 11859]
 gi|329568222|gb|EGG50039.1| hypothetical protein HMPREF9439_02782 [Parasutterella
           excrementihominis YIT 11859]
          Length = 331

 Score = 45.1 bits (105), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 83/320 (25%), Positives = 143/320 (44%), Gaps = 41/320 (12%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M  K  Y  +GLFVV+ +  +  +   +        P AE+      S+ GL   + V+F
Sbjct: 1   MGVKTNYFRLGLFVVAAIAAAI-ASILILLGPSLGKPYAEMETYFQFSISGLEVGAPVKF 59

Query: 61  NGIPVGRIVGLFLDQE-YPNHSL-------AKALIRPDTPL-----------YPSTTATI 101
            GI VG++  + L  E YP+ S        A A++R    L           Y +    I
Sbjct: 60  RGIQVGQVQEILLSTEAYPSSSQEILSETKAVAVVRMRMELAGKEVESHLQDYINHGLRI 119

Query: 102 RTQGLAGIT---YIELSTLRKEKKTIFQIATERNQRAM-ITATPSGINYFISNAENTSKK 157
           +TQ LAGIT   Y+ +  L  +K    ++  +   + + I + PS  N  + N +     
Sbjct: 120 QTQ-LAGITGSLYLSVDFLDPKKYPADRVPFDWKPKYLFIPSAPSLSNEIVENVKGFLAS 178

Query: 158 ISDSSRHIQKIIENIEKPLTTTIANIETISTVLANNI--SHIDKMMHTTQVTPHSSDSK- 214
           +   S +I K ++     + + IAN+E I    AN I  S  +K+  +     + +D+K 
Sbjct: 179 L--DSLNINKDLQETVPVIQSLIANLERI----ANGIDPSSFNKLGSSLSNLLNQADNKI 232

Query: 215 NTF--NTITDLITSLDKMIKAIDLQKVNQILENIQVSSN--NFVKSSDQVI-NTVHDVRE 269
           N F  N +  LI  LDK  + I    ++Q  E  Q+ +N  N  ++ +Q++ N  +DV  
Sbjct: 233 NQFDINQLNTLIAQLDKSAEQIG--NLSQKAETKQLVTNLTNLSRNLNQMVSNNGYDVTV 290

Query: 270 TTQTFQEVGQKIDHLLSDFS 289
           T     ++ Q + +L ++ S
Sbjct: 291 TLMNLSKIAQNLKNLTNNIS 310


>gi|301629825|ref|XP_002944034.1| PREDICTED: hypothetical protein LOC100485473 [Xenopus (Silurana)
           tropicalis]
          Length = 321

 Score = 44.7 bits (104), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 38/67 (56%)

Query: 48  SVDGLSTDSSVRFNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLA 107
           SV GL   +SVR+ G+ VG+++ +  D     + L +  +  D P+ P+T A +  QG+ 
Sbjct: 45  SVSGLQPQASVRYKGVAVGKVMDIGFDPLVQGNVLIRIAVNADAPIRPTTFAVLGYQGVT 104

Query: 108 GITYIEL 114
           G+ ++ L
Sbjct: 105 GLAHVLL 111


>gi|217031803|ref|ZP_03437306.1| hypothetical protein HPB128_199g11 [Helicobacter pylori B128]
 gi|216946455|gb|EEC25057.1| hypothetical protein HPB128_199g11 [Helicobacter pylori B128]
          Length = 251

 Score = 44.7 bits (104), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 33/172 (19%), Positives = 77/172 (44%), Gaps = 12/172 (6%)

Query: 25  IYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRFNGIPVGRIVGLFLDQEYPNHSLAK 84
           I WL      DG   E ++     + G++T+S V + GI VG ++ +   ++        
Sbjct: 5   ILWLGHLGLDDGKYYEYVVYTDKDLGGIATNSPVNYKGIQVGNVIKVGFAKDKVGVVRLD 64

Query: 85  ALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKEKKTIFQIATERNQRAMITATPSGI 144
            +I+    +   +   + ++G  G+ ++ L     E+   F  + ++ +R +I      +
Sbjct: 65  LMIKSSVKIRKDSKVAVSSRGFMGLKFLALEQSHNEE---FYGSGDKGERILIFKEGL-M 120

Query: 145 NYFISNAENTSKKISDSSRHIQKII--ENIEK------PLTTTIANIETIST 188
           +    +A    +++  + R++ +I+  EN+EK       +   IAN+++  T
Sbjct: 121 DRLSGDANQVVQEVMKAIRNVNRILDDENVEKFKHILASVDDLIANLDSRKT 172


>gi|313241328|emb|CBY33603.1| unnamed protein product [Oikopleura dioica]
          Length = 1964

 Score = 44.7 bits (104), Expect = 0.034,   Method: Composition-based stats.
 Identities = 42/196 (21%), Positives = 86/196 (43%), Gaps = 14/196 (7%)

Query: 233  AIDLQKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKM 292
            A D +K  ++LE          K   ++ N  +D+R    T Q+V  +     ++F ++ 
Sbjct: 868  AEDYKKNKEMLEKETAQREELAKKLGKITNERNDLRAELDTIQDVLDE-----AEFRAEK 922

Query: 293  KSKETSAFLENIADSTSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKF-AE 351
              +      + I++   N   + + + E+ ++R  + +TI  ++N      ++ ++   E
Sbjct: 923  LQEAKLLMEQKISEMKDNFEGNTNLVEEMQEERDSLKNTIEGLQNDLKKAQETVERMKGE 982

Query: 352  LMSKINNISALKENNSLFKDAQRAMHTFRDTS----EKINRYIPSIGNNLQNFSQSGLND 407
                   +++L+E+ S FKD    M+  +D +    E +N  + S+     N S S    
Sbjct: 983  RKQLEKQMASLEEDISEFKDRMTKMNIEKDKNLSEQELVNADLTSLEEKCSNLSLSK--- 1039

Query: 408  IQNLVRKLQETVNHFD 423
             QNL  K+ ET+   D
Sbjct: 1040 -QNLEEKIHETLIKLD 1054


>gi|301763589|ref|XP_002917209.1| PREDICTED: LOW QUALITY PROTEIN: laminin subunit alpha-4-like
           [Ailuropoda melanoleuca]
          Length = 1823

 Score = 44.7 bits (104), Expect = 0.035,   Method: Composition-based stats.
 Identities = 62/294 (21%), Positives = 124/294 (42%), Gaps = 40/294 (13%)

Query: 113 ELSTLRKEKKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENI 172
           +LS L   +  + Q A +  Q     A     N   S+     +K  D+S     + ENI
Sbjct: 574 KLSNLSNLRHDLVQEAVDHAQNLQQEADELSRNLHSSDMNGLVQKALDAS----NVYENI 629

Query: 173 EKPLTTTIANIE---TISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLD- 228
              ++      E    I+  + + +S ID     TQ+  H  +S+N  N   +L    D 
Sbjct: 630 ANYVSEANEMAELALNITDRIYDAVSGID-----TQIIYHKDESENLLNQARELQAKADP 684

Query: 229 -------KMIKAID---------LQKVNQILENIQVSSNNFVKSS-DQVINTVHDVRETT 271
                   M + +D           ++N  ++ +Q +    V+   DQ      +  +TT
Sbjct: 685 GNDEAVADMNRRVDGALARKRALKNRLNDAIKRLQATERGDVQQRLDQSKLITEEASKTT 744

Query: 272 QTFQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNMRSSISAIREITDQRQKIIST 331
              Q     + + L+++S  ++S ++SA+        + + S+  A+R +T+   +++  
Sbjct: 745 VEVQRAAAPMANNLTNWSQNLQSFDSSAY-------NTAVDSARDAVRNLTEVVPQLLDQ 797

Query: 332 INTIENI--TSNLNDSSQKFAELMSKINNISALKENNSLFKDAQRAMHTFRDTS 383
           + T+E     SN++ S Q+  EL+++  ++++ K   S+  D Q A+     TS
Sbjct: 798 LRTVEQKRPASNVSASIQRIRELIAQTRSVAS-KIQVSMMFDGQSAVEVHPKTS 850


>gi|281345029|gb|EFB20613.1| hypothetical protein PANDA_005417 [Ailuropoda melanoleuca]
          Length = 1813

 Score = 44.3 bits (103), Expect = 0.036,   Method: Composition-based stats.
 Identities = 62/294 (21%), Positives = 124/294 (42%), Gaps = 40/294 (13%)

Query: 113 ELSTLRKEKKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENI 172
           +LS L   +  + Q A +  Q     A     N   S+     +K  D+S     + ENI
Sbjct: 564 KLSNLSNLRHDLVQEAVDHAQNLQQEADELSRNLHSSDMNGLVQKALDAS----NVYENI 619

Query: 173 EKPLTTTIANIE---TISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLD- 228
              ++      E    I+  + + +S ID     TQ+  H  +S+N  N   +L    D 
Sbjct: 620 ANYVSEANEMAELALNITDRIYDAVSGID-----TQIIYHKDESENLLNQARELQAKADP 674

Query: 229 -------KMIKAID---------LQKVNQILENIQVSSNNFVKSS-DQVINTVHDVRETT 271
                   M + +D           ++N  ++ +Q +    V+   DQ      +  +TT
Sbjct: 675 GNDEAVADMNRRVDGALARKRALKNRLNDAIKRLQATERGDVQQRLDQSKLITEEASKTT 734

Query: 272 QTFQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNMRSSISAIREITDQRQKIIST 331
              Q     + + L+++S  ++S ++SA+        + + S+  A+R +T+   +++  
Sbjct: 735 VEVQRAAAPMANNLTNWSQNLQSFDSSAY-------NTAVDSARDAVRNLTEVVPQLLDQ 787

Query: 332 INTIENI--TSNLNDSSQKFAELMSKINNISALKENNSLFKDAQRAMHTFRDTS 383
           + T+E     SN++ S Q+  EL+++  ++++ K   S+  D Q A+     TS
Sbjct: 788 LRTVEQKRPASNVSASIQRIRELIAQTRSVAS-KIQVSMMFDGQSAVEVHPKTS 840


>gi|217033905|ref|ZP_03439329.1| hypothetical protein HP9810_870g37 [Helicobacter pylori 98-10]
 gi|216943668|gb|EEC23113.1| hypothetical protein HP9810_870g37 [Helicobacter pylori 98-10]
          Length = 251

 Score = 44.3 bits (103), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 34/167 (20%), Positives = 72/167 (43%), Gaps = 13/167 (7%)

Query: 25  IYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRFNGIPVGRIVGLFLDQEYPNHSLAK 84
           I WL      DG   E ++     + G++T+S V + GI VG ++ +   ++        
Sbjct: 5   ILWLGHLGLDDGKYYEYVVYTDKDLGGIATNSPVNYKGIQVGNVIKVGFAKDKVGVVRLD 64

Query: 85  ALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKEKKTIFQIATERNQRAMITATPSGI 144
            +I+    +   +   + ++GL G+ ++ L     E+   F  + ++ +R +I     G+
Sbjct: 65  LMIKSSVKIRKDSKVAVSSRGLMGLKFLALEQSHNEE---FYGSGDKGERILI--FKEGL 119

Query: 145 NYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTIANIETISTVLA 191
                  +  S   + + + + K I+N+ K L     N+E    +LA
Sbjct: 120 ------MDRLSVDANQAMQEVMKAIKNVNKVLDDE--NVEKFKHILA 158


>gi|292626984|ref|XP_002666501.1| PREDICTED: laminin subunit beta-2 [Danio rerio]
 gi|220675879|emb|CAX12737.1| novel protein similar to vertebrate laminin, beta 2 (laminin S)
            (LAMB2) [Danio rerio]
          Length = 1782

 Score = 44.3 bits (103), Expect = 0.036,   Method: Composition-based stats.
 Identities = 59/275 (21%), Positives = 109/275 (39%), Gaps = 50/275 (18%)

Query: 113  ELSTLRKEKKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENI 172
            EL     + KT  Q A +R Q A+              A +T  K+  S+  ++ +I+ I
Sbjct: 1456 ELFKQVADAKTKAQEAKDRAQAAL------------EKASDTKNKVDHSNNDLRDLIKQI 1503

Query: 173  EKPLTTTIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIK 232
             + L    A+ ++I  V AN +  +       Q+  H +D       I D + SL     
Sbjct: 1504 RQFLMQEGADPDSIEAV-ANRVLELSIPASPKQIR-HLADE------IKDRVKSL----- 1550

Query: 233  AIDLQKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKM 292
                  V+ ILE  Q    N V+ ++Q++      R   +  +   + +   L+D S   
Sbjct: 1551 ----SNVDAILEQTQ----NDVRKAEQLLLDAKKARNKAEGVKNTAESVKKALNDASRAQ 1602

Query: 293  KSKETSAFLENIADSTSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAEL 352
             + E +  ++   +     ++ ++ I+  T   ++             +LND+  +  +L
Sbjct: 1603 AAAEKA--IQKAKNDIGLTQNQLAQIQSETSASER-------------DLNDAVDRLGDL 1647

Query: 353  MSKINNISALKENNSLFKDAQRAMHTFRDTSEKIN 387
              +I  +   + NNSL  DA RA  T     +K N
Sbjct: 1648 ERQIEALKTKRANNSL--DAARAEETATMARDKAN 1680


>gi|114777486|ref|ZP_01452483.1| Mammalian cell entry-related protein [Mariprofundus ferrooxydans
           PV-1]
 gi|114552268|gb|EAU54770.1| Mammalian cell entry-related protein [Mariprofundus ferrooxydans
           PV-1]
          Length = 302

 Score = 44.3 bits (103), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 48/168 (28%), Positives = 75/168 (44%), Gaps = 28/168 (16%)

Query: 5   NYYTSVGLFV-VSILFFSFFS-----IYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSV 58
           N +  +G FV V+++  +F +     I W S    + G + E        + GL   S V
Sbjct: 2   NPHARLGAFVLVALILLAFATGKIGDIVWPS----HQGHIVEAEF---DDLLGLDVQSPV 54

Query: 59  RFNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLR 118
           R  G+ +G +  + L     N +L +  + P   L  ST ATI  +GL G   + L T +
Sbjct: 55  RMAGVKIGVVQQILLKN---NRALVRIALNPGVTLPGSTRATIIGRGLVGEKNLAL-TAK 110

Query: 119 KEKKTIFQIATERNQRAMITATPSG-INYFISNAENTSKKISDSSRHI 165
              KTI        + A+I + P+G IN FI+ A      I+D  R +
Sbjct: 111 AGDKTILP------EGAIIPSDPAGDINTFIAKASG----ITDDVRAL 148


>gi|229494342|ref|ZP_04388105.1| virulence factor Mce family protein [Rhodococcus erythropolis
           SK121]
 gi|229318704|gb|EEN84562.1| virulence factor Mce family protein [Rhodococcus erythropolis
           SK121]
          Length = 351

 Score = 44.3 bits (103), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 63/315 (20%), Positives = 130/315 (41%), Gaps = 38/315 (12%)

Query: 9   SVGLFVVSILFFSFFSI--YWLS-RSNQYDGPMAEVIIRIPGSVDGLSTDSSVRFNGIPV 65
           S+G+FV+ +   +   I   W + R++ Y   +A        +  GLS    V   G+P 
Sbjct: 35  SLGIFVLVVGLGAALGIPKLWYNVRTSAYTAELA--------NASGLSDTDPVYVAGVPA 86

Query: 66  GRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKEKKTIF 125
           GR+  + L     NH +    +  D PL   +TAT+R + + G  Y+E+           
Sbjct: 87  GRVDSIDL---AGNHVVVNFRLDKDQPLGNQSTATVRLKTVLGKRYLEIVP--------A 135

Query: 126 QIATERNQRAMI---TATPSGINYFISNAENTSKKISDSSRH-----IQKIIENIEKPLT 177
            +  + + R +    T  P  ++   S+A   +  +   +       + ++I      + 
Sbjct: 136 GVVDDSDARVIPLSRTTVPYSLDDVSSDATTAATGVDLQAMESMMNTLSQVIPTDSDQVG 195

Query: 178 TTIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQ 237
             +A I   S   A N   ID+++  ++     + ++   ++I     +   +++ + ++
Sbjct: 196 RALAGISGASAAFAQNSEQIDQILIMSRELSDMAAAQT--DSIVGTAANAQTIVRTLAMR 253

Query: 238 K--VNQILENIQV----SSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSK 291
           K  + Q+++N+ +     S  FV   D+      ++ E T T +    +ID LL+   S 
Sbjct: 254 KDALTQLVDNLTIIISKLSTTFVDRQDEFGAMTDNLVEVTTTLKNNADQIDLLLTRLPSA 313

Query: 292 MKSKETSAFLENIAD 306
           ++S   S    N  D
Sbjct: 314 LRSVTDSTGTGNWTD 328


>gi|224083177|ref|XP_002189670.1| PREDICTED: similar to ankyrin repeat and kinase domain containing 1
           [Taeniopygia guttata]
          Length = 1469

 Score = 44.3 bits (103), Expect = 0.046,   Method: Composition-based stats.
 Identities = 47/256 (18%), Positives = 107/256 (41%), Gaps = 15/256 (5%)

Query: 152 ENTSKKISDSSRHIQKI---IENIEKPLTTTIANIETISTVLANNISH-IDKMMHTTQVT 207
           +N S  + D S  ++ I   +ENI  PL      +E IS  L  NISH +++M H+ +  
Sbjct: 170 DNRSHPLEDISHPLEDISYPLENISHPLEDISHPLEDISHPL-ENISHPLEEMFHSQEKV 228

Query: 208 PHSSDSKNTFNTITDLITSLDKMIKAIDLQKVNQILENIQVSSNNFVKSSDQVINTVHDV 267
            H  +    F++  ++   L+K+     L+ ++  LE +     + ++ S  +    H +
Sbjct: 229 SHPVE---MFHSQENVSHPLEKVFYP--LENISHPLEEM----FHALEVSHPLDKVFHPL 279

Query: 268 RETTQTFQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNMRSSISAIREITDQRQK 327
              +   +EV   ++ +          ++ S  LE +  S  N+   +  +    ++   
Sbjct: 280 ENVSHPLEEVSHPLEKMFHALEVSHHLEKVSHPLEEMFHSQENVSHPLEEVSHALEELSH 339

Query: 328 IISTINTIENITSNLNDSSQKFAELMSKINNIS-ALKENNSLFKDAQRAMHTFRDTSEKI 386
            +   + +E ++  L   S     +   +  +S  L+E +   ++    +       E++
Sbjct: 340 TLEVSHPLEKVSHPLEKVSHPLENISHPLEEMSHPLEEVSPALEEVSHPLEDISHPLEEV 399

Query: 387 NRYIPSIGNNLQNFSQ 402
           +  + +I + L+N S 
Sbjct: 400 SHPLENISHPLENISH 415



 Score = 43.5 bits (101), Expect = 0.065,   Method: Composition-based stats.
 Identities = 53/244 (21%), Positives = 103/244 (42%), Gaps = 37/244 (15%)

Query: 144 INYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTIANIETISTVLA------------ 191
           I+Y + N  +  + IS     I   +ENI  PL     + E +S  +             
Sbjct: 186 ISYPLENISHPLEDISHPLEDISHPLENISHPLEEMFHSQEKVSHPVEMFHSQENVSHPL 245

Query: 192 -------NNISH-IDKMMHTTQVTPHSSDS-----KNTFNTITDLITSLDKMIKAID--- 235
                   NISH +++M H  +V+ H  D      +N  + + ++   L+KM  A++   
Sbjct: 246 EKVFYPLENISHPLEEMFHALEVS-HPLDKVFHPLENVSHPLEEVSHPLEKMFHALEVSH 304

Query: 236 -LQKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKS 294
            L+KV+  LE +  S  N     ++V + + ++  T +    + +K+ H L   S  +++
Sbjct: 305 HLEKVSHPLEEMFHSQENVSHPLEEVSHALEELSHTLEVSHPL-EKVSHPLEKVSHPLEN 363

Query: 295 -----KETSAFLENIADSTSNMRSSISAIREITDQRQKIISTIN-TIENITSNLNDSSQK 348
                +E S  LE ++ +   +   +  I    ++    +  I+  +ENI+  L   SQ 
Sbjct: 364 ISHPLEEMSHPLEEVSPALEEVSHPLEDISHPLEEVSHPLENISHPLENISHPLEKVSQP 423

Query: 349 FAEL 352
             E+
Sbjct: 424 LEEV 427


>gi|253701626|ref|YP_003022815.1| exodeoxyribonuclease VII large subunit [Geobacter sp. M21]
 gi|259646293|sp|C6E2U7|EX7L_GEOSM RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|251776476|gb|ACT19057.1| exodeoxyribonuclease VII, large subunit [Geobacter sp. M21]
          Length = 458

 Score = 43.9 bits (102), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 53/264 (20%), Positives = 115/264 (43%), Gaps = 25/264 (9%)

Query: 141 PSGIN----YFISNAENTSKKISDSSRH---IQKIIENIEKPLTTTIANIETISTVLANN 193
           P GI      FI   E  +K+   S  H   I K+   I    + T A I  I TVL   
Sbjct: 104 PQGIGGLQMAFIQLKEKLAKEGLFSELHKIEIPKLPRRIGIVTSPTGAAIRDILTVLNRR 163

Query: 194 ISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVNQILENIQVSSNNF 253
            ++++ +     ++P     +     I D I  L++ +  ID+  V +   +++   + +
Sbjct: 164 FTNVELL-----ISPVRVQGEGAAREIADAIDDLNR-VGNIDVMIVGRGGGSLE---DLW 214

Query: 254 VKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNMRS 313
             + + V   +H  R        VG +ID  ++DF + +++   SA  E +  S   + +
Sbjct: 215 AFNEEVVARAIH--RSKVPVISAVGHEIDFTIADFVADLRAATPSAAAELVVASKKELTA 272

Query: 314 SISAI--REITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNISA--LKENNSLF 369
            + A+  R    Q++++  +   +  ++  + D S+    L  +++++ A  ++E   + 
Sbjct: 273 EVEALSHRLHVSQQRRLERSRALVTALSRAITDPSRVLGHLAQRVDSLDARLVREAGLIL 332

Query: 370 KDAQRAMHTFRDTSEKINRYIPSI 393
            DA   + T    + +++R  P++
Sbjct: 333 DDASERIVTL---TARLSRQTPAL 353


>gi|302339869|ref|YP_003805075.1| methyl-accepting chemotaxis sensory transducer [Spirochaeta
           smaragdinae DSM 11293]
 gi|301637054|gb|ADK82481.1| methyl-accepting chemotaxis sensory transducer [Spirochaeta
           smaragdinae DSM 11293]
          Length = 723

 Score = 43.9 bits (102), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 60/279 (21%), Positives = 123/279 (44%), Gaps = 42/279 (15%)

Query: 105 GLAGITYIELSTLRKEKKTIFQ-IATERNQRAMITATPSGINYFISNAENTSKKISDSSR 163
           GL G+   + S +++    + + I+  +N   + T   +  +  +  AE +S+ + ++  
Sbjct: 449 GLTGLAGTQSSAVQQSTAAVEEMISALKNTAKITTRQKTMADNLMKGAEESSEVLEEAYN 508

Query: 164 HIQKIIENIEK--PLTTTIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTIT 221
            I K+  NI+    +T+ I +I + + +LA         M+      H+ +S   F  + 
Sbjct: 509 SIVKVNTNIDSIMEMTSVIDDISSQTNLLA---------MNAAIEAAHAGESGKGFAVVA 559

Query: 222 DLITSLDKMIKA----IDLQKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEV 277
           D I  L +        I L+ V  I+E IQ+S++NF      +   V +++ T   F E+
Sbjct: 560 DEIRKLAEHSSTSSSRITLE-VKTIIEQIQLSAHNFDSLKQSIDEIVKEIKSTADAFSEI 618

Query: 278 GQKI-------DHLLSDFSSKMKSKETSAFLENIADSTSNMRSSIS-------------- 316
                      D +L   +S     +TS  L   A++  N  +++S              
Sbjct: 619 NTSTVEMSSGSDQILQAMASL---SDTSVELTEAAENMQNQTTTVSEDIKSVLQLTQSSN 675

Query: 317 -AIREITDQRQKIISTINTIENITSNLNDSSQKFAELMS 354
            A+ EI+   ++I++ +N I +   NL +++Q+ +E +S
Sbjct: 676 LAVEEISVGSREILTAMNNITDDVQNLGETTQELSERVS 714


>gi|324999490|ref|ZP_08120602.1| Mammalian cell entry related domain protein [Pseudonocardia sp. P1]
          Length = 438

 Score = 43.9 bits (102), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 64/337 (18%), Positives = 134/337 (39%), Gaps = 62/337 (18%)

Query: 51  GLSTDSS--VRFNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAG 108
           GL+ DSS  VR  G+PVG +VG   DQ                       AT+R     G
Sbjct: 53  GLNVDSSQEVRIAGVPVGEVVGAEADQ--------------------GDDATLRISIDPG 92

Query: 109 ITYIELSTLRKEKKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQ-- 166
               E + L    KT   +         +   P G    +  AEN +  +S ++R+IQ  
Sbjct: 93  HQVFENARLEYRTKTPLNV-------PYLALVPGGPPAALL-AENATVPVSQTTRNIQPY 144

Query: 167 ----KIIENIEKPLTTTIANIETISTVLANNISHIDKMMHTTQVT-----PHSSDSKNTF 217
               ++ E+ ++ LT+ +   +   T LA+  + +   +  T  T     P     +   
Sbjct: 145 EILNELDEHTQESLTSLLNESD---TALADAPAQLPGGLRATDATVATLQPVMESLQQRR 201

Query: 218 NTITDLITSLDKMIKAI--DLQKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQ 275
             I  L+TSL ++  A   D Q++ +++ ++Q + +       ++ +++  +  TT T +
Sbjct: 202 ELIQKLVTSLSRISTAAGRDDQRLTRLVASLQETLSVLGARDRELTDSLGKLPGTTGTLR 261

Query: 276 EVGQKIDHLLSDFSSKMK-----SKETSAFLENIADSTSNMRSSISAIREITDQRQKIIS 330
           E       L ++    ++     S E    +  + D+       +   R +  + + +++
Sbjct: 262 EALASTSDLTTELDPVLESLDQASGELPDTVRRVTDTVRKAGPVVDTARPVVAKARPVVA 321

Query: 331 -----------TINTIENITSNLNDSSQKFAELMSKI 356
                       ++ ++ +T +L D++++ A  M  +
Sbjct: 322 DLRPLVGDARVALDDLKPVTGHLPDATERLAPWMPNL 358


>gi|194332619|ref|NP_001123798.1| hypothetical protein LOC100170549 [Xenopus (Silurana) tropicalis]
 gi|189441913|gb|AAI67592.1| LOC100170549 protein [Xenopus (Silurana) tropicalis]
          Length = 1853

 Score = 43.9 bits (102), Expect = 0.055,   Method: Composition-based stats.
 Identities = 55/294 (18%), Positives = 130/294 (44%), Gaps = 33/294 (11%)

Query: 148  ISNAENTSKKISDSSRHIQKIIENIEKPLTTTIANIETISTVLAN--NIS------HIDK 199
            ++NA+ + ++I DS+  +++ I+ I+  LT   A+ E+I  V     NIS       I+ 
Sbjct: 1552 LANAKESKRRIEDSTEKLREFIKKIKDFLTEEGADPESIELVARQVLNISLPASPGDIEA 1611

Query: 200  MMHTTQ--VTPHSSDSKNTFNTITDLITSLDKMIKAIDLQ-KVNQILENIQVSSNNFVKS 256
            +++  +  +   S   +   NT   L T+ +   +A++ Q K   +  NI  +     ++
Sbjct: 1612 LVNKIKESIGNLSCTDEILTNTSEILATAKNLHKEAVEAQAKAEAVSANISDAQALLQEA 1671

Query: 257  SDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSS-KMKSKETSAFLENIADSTSNMRSSI 315
              +  +    +++  Q+ ++V  K++  +   +  + K  +    + N+++   ++    
Sbjct: 1672 EAKAKSAEKALKKAKQSIKDVKSKVEQTMQTLTGVEQKEMDIMERIGNLSEKVDDLLDKT 1731

Query: 316  SAIREI-TDQRQKIISTINTIENITSNLNDSSQKFAELMSKI-----------NNISALK 363
             + R+I +D +++    +N+   +   ++D  +K+ +L  K+           + I  +K
Sbjct: 1732 ESNRQIASDAKERANLVLNSTGELRKEMDDVQRKYDDLKEKVGGYNSSSGTALDRIEKIK 1791

Query: 364  EN--------NSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQ 409
            E         N+  K+  +    FR     +   I +I   L+N +   LNDI+
Sbjct: 1792 EEAKALYDKANTAKKELAKLEAQFRANEANMTAKILTI-EQLENQTTQLLNDIR 1844


>gi|53802515|ref|YP_112709.1| Mce family protein [Methylococcus capsulatus str. Bath]
 gi|53756276|gb|AAU90567.1| Mce family protein [Methylococcus capsulatus str. Bath]
          Length = 304

 Score = 43.9 bits (102), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 64/318 (20%), Positives = 121/318 (38%), Gaps = 53/318 (16%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M  + Y    GLFVV IL  +   I  +     Y       ++   G+V GL+ +S V F
Sbjct: 1   MVRETYALLTGLFVV-ILGSALIGIALVL--GDYGTERDVYVVSTQGAVSGLNPESLVIF 57

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G+  G++  +      P   L +  +    P+   T AT+R Q L G+  I+LS    E
Sbjct: 58  RGVRAGKVASISFAPHDPRTILVRIEVDKGLPITRGTYATLRVQPLTGLAQIDLS---DE 114

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
                 + T+    A I   PS ++    +  +   +I+  +  +  ++++  +      
Sbjct: 115 GNDPEPLRTDPRNPANIPLRPSLLDKLTGSGSDILTQIAQLTSRLNALLDDGNR------ 168

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
                             ++ HT +          + +T  D +  L++ I+        
Sbjct: 169 -----------------QRIAHTLE----------SLDTAADELVRLERYIE-------- 193

Query: 241 QILENIQVSSNNFVKSSDQVINTVHDVRETT---QTFQEVGQK---IDHLLSDFSSKMKS 294
           + LE I +      ++         DVRET+   +   E  QK   I    SD   + + 
Sbjct: 194 EGLERIPILDGRLRQALADHSAMARDVRETSRQVRALSESAQKVVDIGAAASDTLIRSRL 253

Query: 295 KETSAFLENIADSTSNMR 312
            E  A +++ A + +++R
Sbjct: 254 PELDALIDDAAHTAASLR 271


>gi|226304397|ref|YP_002764355.1| Mce family protein [Rhodococcus erythropolis PR4]
 gi|226183512|dbj|BAH31616.1| putative Mce family protein [Rhodococcus erythropolis PR4]
          Length = 338

 Score = 43.9 bits (102), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 65/317 (20%), Positives = 130/317 (41%), Gaps = 42/317 (13%)

Query: 9   SVGLFVVSILFFSFFSI--YWLS-RSNQYDGPMAEVIIRIPGSVDGLSTDSSVRFNGIPV 65
           S+G+FV+ +   +   I   W + R++ Y   +A        +  GLS    V   G+P 
Sbjct: 22  SLGIFVLVVGLGAALGIPKLWYNVRTSAYTAELA--------NASGLSDTDPVYVAGVPA 73

Query: 66  GRI--VGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKEKKT 123
           GR+  + L  D    N  L K     D PL   +TAT+R + + G  Y+E+         
Sbjct: 74  GRVDSIDLAGDHVVVNFRLDK-----DQPLGNQSTATVRLKTVLGKRYLEI--------V 120

Query: 124 IFQIATERNQRAMI---TATPSGINYFISNAENTSKKISDSSRH-----IQKIIENIEKP 175
              +  + + R +    T  P  ++   S+A   +  +   +       + ++I      
Sbjct: 121 PAGVVDDSDARVIPLSRTTVPYSLDDVSSDATTAATGVDLQAMESMMNTLSEVIPTDSDQ 180

Query: 176 LTTTIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAID 235
           +   +A I   S   A N   ID+++  ++     + ++   ++I     +   +++ + 
Sbjct: 181 VGRALAGISGASAAFAQNSEQIDQILIMSRELSDMAAAQT--DSIVGTAANAQTIVRTLA 238

Query: 236 LQK--VNQILENIQV----SSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFS 289
           ++K  + Q+++N+ +     S  FV   D+      ++ E T T +    +ID LL+   
Sbjct: 239 MRKDALTQLVDNLTIIISKLSTTFVDRQDEFGAMTDNLVEVTTTLKNNADQIDLLLTRLP 298

Query: 290 SKMKSKETSAFLENIAD 306
           S ++S   S    N  D
Sbjct: 299 SALRSVTDSTGTGNWTD 315


>gi|298530714|ref|ZP_07018116.1| Mammalian cell entry related domain protein [Desulfonatronospira
           thiodismutans ASO3-1]
 gi|298510088|gb|EFI33992.1| Mammalian cell entry related domain protein [Desulfonatronospira
           thiodismutans ASO3-1]
          Length = 505

 Score = 43.9 bits (102), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 59/288 (20%), Positives = 118/288 (40%), Gaps = 28/288 (9%)

Query: 49  VDGLSTDSSVRFNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAG 108
           V GL T+S V   GI VG +  + L   + N +     IRPD  ++  + ATIRT+G+ G
Sbjct: 49  VTGLRTNSPVEIAGIDVGTVKDITL---HENRARVTMAIRPDIDVHADSQATIRTRGVLG 105

Query: 109 ITYIELSTLRKEKKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKI 168
             ++E++     + T+     E          P+ ++  ++   + +  IS+ SR +  +
Sbjct: 106 DKFVEVNPGSATEPTL-----EDGGVVSRGVQPTDLDQVMARIGDIADDISEVSRSVSNV 160

Query: 169 IENIEKPLTTTIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLD 228
               E        ++      L     H+++++ T                I  ++ +L 
Sbjct: 161 FGGPEGE-----QDMREFFDNLREAAVHMNQIVQTNA------------RGIEKIVANLQ 203

Query: 229 KMIKAIDLQKVNQI-LENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSD 287
               + DL+ +++   E I    +NF ++S Q+  ++  + E   T Q     +  LL D
Sbjct: 204 DF--SGDLKTISETNKEGITHIVDNFSQASSQLNVSLEQLGEIMDTAQHGEGPVATLLED 261

Query: 288 FSSKMKSKETSAFLENIADSTSNMRSSISAIREITDQRQKIISTINTI 335
                  + T+A LE++         ++  +    D  +KI   ++ I
Sbjct: 262 RQMSEDMRRTAASLESLTRKLDEGEGTLGKLISEDDTGRKIDDALDGI 309


>gi|220903811|ref|YP_002479123.1| Mammalian cell entry related domain protein [Desulfovibrio
           desulfuricans subsp. desulfuricans str. ATCC 27774]
 gi|219868110|gb|ACL48445.1| Mammalian cell entry related domain protein [Desulfovibrio
           desulfuricans subsp. desulfuricans str. ATCC 27774]
          Length = 150

 Score = 43.5 bits (101), Expect = 0.066,   Method: Composition-based stats.
 Identities = 32/110 (29%), Positives = 56/110 (50%), Gaps = 4/110 (3%)

Query: 8   TSVGLFV-VSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRFNGIPVG 66
           T+VGLFV + +L  ++ +I  L +         E+      SV GL   + V  +G+PVG
Sbjct: 7   TAVGLFVLIGLLCVAYLTIK-LGKMEVLSNKGYELTANF-DSVSGLRVGADVEMSGVPVG 64

Query: 67  RIVGLFLDQE-YPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELS 115
           +++ + LD +   N ++ +  +  D  L   + A+I T GL G  Y+ +S
Sbjct: 65  KVISISLDPDPMRNQAVVRLRLDKDLHLSDDSIASILTSGLIGDKYVSIS 114


>gi|242277491|ref|YP_002989620.1| mammalian cell entry related domain protein [Desulfovibrio
           salexigens DSM 2638]
 gi|242120385|gb|ACS78081.1| Mammalian cell entry related domain protein [Desulfovibrio
           salexigens DSM 2638]
          Length = 320

 Score = 43.5 bits (101), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 33/107 (30%), Positives = 52/107 (48%), Gaps = 13/107 (12%)

Query: 8   TSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRFNGIPVGR 67
           T +GLF+V +     FS Y     +QY     +++ R   +V  L+    V++ G+ VG+
Sbjct: 24  TVLGLFIVFLGGHDIFSDY-----SQY-----KILFR---NVKDLTPGRPVKYAGLSVGK 70

Query: 68  IVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIEL 114
           +  + +D E P        +  D PLY  TTA +  +GL G  YI L
Sbjct: 71  VDSINVDAENPGRISVIINVDHDFPLYRGTTAMVTQKGLVGDNYILL 117


>gi|91084119|ref|XP_969552.1| PREDICTED: similar to laminin alpha-1, 2 chain [Tribolium castaneum]
 gi|270008021|gb|EFA04469.1| hypothetical protein TcasGA2_TC014773 [Tribolium castaneum]
          Length = 3160

 Score = 43.5 bits (101), Expect = 0.070,   Method: Composition-based stats.
 Identities = 45/235 (19%), Positives = 105/235 (44%), Gaps = 27/235 (11%)

Query: 211  SDSKNTFNTITDLITSLDKMIKAIDLQKVNQILENIQVS---SNNFVKSSDQVINTVHDV 267
            +D  N ++   D + +  K+I   ++ ++ + +E I  +    N  +    ++IN +   
Sbjct: 1765 NDRHNIYSYQFDNLETARKLINEANIPEMEKRVEKINQNLPKRNEILSEQTKIINEMSQE 1824

Query: 268  RET-TQTFQEVGQKIDHLLSDFSSKMKS--------KETSAFLENIADSTSNMRSSISAI 318
             +T ++T QE+  +++ L+ + +   KS        +E    L+ I D  +   + +   
Sbjct: 1825 AQTLSKTVQELDDRVNTLIENVNGFGKSQVDVNEALREAKEILDEITDIAN--EAPLFQY 1882

Query: 319  REITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNISALKENNSLFKDAQRAMHT 378
             ++  + QK++  +N I     N ++  +K AEL  ++  +  L +N       +R    
Sbjct: 1883 DDVFKKCQKLLDDVNQIYANEINTSEVEKKLAELRHRLTKLRKLLDN------TERTNQL 1936

Query: 379  FRDTSEKINRYIPSIGNNLQNFSQSGL---NDIQNLVRKLQETVNHFDDCLNNFE 430
             +  +E+  + I  + + L+  +        DI++ +RK+  T    +D LN+ E
Sbjct: 1937 AQTKNEQNRKRIRDVQDTLERINAHNYIVTRDIEDALRKINAT----NDLLNDLE 1987



 Score = 40.0 bits (92), Expect = 0.71,   Method: Composition-based stats.
 Identities = 64/312 (20%), Positives = 136/312 (43%), Gaps = 41/312 (13%)

Query: 144  INYFISNAENTS---KKISDSSRH----IQKIIENIEK----PLTTTIANIETISTVLAN 192
            +N   +N  NTS   KK+++  RH    ++K+++N E+      T    N + I  V  +
Sbjct: 1896 VNQIYANEINTSEVEKKLAEL-RHRLTKLRKLLDNTERTNQLAQTKNEQNRKRIRDV-QD 1953

Query: 193  NISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLD---KMIKAIDLQKVNQILENIQVS 249
             +  I+   H   VT    D+    N   DL+  L+   +++   DL+   + LEN ++ 
Sbjct: 1954 TLERINA--HNYIVTRDIEDALRKINATNDLLNDLETIYQLLAKTDLENATKDLENDEL- 2010

Query: 250  SNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSK-ETSAFLENIADST 308
                    D++ +T+  VR+  +  Q+   K    + +F+S+  +K   SA  +NI    
Sbjct: 2011 --------DELYDTLSSVRDHVRKLQD-KVKFYKTVFNFTSEEWTKINASASYDNIVKGI 2061

Query: 309  SNMRSSISAIREITDQRQKII-----STINTIENITSNLNDSSQKFAELMSKINNISALK 363
               R      R+IT +  + +      ++N   N+    +D  QK   +++  N      
Sbjct: 2062 EEARREAKEARDITLKALEKLYPPGDDSLNDKTNLAKAFSDRIQK--RILNLKNLSDEFA 2119

Query: 364  ENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFD 423
            + + L +D +R +      + ++N ++  I  +++N S     D+ + ++K +    +  
Sbjct: 2120 KTSELLEDLKRDILFNGKNNNELNAFLRDIQKDIRNQS-----DVISKLKKSKNDARNVS 2174

Query: 424  DCLNNFERNPQD 435
              + + E+  +D
Sbjct: 2175 SMIASIEQRVKD 2186


>gi|313672873|ref|YP_004050984.1| mammalian cell entry related domain protein [Calditerrivibrio
           nitroreducens DSM 19672]
 gi|312939629|gb|ADR18821.1| Mammalian cell entry related domain protein [Calditerrivibrio
           nitroreducens DSM 19672]
          Length = 526

 Score = 43.5 bits (101), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 67/314 (21%), Positives = 132/314 (42%), Gaps = 44/314 (14%)

Query: 51  GLSTDSSVRFNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGIT 110
           GL+TD+ V+F G+ VG++  + L+       +A+ LI     +       +R+ G  G  
Sbjct: 49  GLNTDAPVKFKGVNVGKVKNISLED---GKVVAEMLIEDKYKIPAKVRVIVRSSGFLGEK 105

Query: 111 YIELSTLRKEKKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIE 170
           Y EL  L +      Q        +++  T       +++ +    K+ D +  I+ I  
Sbjct: 106 YAELEELPE------QTGEYLAAGSIVKDTKD-----VTDFDQLGNKLGDIADDIKAITS 154

Query: 171 NIEKPLTTTIANIETISTVLANNISHIDKMMHTTQVTPH-SSDSKNTFNTITDLITSLDK 229
           ++   L TT    E +   L       D +  TT V  +  + ++   N +   I ++  
Sbjct: 155 SLRDVLATTEGK-ENMKVTL-------DNIRQTTDVLKNIMAYNEARINAVIKNIEAITV 206

Query: 230 MIK--AIDLQK-VNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLS 286
           ++K  A D Q+ +NQ+L N++  S    + + Q+   V+ +             ID L++
Sbjct: 207 VVKNMATDNQENINQLLANLKDVSQTLKEQTPQIAGKVNSIT----------GNIDDLVT 256

Query: 287 DFSSKMKSKETSAFLENIADSTSNMRSSISAIREITDQRQKIISTINTIEN---ITSNLN 343
                ++       ++NI   T+ +  ++  I  ITD+  K   TI  + N      NLN
Sbjct: 257 GSKGNLEDS-----IKNIKTVTAKLEKTVDNINSITDKINKGEGTIGKLINDNQTVDNLN 311

Query: 344 DSSQKFAELMSKIN 357
           ++ +    L +K++
Sbjct: 312 ETLKGVRNLFTKMD 325


>gi|300854350|ref|YP_003779334.1| putative C4-dicarboxylate transporter protein/chemotaxis
           domain-containing protein [Clostridium ljungdahlii DSM
           13528]
 gi|300434465|gb|ADK14232.1| putative C4-dicarboxylate transport system protein with a
           chemotaxis protein domain [Clostridium ljungdahlii DSM
           13528]
          Length = 720

 Score = 43.5 bits (101), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 78/320 (24%), Positives = 143/320 (44%), Gaps = 56/320 (17%)

Query: 151 AENT---SKKISDSSRHIQKIIENIEKPLTTTIANIETISTVLANNISHIDKMMHTTQVT 207
           AENT   SKK+ +S+R++ +  +  +  +  +++ I  IS+V  NN          T++ 
Sbjct: 166 AENTAEESKKVLESTRNVLQSAKEGQMLIEKSVSVINDISSVTDNN----------TKLG 215

Query: 208 PHSSDSKNTFNTITDLITSLDKMIKAIDLQKVNQILENIQVSSNNFVKSSDQVINTVHDV 267
                     + I DLI S+       +L  +N  +E  +   +   K    V   V  +
Sbjct: 216 NELKGKSTEVSGIVDLINSISDQ---TNLLALNAAIEAARAGEHG--KGFAVVAEEVRQL 270

Query: 268 -RETTQTFQEVGQKIDHLLSDFSSKMK-----SKETSAFLENIADSTSNMRSSISAIREI 321
             ++ Q  + + + I+ +L D S  +K     SK T + ++ I  +  N  S IS+I + 
Sbjct: 271 SNQSQQAAKRINKIIEGMLLDTSQVVKAFEIMSKSTVSGVDTINKAKCNFESIISSIEKS 330

Query: 322 TDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNISALKENNSLFKDAQRAMHTFRD 381
            ++ Q+++          ++ N+ S+   +LMS ++N++A+ E +S       +  T  +
Sbjct: 331 REKLQQVV----------THANNQSKATNDLMSTVHNVAAIAEESS------ASTQTVSE 374

Query: 382 TSEKINRYIPSIGNNLQNFSQSGLNDIQNL-------VRKLQ---ETVNHFDDCLNNFER 431
            SE+I++ + SI  N +  S    N  Q L       VR L+   E  N+   C    ER
Sbjct: 375 NSEQISKSVASIAGNAKKLSNMAGNLEQALFKFKFSNVRTLRVGFEMTNN-SICYAGMER 433

Query: 432 NPQDI---VWGREKGSVKIY 448
             Q++     GR K  +KIY
Sbjct: 434 FGQELEKHTNGRYK--LKIY 451


>gi|197117643|ref|YP_002138070.1| exodeoxyribonuclease VII large subunit [Geobacter bemidjiensis Bem]
 gi|226736762|sp|B5EI10|EX7L_GEOBB RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|197087003|gb|ACH38274.1| exodeoxyribonuclease VII, large subunit [Geobacter bemidjiensis
           Bem]
          Length = 458

 Score = 43.1 bits (100), Expect = 0.085,   Method: Compositional matrix adjust.
 Identities = 55/266 (20%), Positives = 116/266 (43%), Gaps = 29/266 (10%)

Query: 141 PSGIN----YFISNAENTSKKISDSSRH---IQKIIENIEKPLTTTIANIETISTVLANN 193
           P GI      FI   E  +K+   S  H   I K+   I    + T A I  I TVL   
Sbjct: 104 PQGIGGLQMAFIQLKEKLAKEGLFSELHKREIPKLPRRIGVVTSPTGAAIRDILTVLNRR 163

Query: 194 ISHIDKMMHTTQVTPHSSDSKNTFNTITDL--ITSLDKMIKAIDLQKVNQILENIQVSSN 251
            ++++ ++   +V    + ++   + I DL  + +LD MI    + +    LE++     
Sbjct: 164 FTNVELLISPVRVQGDGA-AREIADAIDDLNRVGNLDVMI----VGRGGGSLEDL----- 213

Query: 252 NFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNM 311
            +  + + V   +H  R        VG +ID  ++DF + +++   SA  E +  S   +
Sbjct: 214 -WAFNEEVVARAIH--RSKVPVISAVGHEIDFTIADFVADLRAATPSAAAEIVVASKKEL 270

Query: 312 RSSISAI--REITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNISA--LKENNS 367
            + + A+  R    Q++++  +   +  ++  + D S+    L  +++++ A   +E   
Sbjct: 271 TAEVEALTHRLHVSQQRRLERSRALVTALSRAITDPSRFLGHLAQRVDSLDARLTREAGL 330

Query: 368 LFKDAQRAMHTFRDTSEKINRYIPSI 393
           +  DA   + T    + +++R  P++
Sbjct: 331 ILDDASERIVTL---TARLSRQTPAL 353


>gi|261416605|ref|YP_003250288.1| Mammalian cell entry related domain protein [Fibrobacter
           succinogenes subsp. succinogenes S85]
 gi|261373061|gb|ACX75806.1| Mammalian cell entry related domain protein [Fibrobacter
           succinogenes subsp. succinogenes S85]
 gi|302326064|gb|ADL25265.1| Mce-like protein [Fibrobacter succinogenes subsp. succinogenes S85]
          Length = 307

 Score = 43.1 bits (100), Expect = 0.086,   Method: Compositional matrix adjust.
 Identities = 58/260 (22%), Positives = 112/260 (43%), Gaps = 40/260 (15%)

Query: 49  VDGLSTDSSVRFNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAG 108
           V+GL  D+ V+ NGI VG +  + ++++  N  +    +   TP+   T A + T G+  
Sbjct: 49  VNGLFVDAKVKLNGISVGSVTSITINEQDLNQVVVAFKVTQGTPIKIGTRAGL-TAGM-- 105

Query: 109 ITYIELSTLRKEKKTIFQIAT--ERN--QRAMITATPSGINYFISNAENTSKKIS----- 159
                   L  EK+ I    +  E N  +  ++ A  S  +       +   K++     
Sbjct: 106 -------NLTGEKQVILSGGSFNEPNVPEGGLVPAAASMFDQITGQMGDLFGKVNPIVDG 158

Query: 160 -------DSSRHIQKIIENIEKPLTTTIANIETISTVLANNISHIDKMMHTTQ-VTPHSS 211
                  +++  I + ++N+EK    T AN+  I+  L   ++++ K   + Q +     
Sbjct: 159 LVRVLNPENAESISRTLQNLEK----TTANLSYITANLGKPLNNMSKSAASLQKILAEIE 214

Query: 212 DSKNTFNTITDLITSLDKMIKAIDLQKVNQILENIQVSSNNFV--------KSSDQVINT 263
           ++K    T  +L T L + ++AID + +N+ L     S N           K+ DQV N 
Sbjct: 215 EAKLAAKTEQNL-TVLKEKLEAIDTKGLNENLMQTAESMNKLAQRVDAIVYKNEDQVGNA 273

Query: 264 VHDVRETTQTFQEVGQKIDH 283
           + ++    +  +E  QKI +
Sbjct: 274 MDELNTILENLEEFSQKIKN 293


>gi|218782262|ref|YP_002433580.1| Mammalian cell entry related domain protein [Desulfatibacillum
           alkenivorans AK-01]
 gi|218763646|gb|ACL06112.1| Mammalian cell entry related domain protein [Desulfatibacillum
           alkenivorans AK-01]
          Length = 148

 Score = 42.7 bits (99), Expect = 0.11,   Method: Composition-based stats.
 Identities = 33/108 (30%), Positives = 54/108 (50%), Gaps = 6/108 (5%)

Query: 10  VGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRFNGIPVGRIV 69
           VG+FV+  L    +    + R +   G   +V  R   SV+GL T + V+  G+ VG++ 
Sbjct: 10  VGVFVLVCLLCVAYLTVKVGRMDVLGGDTYQVSARFQ-SVEGLKTGADVQIAGVGVGKVS 68

Query: 70  GLFLDQEYPNHSLAKALIRPDT--PLYPSTTATIRTQGLAGITYIELS 115
            + +D   P   +A   ++ D    L   T A++RT GL G  YI+L+
Sbjct: 69  NVIID---PMDLVAVVTLQVDKGIELTEDTIASVRTAGLIGDKYIKLT 113


>gi|23013310|ref|ZP_00053220.1| COG1463: ABC-type transport system involved in resistance to
           organic solvents, periplasmic component
           [Magnetospirillum magnetotacticum MS-1]
          Length = 163

 Score = 42.7 bits (99), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 36/65 (55%), Gaps = 2/65 (3%)

Query: 50  DGLSTDSSVRFNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGI 109
           DG++  S+VR +G  VGR+V   LD+ Y   ++    +R D  L   T A I T GL G 
Sbjct: 50  DGINVGSNVRLSGTNVGRVVDQSLDERY--RAVLTLRLRNDISLTSDTAAVIYTDGLLGA 107

Query: 110 TYIEL 114
            +IEL
Sbjct: 108 KFIEL 112


>gi|313224743|emb|CBY20534.1| unnamed protein product [Oikopleura dioica]
          Length = 1950

 Score = 42.7 bits (99), Expect = 0.11,   Method: Composition-based stats.
 Identities = 41/196 (20%), Positives = 86/196 (43%), Gaps = 14/196 (7%)

Query: 233  AIDLQKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKM 292
            A D +K  ++LE          K   ++ N  +D+R    T Q+V  +     ++F ++ 
Sbjct: 868  AEDYKKNKEMLEKETAQREELAKKLGKITNERNDLRAELDTIQDVLDE-----AEFRAEK 922

Query: 293  KSKETSAFLENIADSTSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKF-AE 351
              +      + I++   N   + + + E+ ++R  + +TI  ++N      ++ ++   E
Sbjct: 923  LQEAKLLMEQKISEMKDNFEGNTNLVEEMQEERDSLKNTIEGLQNDLKKAQETVERMKGE 982

Query: 352  LMSKINNISALKENNSLFKDAQRAMHTFRDTS----EKINRYIPSIGNNLQNFSQSGLND 407
                   +++L+E+ S FKD    M+  ++ +    E +N  + S+     N S S    
Sbjct: 983  RKQLEKQMASLEEDISEFKDRMTKMNIEKEKNLSEQELVNADLTSLEEKCSNLSLSK--- 1039

Query: 408  IQNLVRKLQETVNHFD 423
             QNL  K+ ET+   D
Sbjct: 1040 -QNLEEKIHETLIKLD 1054


>gi|110671101|ref|YP_667658.1| ABC transporter, periplasmic protein,pseudogene [Francisella
           tularensis subsp. tularensis FSC198]
 gi|134301424|ref|YP_001121392.1| hypothetical protein FTW_0324 [Francisella tularensis subsp.
           tularensis WY96-3418]
 gi|224457823|ref|ZP_03666296.1| hypothetical protein FtultM_09463 [Francisella tularensis subsp.
           tularensis MA00-2987]
 gi|254371263|ref|ZP_04987265.1| ABC transporter [Francisella tularensis subsp. tularensis FSC033]
 gi|254875494|ref|ZP_05248204.1| ABC transporter [Francisella tularensis subsp. tularensis
           MA00-2987]
 gi|255961466|ref|YP_003097806.1| ABC transporter, periplasmic protein,pseudogene [Francisella
           tularensis subsp. tularensis SCHU S4]
 gi|110321434|emb|CAL09626.1| ABC transporter, periplasmic protein,pseudogene [Francisella
           tularensis subsp. tularensis FSC198]
 gi|134049201|gb|ABO46272.1| hypothetical protein, mammalian cell entry (MCE) domain
           [Francisella tularensis subsp. tularensis WY96-3418]
 gi|151569503|gb|EDN35157.1| ABC transporter [Francisella tularensis subsp. tularensis FSC033]
 gi|240248244|emb|CAG46243.2| ABC transporter, periplasmic protein,pseudogene [Francisella
           tularensis subsp. tularensis SCHU S4]
 gi|254841493|gb|EET19929.1| ABC transporter [Francisella tularensis subsp. tularensis
           MA00-2987]
 gi|282159867|gb|ADA79258.1| hypothetical protein NE061598_09045 [Francisella tularensis subsp.
           tularensis NE061598]
          Length = 177

 Score = 42.7 bits (99), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 35/134 (26%), Positives = 62/134 (46%), Gaps = 2/134 (1%)

Query: 1   MESKNYYTSVGLF-VVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVR 59
           M +K + TSVG+F ++ +L   F +      S +        I     SV  L T++SV+
Sbjct: 1   MRNKYFETSVGIFIIIGVLCLLFLTFKVSGTSFKAFNTQEYTITADFKSVGSLRTNASVK 60

Query: 60  FNGIPVGRIVGLFLDQEYPNH-SLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLR 118
             G+ +GR+  + L++ Y    ++    I  D  +  + +A+I   G+ G  Y+ LS   
Sbjct: 61  IAGVEIGRVTKIALEKSYNGFMAVVTMAINSDKKIPANYSASIAMSGILGDNYVALSPPS 120

Query: 119 KEKKTIFQIATERN 132
           ++   I  IA   N
Sbjct: 121 EDIMAIAGIADANN 134


>gi|239904659|ref|YP_002951397.1| hypothetical protein DMR_00200 [Desulfovibrio magneticus RS-1]
 gi|239794522|dbj|BAH73511.1| hypothetical protein [Desulfovibrio magneticus RS-1]
          Length = 303

 Score = 42.7 bits (99), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 66/326 (20%), Positives = 123/326 (37%), Gaps = 56/326 (17%)

Query: 5   NYYTSVGLFVVSILFFSFFSI------YWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSV 58
           +Y  + G   + ++    F +      +W+    +YD      +IR   ++  LS    V
Sbjct: 10  DYLKAAGALALGLVILGGFMVVLGGNWFWV----KYD----HYLIRFT-AIKDLSRGRPV 60

Query: 59  RFNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLR 118
           ++ G+ VGR+  + LD   P +      I    PL+  T A I  +GL G  Y+ L    
Sbjct: 61  KYAGLDVGRVEDITLDVNDPRYIGVTVAIHQGFPLFGGTVARIAQKGLVGDYYVLLELRG 120

Query: 119 KEKKTIFQIATERNQRAMITATPSGINYFISN-AENTSKKISDSSRHIQKIIENIEKPLT 177
           +  + I   A          A P+     +   A    + + D    I +I ENI   L 
Sbjct: 121 QPGEKIVPGA----------AIPAITTMDVQELAAKAGEMLDDIRPKINEIAENIS--LL 168

Query: 178 TTIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQ 237
            T  N E++   L      ++ +         ++D +  +  ++                
Sbjct: 169 FTPENTESLKKALEGTPRLVEDLRLA------ANDFRRNWEALS---------------A 207

Query: 238 KVNQILENIQVSSNNFVKSSDQVINTVH-DVRETTQTFQEVGQKIDHLLSDFSSKM--KS 294
           K  +  E +  S    +K  D+V+ TV  ++ +T  TF+   + +  L SD         
Sbjct: 208 KGGKAAETLDAS----LKRMDKVVTTVEGELTKTLATFRTQAEHVGGLTSDVRQGFNYDQ 263

Query: 295 KETSAFLENIADSTSNMRSSISAIRE 320
           ++    L N+  ++  +R   S +RE
Sbjct: 264 EQLEEILRNLNRTSREVRELASRLRE 289


>gi|144898203|emb|CAM75067.1| ABC-type transport system involved in resistance to organic
           solvents, periplasmic component [Magnetospirillum
           gryphiswaldense MSR-1]
          Length = 165

 Score = 42.7 bits (99), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 38/67 (56%), Gaps = 2/67 (2%)

Query: 49  VDGLSTDSSVRFNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAG 108
           +DG+   S+VR +G+ +G +V   LD ++   ++ +  I  +  L   +TA IRT GL G
Sbjct: 50  LDGIGVGSTVRLSGVKIGSVVTQSLDPDF--RAVTRLQIAENVTLPADSTAVIRTDGLLG 107

Query: 109 ITYIELS 115
             YIE+ 
Sbjct: 108 AKYIEIG 114


>gi|115655426|ref|XP_784803.2| PREDICTED: similar to ENSANGP00000010787 [Strongylocentrotus
            purpuratus]
 gi|115963244|ref|XP_001188277.1| PREDICTED: similar to ENSANGP00000010787 [Strongylocentrotus
            purpuratus]
          Length = 2879

 Score = 42.4 bits (98), Expect = 0.14,   Method: Composition-based stats.
 Identities = 86/341 (25%), Positives = 160/341 (46%), Gaps = 57/341 (16%)

Query: 114  LSTLRKEKKTIFQIATERNQRAMITA-TPSGINYFISNAENTSKKISDSSRHIQKIIENI 172
            LS   +E  + FQ A  + Q A+ T      +   +  AE T++  +DS    Q  +   
Sbjct: 1629 LSEQTQESLSYFQSAEPQGQLAVDTVRNYRSVVSTVEEAEATNQNATDSLASTQDYLTT- 1687

Query: 173  EKPLTTTIANIETISTV-LANNISH-IDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKM 230
                T  I + E   ++ L+N+++  ID  M  T+    S DS N   T+   I S D +
Sbjct: 1688 ---RTVAILSEEAQRSLQLSNDLTDTIDGSMTDTEALTASLDSAN--QTLQSAIESWDNV 1742

Query: 231  IKAI-DLQ-KVNQILE-----NIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDH 283
             + + +L+ +VN +LE      IQ + ++ ++++++ I   + + ++T T  E   ++D 
Sbjct: 1743 RQDVSNLEAEVNTLLELAENPEIQPAIDSGIEAANETIAAGNSILDSTATLTE---RLD- 1798

Query: 284  LLSDFSSKMKSKETSAFLENIADSTSNMRSSISAIREITDQRQKIISTINTIE-NITSNL 342
                     + +++  F+++      N+R++ + I  + ++  +I S INT+  N+ + L
Sbjct: 1799 ---------EEEQSIVFIQD------NVRNATTLITGLPNRVSQIESNINTLSTNVDTIL 1843

Query: 343  NDSSQKFAELMSKINN-ISALKENNSLFKDAQRAMHTFRDTSEKINRYIP----SIGNNL 397
            N  +Q  + L S INN I++L+E        +RA  T  D+ + + R  P    +I +  
Sbjct: 1844 NLQNQT-SILRSGINNKIASLREK------LRRAQTTIADSDQPV-RLGPQSPLTIVSPS 1895

Query: 398  QNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFERNPQDIVW 438
              FS S  N+IQ  V+  Q       D L  F  NP + V+
Sbjct: 1896 DTFSLS--NEIQLDVKPEQR------DGLVFFMENPANNVF 1928


>gi|85858105|ref|YP_460307.1| organic solvents resistance ABC transporter periplasmic protein
           [Syntrophus aciditrophicus SB]
 gi|85721196|gb|ABC76139.1| ABC-type transport system involved in resistance to organic
           solvents, periplasmic component [Syntrophus
           aciditrophicus SB]
          Length = 172

 Score = 42.4 bits (98), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 32/108 (29%), Positives = 57/108 (52%), Gaps = 4/108 (3%)

Query: 8   TSVGLFV-VSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRFNGIPVG 66
           T+VG+F+ V I+   + ++  L   + +     ++  R   SV GL + S V   GI +G
Sbjct: 20  TTVGIFLAVGIILIGYMTV-KLGHVSLFGDDTYKLSARFT-SVSGLRSGSPVNMLGIEIG 77

Query: 67  RIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIEL 114
           R+  L +DQ+    ++ +  IR D  +Y    A+I+T+GL G  Y+ +
Sbjct: 78  RVEKLAIDQQ-DLRAVVEMSIRKDIKIYDDAIASIKTEGLIGDKYLSI 124


>gi|224418848|ref|ZP_03656854.1| ABC transporter permease [Helicobacter canadensis MIT 98-5491]
 gi|253828163|ref|ZP_04871048.1| ABC-type transport system, periplasmic component [Helicobacter
           canadensis MIT 98-5491]
 gi|313142366|ref|ZP_07804559.1| predicted protein [Helicobacter canadensis MIT 98-5491]
 gi|253511569|gb|EES90228.1| ABC-type transport system, periplasmic component [Helicobacter
           canadensis MIT 98-5491]
 gi|313131397|gb|EFR49014.1| predicted protein [Helicobacter canadensis MIT 98-5491]
          Length = 265

 Score = 42.4 bits (98), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 56/265 (21%), Positives = 121/265 (45%), Gaps = 23/265 (8%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++  Y  +G+F +++L      I+W+ + ++      E  I      +G+  ++ V++
Sbjct: 1   METRLNYVLLGVFFIAVLLALAGFIFWMGKYDRNLSEYNEYYIYNKELPNGIRVETPVKY 60

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G+PVG +    L     N       ++ +  L   +   +++QGL G  ++   TL + 
Sbjct: 61  LGLPVGFVRHYQLS---GNEVEIVVWVQKEIILNEGSKVAVQSQGLTGGNFL---TLIQG 114

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIE-----NIEKP 175
           K   F     ++Q+A++    + I    S AEN   ++  S     +++      NIE  
Sbjct: 115 KGKPFS----QSQKAILGFKENWIEQVSSKAENVMAQLETSLERFNQLLNDKNLGNIEMG 170

Query: 176 LTTTIANIET-ISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNT---ITDLITSLDKMI 231
           L    AN+ + +  VL +  + I + +   +        +  +N    +T L+ +L++  
Sbjct: 171 L-QNFANVSSELYWVLKDARAEI-RNIGEVRARLDEDLKQGDYNLRLILTPLLFNLEQNS 228

Query: 232 KAID--LQKVNQILENIQVSSNNFV 254
           K++   LQ+ N+IL++ + S + F+
Sbjct: 229 KSLQKILQEGNEILDDFRDSPSGFL 253


>gi|238923523|ref|YP_002937039.1| methyl-accepting chemotaxis protein [Eubacterium rectale ATCC
           33656]
 gi|238875198|gb|ACR74905.1| methyl-accepting chemotaxis protein [Eubacterium rectale ATCC
           33656]
          Length = 674

 Score = 42.0 bits (97), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 47/226 (20%), Positives = 96/226 (42%), Gaps = 44/226 (19%)

Query: 236 LQKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSK 295
           +Q++N  +E + +S N   +++  +   V D RE        G ++D  + D  +   S+
Sbjct: 398 MQELNNTVEQLSLSVNEIAENATTLAMVVSDTREE-------GSQVDLKMKD--TVEVSR 448

Query: 296 ETSAFLENIADSTSNMRSSISAIREITDQRQKIISTINTIENITSNL------------- 342
           +  A ++N+ D+  N+  S+  +++  D+  K    I  I  + S +             
Sbjct: 449 KGKADMQNVGDAMQNINQSVLKLQQAIDKVGKASEEITNITGVISGIAEETNLLSLNASI 508

Query: 343 -----NDSSQKFAELMSKINNISA------------LKENNSLFKDAQRAMHTFRDTSEK 385
                 ++ + FA + ++I  ++             + E N L KDA   +    D+ E 
Sbjct: 509 EAARAGEAGKGFAVVATEIGQLAKNSAESVQNIEKLISEINVLVKDA---VLQADDSVEN 565

Query: 386 INRYIPSIGNNLQNFSQ--SGLNDIQNLVRKLQETVNHFDDCLNNF 429
           IN     +G+ L+ F      ++++  LVR++ E V   D+  NN 
Sbjct: 566 INSSGELVGDALKTFDVIFGNIDEVSTLVRQMIEKVEKVDEVANNV 611


>gi|261415407|ref|YP_003249090.1| Mammalian cell entry related domain protein [Fibrobacter
           succinogenes subsp. succinogenes S85]
 gi|261371863|gb|ACX74608.1| Mammalian cell entry related domain protein [Fibrobacter
           succinogenes subsp. succinogenes S85]
 gi|302326329|gb|ADL25530.1| Mce-like protein [Fibrobacter succinogenes subsp. succinogenes S85]
          Length = 306

 Score = 42.0 bits (97), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 63/300 (21%), Positives = 124/300 (41%), Gaps = 47/300 (15%)

Query: 7   YTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRFNGIPVG 66
           Y SVGL V+  +F   F +++L+  +  +       +R    V  L  D  V+ NG+ +G
Sbjct: 8   YFSVGLVVLLAIFILIFGMFFLNEKDLRE-TFDVYHLRFT-QVSTLVLDDPVKINGVKLG 65

Query: 67  RIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQ--GLAGITYIELSTLRKEKKTI 124
           R+  +    E   H +    +R  + +     + IR Q  G+ G            ++ I
Sbjct: 66  RVESI----ELSGHRVV-VTVRLKSNVKIPKDSEIRVQNIGIMG------------ERQI 108

Query: 125 FQIATERNQRAMITATPSG-INYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTIANI 183
             I  +  +  +   T +G  +  I+ A   + ++ DS++    ++E ++  L  TIAN 
Sbjct: 109 GMILGDAEEYYVPGDTITGQFDAGIAEALGLAGEVCDSTK---VLLEAVKTALNGTIANP 165

Query: 184 E---TISTVLANNISHIDKMMHTTQVT-PHSSDSKNTFNTITDLITSLDKMIKAIDLQKV 239
           E      T+L    +  D++M     T P    S    N +T                KV
Sbjct: 166 EFQDRFKTLLVKAENLEDRLMSLVTTTDPQLKKSLANLNKVT---------------VKV 210

Query: 240 NQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSA 299
           N++++ ++   N     +D+V+   +   +     + V + +D L++   +KM SK+ + 
Sbjct: 211 NELVDGVKEPINGLFAGTDKVMGNAN---QLISDLEGVTKHLDGLIAKVQAKMDSKDNTV 267


>gi|167626718|ref|YP_001677218.1| hypothetical protein Fphi_0499 [Francisella philomiragia subsp.
           philomiragia ATCC 25017]
 gi|167596719|gb|ABZ86717.1| conserved hypothetical protein [Francisella philomiragia subsp.
           philomiragia ATCC 25017]
          Length = 176

 Score = 42.0 bits (97), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 42/143 (29%), Positives = 68/143 (47%), Gaps = 15/143 (10%)

Query: 1   MESKNYYTSVGLFV---VSILFFSFFSIYWLS----RSNQYDGPMAEVIIRIPGSVDGLS 53
           M +K++ TSVG+F+   V  L F  F +   S     SN+Y     E   +  GS   L 
Sbjct: 1   MRNKHFETSVGIFIIIGVLCLIFLTFKVSGTSFKSFGSNEY---TIEADFKNVGS---LR 54

Query: 54  TDSSVRFNGIPVGRIVGLFLDQEYPNHSLAKAL-IRPDTPLYPSTTATIRTQGLAGITYI 112
           T++SV+  G+ VGR+  + L++ Y     A  + I  D  +  + +A I   G+ G  Y+
Sbjct: 55  TNASVKIAGVEVGRVTKISLEKTYNGFMAAVTIAINSDKKIPANYSAAIAMSGILGDNYV 114

Query: 113 ELSTLRKEKKTIFQIA-TERNQR 134
            L+   ++  +I  I  TE N  
Sbjct: 115 ALTPPSEDIMSIAGIGDTENNSE 137


>gi|309388789|gb|ADO76669.1| methyl-accepting chemotaxis sensory transducer with Cache sensor
           [Halanaerobium praevalens DSM 2228]
          Length = 589

 Score = 42.0 bits (97), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 44/155 (28%), Positives = 75/155 (48%), Gaps = 23/155 (14%)

Query: 216 TFNTITDLITSLDKMIKAIDLQKVNQILENIQVSSNNFVKSSDQVINTVHDV----RETT 271
           T N+  +++T + K I    ++  NQ  E + +S     K+++QV   + +V     E +
Sbjct: 275 TANSQKEILTEIKKEI----IELTNQSQE-LAISGQEVEKAAEQVGGAIENVASGAEEQS 329

Query: 272 QTFQEVGQKIDHLLSDFSS------KMKSKETSAFLENIADSTSNMRSSISAIREITDQR 325
               E  Q +  L+S   S      KM S  ++  +ENI   T +M+SSI  + ++ D  
Sbjct: 330 AQIMETSQNLKQLISQIDSTSSKSRKMGSA-SNQVIENIKTGTKSMQSSIQQVNKVKDNS 388

Query: 326 QKIISTINTIENITSNLNDSSQKFAELMSKINNIS 360
            +I  TIN       NL D S++   +++ INNIS
Sbjct: 389 AEIGITIN-------NLGDLSEEIGTIVNLINNIS 416


>gi|118431124|ref|NP_147358.2| surface layer protein [Aeropyrum pernix K1]
 gi|116062448|dbj|BAA79579.2| surface layer protein [Aeropyrum pernix K1]
          Length = 1550

 Score = 42.0 bits (97), Expect = 0.20,   Method: Composition-based stats.
 Identities = 46/241 (19%), Positives = 108/241 (44%), Gaps = 27/241 (11%)

Query: 165  IQKIIENIEKPLTTTIANIETISTVLANNISHIDK--------MMHTTQVTPHSSDSKNT 216
            IQ  +  I+    T + +++ + T++A++   + K        ++   Q+   S D+ + 
Sbjct: 1281 IQGDVAEIKTTAGTILVSVQDLQTIVADSTDAVIKAVEDNVALVLDGQQLILESLDTLDA 1340

Query: 217  -FNTITDLITSLDKMIKAI-----DLQKVNQILENIQVSSNNFVKSSDQVINTVHDVRET 270
                ++D +  +  ++  +     DL + N  +E + V +N  + +    + T+     T
Sbjct: 1341 KITAVSDGVAEVQTILGDVSVSLEDLVEANATIEEVVVENNQLLATITTSMGTLTADMST 1400

Query: 271  TQTFQEVGQ--KIDHLLSDFSS-KMKSKETSAFLENIADSTSNMRSSISAIREITDQRQK 327
             +   E G   K+D +L D S+   ++ + +A  E IA + + ++   + I +I      
Sbjct: 1401 LKDLIESGVNVKLDQVLEDLSTISDQNAQLAAQAEAIAQTLAAVQDDTAKITDIQSTLAS 1460

Query: 328  IISTINTIEN----ITSNLNDSSQKFAELMSKINNISALKENNSLFKDAQRAMHTFRDTS 383
            +   + +++     I+S L+D++ K   + SK++++S      S   D Q  +    DT+
Sbjct: 1461 VAGDVASVKQDTSTISSKLDDANGKLDSISSKVDSVS------SAVADIQEQLGQVGDTA 1514

Query: 384  E 384
            E
Sbjct: 1515 E 1515


>gi|254415723|ref|ZP_05029481.1| GAF domain protein [Microcoleus chthonoplastes PCC 7420]
 gi|196177429|gb|EDX72435.1| GAF domain protein [Microcoleus chthonoplastes PCC 7420]
          Length = 1659

 Score = 42.0 bits (97), Expect = 0.22,   Method: Composition-based stats.
 Identities = 41/231 (17%), Positives = 98/231 (42%), Gaps = 24/231 (10%)

Query: 154  TSKKISDSSRHIQKIIENIEKPLTTTIANIETISTVLANNISHIDKMMHTTQVTPHSSDS 213
            +++++ ++ +   K ++  ++ +  T+  I  I   +A     + ++  +TQ      + 
Sbjct: 1435 SAQQVEEAVQQANKTVQAGDEAMNRTVDGIMDIRETVAETSKRLKRLSESTQKVSRVVNL 1494

Query: 214  KNTFNTITDLITSLDKMIKAIDLQKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQT 273
             + F T T L+ +L+  I+A    +  +           FV  +D+V +      E T  
Sbjct: 1495 ISNFTTQTQLL-ALNASIEATRAGEYGR----------GFVVVADEVRSLARQSAEATTE 1543

Query: 274  FQEVGQKIDHLLSDFSSKMKS------------KETSAFLENIADSTSNMRSSISAIREI 321
              ++ Q+I    ++ SS M++             E   +L  I ++TS +   ++ I + 
Sbjct: 1544 IAQLVQEIQMGTAEVSSVMETGIQQVASGTNQVNEAREYLYAIVEATSQISQVVAGITQA 1603

Query: 322  TD-QRQKIISTINTIENITSNLNDSSQKFAELMSKINNISALKENNSLFKD 371
            T  Q Q++ S   T+  + +  N +++   E+ S    +  + +N  +  D
Sbjct: 1604 TQVQSQELQSVTRTMTQVATIANQTAENSMEMSSSFQGLLTMAQNLQMSAD 1654


>gi|308272143|emb|CBX28750.1| hypothetical protein N47_L13480 [uncultured Desulfobacterium sp.]
          Length = 147

 Score = 41.6 bits (96), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 36/120 (30%), Positives = 58/120 (48%), Gaps = 13/120 (10%)

Query: 1   MESKNYYTSVGLF-VVSILFFSFFSIYW----LSRSNQYDGPMAEVIIRIPGSVDGLSTD 55
           M+ ++  TSVG+F ++ ++   + +I      L   N Y      V  +   SV GL   
Sbjct: 1   MKKQSIETSVGIFFLIGLICVGYLTIKLGKMELLGDNTY-----TVKAKFK-SVSGLKQG 54

Query: 56  SSVRFNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELS 115
           S V   G+ +G I  ++LD++  + +L K  I  D  L     A+I+T GL G  YI +S
Sbjct: 55  SQVEMAGVKIGTIDNVYLDKD--DRALVKLKINKDIILTDDVIASIKTSGLIGDKYISIS 112


>gi|32266621|ref|NP_860653.1| hypothetical protein HH1122 [Helicobacter hepaticus ATCC 51449]
 gi|32262672|gb|AAP77719.1| conserved hypothetical protein [Helicobacter hepaticus ATCC 51449]
          Length = 258

 Score = 41.6 bits (96), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 55/242 (22%), Positives = 101/242 (41%), Gaps = 24/242 (9%)

Query: 4   KNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRFNGI 63
           K  + +   F++ IL  +F  I WL+R         +        V G+S ++ +R+ GI
Sbjct: 6   KYVWIATLFFIILILMVAF--ILWLNRFEIDSTRYTQYYAYSSDEVSGVSANTPIRYKGI 63

Query: 64  PVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTAT--IRTQGLAGITYIELSTLRKEK 121
            VGR+  +            + LI  D+ LY    A   I +QGLAG  Y  LS ++   
Sbjct: 64  SVGRVQSVSFKDIKEGTIQIQMLI--DSQLYVRENAKVIISSQGLAGANY--LSLIQSNG 119

Query: 122 KTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKII--ENIE------ 173
             + Q  +E   + ++      I   +S A   S  ++   + +   +  EN++      
Sbjct: 120 GELLQKNSEG--KKVLELDKGSIEKIMSKASELSDDMASLLKSLNNGLNEENLQEINIMI 177

Query: 174 KPLTTTIANIETISTVLANNIS----HIDKMMHTT--QVTPHSSDSKNTFNTITDLITSL 227
           K L+ +  N++ IS  +  N+     ++ +++  T  Q+     D    FN  +  I  +
Sbjct: 178 KELSNSAHNLQNISAQMNKNMQRGEYNLREILTPTLFQLQGSLQDMSKFFNQASSFIDKM 237

Query: 228 DK 229
           DK
Sbjct: 238 DK 239


>gi|237752256|ref|ZP_04582736.1| ABC transporter permease [Helicobacter winghamensis ATCC BAA-430]
 gi|229376498|gb|EEO26589.1| ABC transporter permease [Helicobacter winghamensis ATCC BAA-430]
          Length = 272

 Score = 41.6 bits (96), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 29/123 (23%), Positives = 57/123 (46%), Gaps = 17/123 (13%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++  Y  +G+F+V+ L      ++W+ + ++  G   E  +       G+  ++ VR+
Sbjct: 1   MEARLNYVLLGVFLVASLVALAGFVFWMGKYDRNLGAYVEYYLYNKELPKGIRIETPVRY 60

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKA--------LIRPDTPLYPSTTATIRTQGLAGITYI 112
            G+PVG +          ++ L+ A         ++ +  L   T A + +QGL G  YI
Sbjct: 61  LGLPVGFV---------KSYDLSTAQDKVEIVLWVKKEIMLKEGTRAIVESQGLTGGNYI 111

Query: 113 ELS 115
            L+
Sbjct: 112 ALT 114


>gi|89255922|ref|YP_513284.1| ABC transporter, periplasmic protein [Francisella tularensis subsp.
           holarctica LVS]
 gi|115314404|ref|YP_763127.1| organic solvent ABC superfamily substrate-binding protein
           [Francisella tularensis subsp. holarctica OSU18]
 gi|118496936|ref|YP_897986.1| hypothetical protein FTN_0326 [Francisella tularensis subsp.
           novicida U112]
 gi|167009175|ref|ZP_02274106.1| hypothetical protein Ftulh_00185 [Francisella tularensis subsp.
           holarctica FSC200]
 gi|169656536|ref|YP_001427976.2| ABC transporter periplasmic protein [Francisella tularensis subsp.
           holarctica FTNF002-00]
 gi|187931163|ref|YP_001891147.1| ABC transporter, periplasmic protein [Francisella tularensis subsp.
           mediasiatica FSC147]
 gi|254367280|ref|ZP_04983307.1| ABC transporter, periplasmic protein [Francisella tularensis subsp.
           holarctica 257]
 gi|254368756|ref|ZP_04984769.1| conserved hypothetical protein [Francisella tularensis subsp.
           holarctica FSC022]
 gi|254372306|ref|ZP_04987797.1| ABC transporter [Francisella tularensis subsp. novicida GA99-3549]
 gi|290953703|ref|ZP_06558324.1| ABC transporter, periplasmic protein [Francisella tularensis subsp.
           holarctica URFT1]
 gi|295312938|ref|ZP_06803657.1| ABC transporter, periplasmic protein [Francisella tularensis subsp.
           holarctica URFT1]
 gi|89143753|emb|CAJ78955.1| ABC transporter, periplasmic protein [Francisella tularensis subsp.
           holarctica LVS]
 gi|115129303|gb|ABI82490.1| possible organic solvent ABC superfamily ATP binding cassette
           transporter, binding protein [Francisella tularensis
           subsp. holarctica OSU18]
 gi|118422842|gb|ABK89232.1| conserved hypothetical protein [Francisella novicida U112]
 gi|134253097|gb|EBA52191.1| ABC transporter, periplasmic protein [Francisella tularensis subsp.
           holarctica 257]
 gi|151570035|gb|EDN35689.1| ABC transporter [Francisella novicida GA99-3549]
 gi|157121677|gb|EDO65847.1| conserved hypothetical protein [Francisella tularensis subsp.
           holarctica FSC022]
 gi|164551604|gb|ABU61020.2| ABC transporter, periplasmic component [Francisella tularensis
           subsp. holarctica FTNF002-00]
 gi|187712072|gb|ACD30369.1| ABC transporter, periplasmic protein [Francisella tularensis subsp.
           mediasiatica FSC147]
 gi|328676408|gb|AEB27278.1| Mce-related protein [Francisella cf. novicida Fx1]
          Length = 177

 Score = 41.6 bits (96), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 34/134 (25%), Positives = 62/134 (46%), Gaps = 2/134 (1%)

Query: 1   MESKNYYTSVGLF-VVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVR 59
           M +K + TSVG+F ++ +L   F +      S +        I     +V  L T++SV+
Sbjct: 1   MRNKYFETSVGIFIIIGVLCLLFLTFKVSGTSFKAFNTQEYTITADFKNVGSLRTNASVK 60

Query: 60  FNGIPVGRIVGLFLDQEYPNH-SLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLR 118
             G+ +GR+  + L++ Y    ++    I  D  +  + +A+I   G+ G  Y+ LS   
Sbjct: 61  IAGVEIGRVTKIALEKSYNGFMAVVTMAINSDKKIPANYSASIAMSGILGDNYVALSPPS 120

Query: 119 KEKKTIFQIATERN 132
           ++   I  IA   N
Sbjct: 121 EDIMAIAGIADANN 134


>gi|312137899|ref|YP_004005235.1| mce family protein mce1c [Rhodococcus equi 103S]
 gi|311887238|emb|CBH46547.1| putative Mce family protein Mce1C [Rhodococcus equi 103S]
          Length = 356

 Score = 41.6 bits (96), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 41/194 (21%), Positives = 82/194 (42%), Gaps = 32/194 (16%)

Query: 25  IYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRFNGIPVGRIVGLFLDQEYPNHSLAK 84
           +++LSR++ Y   +A        +  GLS    V   G+P GR+ G+ +     NH    
Sbjct: 54  LWYLSRTSPYSAELA--------NASGLSDGDPVYVAGVPAGRVEGIDIAG---NHVRVD 102

Query: 85  ALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKEKKTIFQIATERNQRAMI------- 137
             +    PL   TTA++R + + G  Y+E+            + T  N  A         
Sbjct: 103 FRLDDGQPLGNRTTASVRLETVLGKRYLEV--------VPAGVVTAENADATAANVIPLA 154

Query: 138 -TATPSGINYFISNAENTSKKISDSS-----RHIQKIIENIEKPLTTTIANIETISTVLA 191
            T  P  ++    +A + + +I  +S     R + +++ +  + L   +A +   S V++
Sbjct: 155 RTTVPYSLDDMSRDATDAATEIDTASLEAMMRTLSEVMPDDPEQLGRVLAGVSGASAVVS 214

Query: 192 NNISHIDKMMHTTQ 205
            N   ID+++  ++
Sbjct: 215 RNAEQIDQLLEMSR 228


>gi|88603281|ref|YP_503459.1| methyl-accepting chemotaxis sensory transducer with Pas/Pac sensor
            [Methanospirillum hungatei JF-1]
 gi|88188743|gb|ABD41740.1| methyl-accepting chemotaxis sensory transducer with Pas/Pac sensor
            [Methanospirillum hungatei JF-1]
          Length = 1285

 Score = 41.6 bits (96), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 44/182 (24%), Positives = 76/182 (41%), Gaps = 15/182 (8%)

Query: 247  QVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAFLEN--- 303
            + +  NF    D+ +N   D     +   E+G K+   +S  + ++K+   +A   N   
Sbjct: 941  EFAGYNFTARFDKKLNIKGDWISFREALDEIGDKVAEAISTINMQVKNLSLNADQANVNV 1000

Query: 304  --IADSTSNMRSSISAIREITDQRQKIISTI-NTIENITSNLNDSSQKFAELMSKINNIS 360
              IA     M  S S +    +Q    +  I   +E++T  + + S+K  E+     N +
Sbjct: 1001 GEIAQGAGQMAHSASQVSANAEQGNSGVQQILKAMEDLTITVAEVSKKTEEVSEYSRNAN 1060

Query: 361  AL-KENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETV 419
             L KE  SL K A+  MH    ++E +NR I  I        Q  +  I  +VR + +  
Sbjct: 1061 DLAKEGTSLAKKAEDGMHVITMSAEDMNRLIGEI--------QQDMGQIGKIVRLISDIA 1112

Query: 420  NH 421
            N 
Sbjct: 1113 NQ 1114


>gi|228957456|ref|ZP_04119210.1| Phage infection protein [Bacillus thuringiensis serovar pakistani
           str. T13001]
 gi|228802210|gb|EEM49073.1| Phage infection protein [Bacillus thuringiensis serovar pakistani
           str. T13001]
          Length = 1011

 Score = 41.2 bits (95), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 58/287 (20%), Positives = 117/287 (40%), Gaps = 30/287 (10%)

Query: 151 AENTSKKISDSSRHIQKIIENIEKPLTTTIANIETISTVLANNISHIDKMMHTTQVTPHS 210
           AE     I D S+ +    E   K        +   S+ L +  S +   +HT Q    S
Sbjct: 168 AEKMFDSIKDVSKGLADGAEGASK--------LHDGSSELHDGSSKVTDGLHTLQ--GKS 217

Query: 211 SDSKNTFNTITD----LITSLDKMIKAIDLQKVNQILENIQVSSNNFVKSSDQVINTVHD 266
            + K+    + D    L+    K+   +++  +N     +QV     V  S +V N ++ 
Sbjct: 218 GEMKDGVQKLADGSNKLVDGSGKVTNGLNV--LNSKTGEMQVGIGKLVDGSGKVTNGLNT 275

Query: 267 VRETTQTFQ-EVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNMRSSISA------IR 319
           +   T   Q  +G+ +D      +  + +  ++A +  + D +  +   + A      I 
Sbjct: 276 LNSKTGEMQIGIGKLVDGS-GKVTDGLHALNSNAGIGKLVDGSGKVTDGLHALNSNAGIG 334

Query: 320 EITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNISA-LKENNSLFKDAQ----R 374
           ++ D   K+   +NT+ + T  L D S+K    ++K+ + S  LK   +   +       
Sbjct: 335 KLVDGSGKVTDGLNTLNSKTGELRDGSEKVTGGLNKLVSKSGELKTGTTDLSNGMGKLVE 394

Query: 375 AMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNH 421
                 + S+ I + +  + +N+Q  S +GL ++Q+ V  +  TVN 
Sbjct: 395 GQSQLEEGSQAIQKGLQELNSNVQK-SAAGLEEMQSKVPSILNTVNE 440


>gi|229143788|ref|ZP_04272208.1| Phage infection protein [Bacillus cereus BDRD-ST24]
 gi|228639663|gb|EEK96073.1| Phage infection protein [Bacillus cereus BDRD-ST24]
          Length = 1011

 Score = 41.2 bits (95), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 56/286 (19%), Positives = 118/286 (41%), Gaps = 37/286 (12%)

Query: 152 ENTSKKISDSSRHIQKIIENIEKPLTTTIANIETISTVLANNISHIDKMMHTTQVTPHSS 211
           ++ SK ++D S    K+ +                S+ L +  S +   +HT Q    S 
Sbjct: 176 KDVSKGLADGSEGASKLHDG---------------SSELHDGSSKVTDGLHTLQ--GKSG 218

Query: 212 DSKNTFNTITD----LITSLDKMIKAIDLQKVNQILENIQVSSNNFVKSSDQVINTVHDV 267
           + K+    + D    L+    K+   +++  +N     +QV     V  S +V N ++ +
Sbjct: 219 EMKDGVQKLADGSNKLVDGSGKVTNGLNV--LNSKTGEMQVGIGKLVDGSGKVTNGLNTL 276

Query: 268 RETTQTFQ-EVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNMRSSISA------IRE 320
              T   Q  +G+ +D      +  + +  ++A +  + D +  +   + A      I +
Sbjct: 277 NSKTGEMQIGIGKLVDGS-GKVTDGLHALNSNAGIGKLVDGSGKVTDGLHALNSNAGIGK 335

Query: 321 ITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNISA-LKENNSLFKDAQ----RA 375
           + D   K+   +NT+ + T  L D S+K    ++K+ + S  LK   +   +        
Sbjct: 336 LVDGSGKVTDGLNTLNSKTGELRDGSEKVTGGLNKLVSKSGELKTGTTDLSNGMGKLVEG 395

Query: 376 MHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNH 421
                + S+ I + +  + +N+Q  S +GL ++Q+ V  +  TVN 
Sbjct: 396 QSQLEEGSQAIQKGLQELNSNVQK-SAAGLEEMQSKVPSILNTVNE 440


>gi|188587450|ref|YP_001918995.1| methyl-accepting chemotaxis sensory transducer [Natranaerobius
           thermophilus JW/NM-WN-LF]
 gi|179352137|gb|ACB86407.1| methyl-accepting chemotaxis sensory transducer [Natranaerobius
           thermophilus JW/NM-WN-LF]
          Length = 555

 Score = 41.2 bits (95), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 51/258 (19%), Positives = 113/258 (43%), Gaps = 57/258 (22%)

Query: 219 TITDLITSLDKMIKAID--LQKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQE 276
           T+ D+ +  ++  +A D  LQ VN+ LE ++  S+N                   ++ QE
Sbjct: 156 TVNDISSGAEEQSQATDQTLQGVNERLEQVERISSN------------------AKSAQE 197

Query: 277 VGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNMRSSISAIREITDQRQKIISTINTIE 336
             ++++ ++ D SSK+++      +++  ++  N + +   I+++TDQ +KI   +N + 
Sbjct: 198 TAEQMEQVIEDSSSKVEN-----LIKSSEETAENNQKAREMIKKLTDQAEKITEIVNVVT 252

Query: 337 NIT--------------SNLNDSSQKFAELMSKINNI------SALKENNSLFK------ 370
           +I+              +   DS Q FA +  ++ N+      SA + +N ++K      
Sbjct: 253 DISEQTHLLALNASIEAARAGDSGQGFAVVAQEVRNLAEESGKSAEEISNLIYKVKEMVN 312

Query: 371 DAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQS------GLNDIQNLVRKLQETVNHFDD 424
           +A R +    + S +   Y  +  N L+    +       ++D+Q+  + L+E++    D
Sbjct: 313 EADRLVEQSVNNSRQGAEYADTARNALKEIVTAVHRVAEKVDDVQSGAQVLKESIQEVQD 372

Query: 425 CLNNFERNPQDIVWGREK 442
            +       Q    G E+
Sbjct: 373 SVQKINEIAQSNAAGAEE 390


>gi|218961391|ref|YP_001741166.1| hypothetical protein; putative signal peptide [Candidatus
           Cloacamonas acidaminovorans]
 gi|167730048|emb|CAO80960.1| hypothetical protein; putative signal peptide [Candidatus
           Cloacamonas acidaminovorans]
          Length = 410

 Score = 41.2 bits (95), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 96/408 (23%), Positives = 162/408 (39%), Gaps = 74/408 (18%)

Query: 48  SVDGLSTDSSVRFNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLA 107
           SV GL   SSV + GI +GR+  + ++ +     +    +   TP+   T A +   G+ 
Sbjct: 48  SVSGLQVGSSVNYRGIKIGRVEDVKINPKDVTKIIITISVNRGTPIKEDTEAVLLLSGIT 107

Query: 108 GITYIELSTLRKEKKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQK 167
           G+  +EL     E K +                P     +I       + IS+ ++ I  
Sbjct: 108 GLKNVELRGGTNEAKLL---------------KPKS---YIKTGTTVLEDISERAKSIVD 149

Query: 168 IIENIEKPLTTTIA--NIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLIT 225
            I+ I   L       N   IST+LA   S I K  H    T   S S+   NT  DL  
Sbjct: 150 KIDMIAANLNAITGEENRNNISTILAQT-SLILKDTHENLATTMQSISRIANNT-ADLTE 207

Query: 226 SLDKMIKAIDLQKVNQILENIQVSSNNFVKSSDQVINT----VHDVRETTQT-FQEVGQK 280
            L K + A+               + N  K+ D + ++    + +V ET+QT    V   
Sbjct: 208 ELSKDLSAV---------------TENLTKNLDAITSSATSNIQNVSETSQTSLINVTNN 252

Query: 281 IDHLLSDFSSKMKSKETSAFLENIADSTSNMRSS---ISAIREITDQRQKIISTINTIEN 337
           ++  L + ++K+++  T   L N  D ++ +R +   +S + E +DQ   I+ T   I  
Sbjct: 253 VNQQLEELTAKLETSLTQ--LTN--DGSALIREANLKVSTVGEHSDQM--ILETTREILT 306

Query: 338 ITSNLNDS---------SQKFAELMSKINNISALKENNSLFKDAQRAMHT-FRDTSEKIN 387
           I++N+N +         +  F  LM+ +  +S       L +   ++M T    T +K  
Sbjct: 307 ISNNINRALDQVNAILYTPGFDSLMTNLGKLSG-----ELSRTDLKSMVTELSTTIQKTG 361

Query: 388 RYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFERNPQD 435
             +     NL      G  D+  ++  L ET     + LN F R   D
Sbjct: 362 TLVS----NLNRVVTRGQGDLLEILSTLTET----SENLNEFSRQIAD 401


>gi|312138211|ref|YP_004005547.1| mce family protein mce2b [Rhodococcus equi 103S]
 gi|325674883|ref|ZP_08154570.1| virulence factor mce family protein [Rhodococcus equi ATCC 33707]
 gi|311887550|emb|CBH46862.1| putative Mce family protein Mce2B [Rhodococcus equi 103S]
 gi|325554469|gb|EGD24144.1| virulence factor mce family protein [Rhodococcus equi ATCC 33707]
          Length = 339

 Score = 41.2 bits (95), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 31/104 (29%), Positives = 49/104 (47%), Gaps = 13/104 (12%)

Query: 14  VVSILFFSF---FSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRFNGIPVGRIVG 70
           V++++F      FS +  S S+ Y    A+          GL +   VR  G+PVG +  
Sbjct: 14  VMALIFAGLAIVFSQFRFSSSDGYHATFADA--------SGLKSGDKVRIAGVPVGSVKS 65

Query: 71  LFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIEL 114
           + +D +  NH+  K  +     L  ST AT+R + L G  Y+EL
Sbjct: 66  VDVDDD--NHAEIKFSVDSQYTLLSSTKATVRYENLVGDRYLEL 107


>gi|254373780|ref|ZP_04989263.1| conserved hypothetical protein [Francisella novicida GA99-3548]
 gi|151571501|gb|EDN37155.1| conserved hypothetical protein [Francisella novicida GA99-3548]
          Length = 177

 Score = 41.2 bits (95), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 34/134 (25%), Positives = 62/134 (46%), Gaps = 2/134 (1%)

Query: 1   MESKNYYTSVGLF-VVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVR 59
           M +K + TSVG+F ++ +L   F +      S +        I     +V  L T++SV+
Sbjct: 1   MRNKYFETSVGIFIIIGVLCLLFLTFKVSGTSFKAFNTQEYTITADFKNVGSLRTNASVK 60

Query: 60  FNGIPVGRIVGLFLDQEYPNH-SLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLR 118
             G+ +GR+  + L++ Y    ++    I  D  +  + +A+I   G+ G  Y+ LS   
Sbjct: 61  IAGVEIGRVTKIALEKSYNGFMAVVTMAINSDKKIPANYSASIAMSGILGDNYVALSPPS 120

Query: 119 KEKKTIFQIATERN 132
           ++   I  IA   N
Sbjct: 121 EDIMAIAGIADANN 134


>gi|28898138|ref|NP_797743.1| ABC transporter periplasmic substrate-binding protein [Vibrio
           parahaemolyticus RIMD 2210633]
 gi|153836512|ref|ZP_01989179.1| ABC-type transport system, periplasmic component [Vibrio
           parahaemolyticus AQ3810]
 gi|260366437|ref|ZP_05778876.1| ABC-type transport system, periplasmic component [Vibrio
           parahaemolyticus K5030]
 gi|260878483|ref|ZP_05890838.1| ABC-type transport system, periplasmic component [Vibrio
           parahaemolyticus AN-5034]
 gi|260897064|ref|ZP_05905560.1| ABC-type transport system, periplasmic component [Vibrio
           parahaemolyticus Peru-466]
 gi|260901860|ref|ZP_05910255.1| ABC-type transport system, periplasmic component [Vibrio
           parahaemolyticus AQ4037]
 gi|28806352|dbj|BAC59627.1| possible ABC transport system periplasmic substrate-binding protein
           [Vibrio parahaemolyticus RIMD 2210633]
 gi|149750110|gb|EDM60855.1| ABC-type transport system, periplasmic component [Vibrio
           parahaemolyticus AQ3810]
 gi|308087746|gb|EFO37441.1| ABC-type transport system, periplasmic component [Vibrio
           parahaemolyticus Peru-466]
 gi|308091354|gb|EFO41049.1| ABC-type transport system, periplasmic component [Vibrio
           parahaemolyticus AN-5034]
 gi|308108168|gb|EFO45708.1| ABC-type transport system, periplasmic component [Vibrio
           parahaemolyticus AQ4037]
 gi|308113092|gb|EFO50632.1| ABC-type transport system, periplasmic component [Vibrio
           parahaemolyticus K5030]
          Length = 323

 Score = 40.8 bits (94), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 66/287 (22%), Positives = 123/287 (42%), Gaps = 36/287 (12%)

Query: 2   ESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRFN 61
           +SK+ Y  +GLFVVS L   F  ++ L   + ++ P   V      SV GL   + VRF 
Sbjct: 3   DSKSSY-KLGLFVVSALVSLFVVLFILGGRSLFE-PKIIVETYFDESVSGLEVGAPVRFR 60

Query: 62  GIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKEK 121
           GI  G +V +          L+ AL     P     +  +    + G       T+ +  
Sbjct: 61  GITAGEVVSI---------ELSDALYEAAVPRENRKSYVVVRSEITGAK----RTIEEWN 107

Query: 122 KTIFQIATERNQRAMI-TATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
           ++I +I+ ER  RA    A  +G  Y   +  +  + +S + +     + + +      +
Sbjct: 108 RSI-EISIERGLRATTQLAGITGQQYLSFDYTSMDEGLSFNWKPNYPYVPSTKSSAGKIV 166

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
           + I+++       I+ +D+           +D       I  LI +L++ I A+D   +N
Sbjct: 167 SGIQSL-------IARLDE-----------ADINTLVANINMLIETLNQSISALDADALN 208

Query: 241 QILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSD 287
             L  + ++SN  VKS D VI+   +V+E   +  ++ + ++  L D
Sbjct: 209 AQLLALLINSNQMVKSVDGVISD-PEVKEIVSSLAQISKSLNSSLKD 254


>gi|118578999|ref|YP_900249.1| hypothetical protein Ppro_0560 [Pelobacter propionicus DSM 2379]
 gi|118501709|gb|ABK98191.1| Mammalian cell entry related domain protein [Pelobacter propionicus
           DSM 2379]
          Length = 148

 Score = 40.8 bits (94), Expect = 0.41,   Method: Composition-based stats.
 Identities = 24/84 (28%), Positives = 43/84 (51%), Gaps = 5/84 (5%)

Query: 48  SVDGLSTDSSVRFNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLA 107
           SV GL   +S+   G+ VG++  + LD +  + +LA   I+    +     A++RT G+ 
Sbjct: 45  SVSGLKPGASIEVAGVEVGKVERIALDPKSNDRALAYMKIKSGVKITDDVIASVRTSGII 104

Query: 108 GITYIELS-----TLRKEKKTIFQ 126
           G  +I+L      T  K++  IF+
Sbjct: 105 GDKFIKLKPGGSDTYLKDRDMIFE 128


>gi|229078384|ref|ZP_04210947.1| Phage infection protein [Bacillus cereus Rock4-2]
 gi|228704925|gb|EEL57348.1| Phage infection protein [Bacillus cereus Rock4-2]
          Length = 999

 Score = 40.8 bits (94), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 66/296 (22%), Positives = 125/296 (42%), Gaps = 51/296 (17%)

Query: 165 IQKIIENIEKPLTTTIA-----NIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNT 219
           I+KI   +   LT T A     +I+ +S  LA+     +K+ H      H   SK     
Sbjct: 152 IEKIKGEVASTLTKTYAEKMFDSIQDVSKGLADGAEGANKL-HDGSSELHDGSSK----- 205

Query: 220 ITDLITSLDKMIKAIDLQKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQ-EVG 278
           +TD + +L    K+ +++   Q L +    SN  V  S +V N ++ +   T   Q  +G
Sbjct: 206 VTDGLHTLQG--KSGEMKDGVQKLAD---GSNKLVDGSGKVTNGLNTLNSKTGEMQIGIG 260

Query: 279 QKID---------HLLS---------DFSSK----MKSKETSAFLENIADSTSNMRSSIS 316
           + +D         H+L+         D S K    + +  ++A +  + D +  +   + 
Sbjct: 261 KLVDGSGKVTDGLHVLNSNAGIGKLVDGSGKVTDGLHALNSNAGIGKLVDGSGKVTDGLH 320

Query: 317 A------IREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNISA-LKENNSLF 369
           A      I ++ D   K+   +NT+ + T  L D S+K    ++K+ + S  LK   +  
Sbjct: 321 ALNSNAGIGKLVDGSGKVTDGLNTLNSKTGELRDGSEKVTGGLNKLVSKSGELKTGTTDL 380

Query: 370 KDAQ----RAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNH 421
            +             + S+ I + +  + +N+Q  S +GL ++Q+ V  +  TVN 
Sbjct: 381 SNGMGKLVEGQSQLEEGSQAIQKGLQELNSNVQK-SAAGLEEMQSKVPSILNTVNE 435


>gi|198434974|ref|XP_002125931.1| PREDICTED: similar to laminin, alpha 2 (predicted) [Ciona
            intestinalis]
          Length = 2893

 Score = 40.8 bits (94), Expect = 0.45,   Method: Composition-based stats.
 Identities = 41/224 (18%), Positives = 98/224 (43%), Gaps = 40/224 (17%)

Query: 149  SNAENTSKKISDSSRHIQKIIENIEKPLTTTIANIETISTVLANNISHI-----DKMMHT 203
            +N    S   ++++R    I+ ++EK   T+   I+   + LA    ++        + +
Sbjct: 1660 NNVSAFSYNQTEAARRWSNIVRSLEKANKTSSLAIKRAMSALATATRNLGIRANQSFLRS 1719

Query: 204  TQVTPHSSDSKNTFNTITDLITSLDKMIKAID-------------LQKVNQILENIQVSS 250
            T +    ++ +NT N   DL+ SLD  +++ +             L +VN I     VS 
Sbjct: 1720 TDILNEVAELRNTVNGERDLLRSLDDHLRSSNHSSMNLTDQHNRLLARVNMINAAPPVSP 1779

Query: 251  NNFVK---SSDQVINTV------------------HDVRETTQTFQEVGQKIDHLLSDF- 288
            +   +   +S+++++ +                  HDV + ++   E+   +D L     
Sbjct: 1780 DRVFEVTSASNRIVDLLNTRLEKAQENVRLLGEAEHDVSQRSRITMEIADNLDGLTEGMR 1839

Query: 289  SSKMKSKETSAFLENIADSTSNMRSSISAIREITDQRQKIISTI 332
            ++ +  + T   LE +  ++ ++R++IS IR++ ++ ++  + I
Sbjct: 1840 AASIAEERTRNKLEQVQLTSDSVRANISNIRQLIEEARRKAAAI 1883


>gi|123461564|ref|XP_001316844.1| hypothetical protein [Trichomonas vaginalis G3]
 gi|121899562|gb|EAY04621.1| hypothetical protein TVAG_473080 [Trichomonas vaginalis G3]
          Length = 1095

 Score = 40.8 bits (94), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 69/300 (23%), Positives = 145/300 (48%), Gaps = 19/300 (6%)

Query: 133 QRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTIANIETISTVLAN 192
           Q+++ ++     N  ++N EN  K+ +     I K+  NIEK     I N   I+ +  N
Sbjct: 379 QKSLESSNIKAKNLELTN-ENLQKEGNSLKLEISKLNSNIEKLNQEKIENNNKINELQLN 437

Query: 193 NISHIDKMMHTTQVTPHSSDSK-NTFNTITDLITSLDKMIKAIDLQKVNQILENIQVSSN 251
           N   ++ + +  ++    +  K      I DL +  DK  + I  Q   +I+E +     
Sbjct: 438 NEKSLENLQNHQKIIEKLNQEKIEITKKINDLQSVNDKSKENI--QNYEKIIEKLNQEKI 495

Query: 252 NFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNM 311
              K  D++ +     +E  Q  Q++ +K++    +F ++MK K++   +  + +  SN 
Sbjct: 496 ENTKKIDELNDVNEKSKENIQNNQKIIEKLNSKFLEFENQMKEKDSE--IAKLQEENSNF 553

Query: 312 RSSISAIREITDQR--QKIISTINTIENITSNLNDSSQKFAELMSKINNISALKE----- 364
            S++   +E +D+   +KI + IN    + + LND S++  E+  K  N+S+  E     
Sbjct: 554 VSNLQKSKEESDKNLTEKIQNLINDRTKLNNTLNDLSKENKEITEKYQNLSSENEKTKSQ 613

Query: 365 NNSLFKD---AQRAMHTFRDTSEKI---NRYIPSIGNNLQNFSQSGLNDIQNLVRKLQET 418
           N +L K+   A + + T ++ ++++   N+ + +  N+L+ F Q  L ++QN +  ++E+
Sbjct: 614 NQNLEKNLDLATKELSTIKEQNKELVKQNQDMQTELNDLKKFKQENLTNLQNYLNLMKES 673


>gi|294994644|ref|ZP_06800335.1| MCE-family protein mce1B [Mycobacterium tuberculosis 210]
          Length = 135

 Score = 40.8 bits (94), Expect = 0.47,   Method: Composition-based stats.
 Identities = 34/107 (31%), Positives = 51/107 (47%), Gaps = 8/107 (7%)

Query: 10  VGLFVVSILFFS--FFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRFNGIPVGR 67
           +G+  V +LFF+     I+   R ++ +G  AE       +V GL     VR +G+ +G+
Sbjct: 10  LGIVSVVLLFFTVMIIVIFGQMRFDRTNGYTAEF-----SNVSGLRQGQFVRASGVEIGK 64

Query: 68  IVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIEL 114
           +  L L  +       +  I    PLY STTA IR   L G  Y+EL
Sbjct: 65  VKALHL-VDGGRRVRVEFNIDRSVPLYQSTTAQIRYSDLIGNRYVEL 110


>gi|322420103|ref|YP_004199326.1| Mammalian cell entry related domain-containing protein [Geobacter
           sp. M18]
 gi|320126490|gb|ADW14050.1| Mammalian cell entry related domain protein [Geobacter sp. M18]
          Length = 356

 Score = 40.8 bits (94), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 25/102 (24%), Positives = 52/102 (50%), Gaps = 14/102 (13%)

Query: 296 ETSAFLENIADSTSNMRSSISAIREITDQRQKIISTINTI---ENITSNLNDSSQKFAEL 352
           + SA ++++ + T+++ + +  +RE+T +  +   T+  +   E + + L D+S+   E+
Sbjct: 242 DASALIKDLREGTTDLNAGLKDVREMTAKVNRGEGTLGKLVHDETLYTELRDASKNVKEI 301

Query: 353 MSKINN----ISALKENNSLFKD-------AQRAMHTFRDTS 383
             KIN+    I  L   + L++D       A+RAM    DT 
Sbjct: 302 AQKINSGQGTIGKLVNEDQLYRDTTATLKKAERAMEGLGDTG 343


>gi|241767741|ref|ZP_04765356.1| Mammalian cell entry related domain protein [Acidovorax delafieldii
           2AN]
 gi|241361259|gb|EER57840.1| Mammalian cell entry related domain protein [Acidovorax delafieldii
           2AN]
          Length = 325

 Score = 40.8 bits (94), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 36/67 (53%)

Query: 48  SVDGLSTDSSVRFNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLA 107
            V GL   ++VR+ G+ VG++  +  D +   + L +  +    P+ PST A +  QG+ 
Sbjct: 45  GVTGLQPQAAVRYKGVAVGKVTRIGFDPQVAGNVLIRIAVNDQAPITPSTFAVLGYQGVT 104

Query: 108 GITYIEL 114
           G+ ++ L
Sbjct: 105 GLAHVLL 111


>gi|258404806|ref|YP_003197548.1| Mammalian cell entry related domain-containing protein
           [Desulfohalobium retbaense DSM 5692]
 gi|257797033|gb|ACV67970.1| Mammalian cell entry related domain protein [Desulfohalobium
           retbaense DSM 5692]
          Length = 529

 Score = 40.8 bits (94), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 58/274 (21%), Positives = 113/274 (41%), Gaps = 52/274 (18%)

Query: 49  VDGLSTDSSVRFNGIPVGRI--VGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGL 106
           V GL   + V   GI VG++  +GL   +     +L K +  P         A IRT+G+
Sbjct: 49  VSGLKQGAPVEIAGIEVGQVHSIGLADGRAELTLALDKGIAVP-----VDVKAVIRTRGV 103

Query: 107 AGITYIELSTLRKEKKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSR--- 163
            G  ++EL     E   +     E  QR   +++P+ ++  +      ++ IS  S+   
Sbjct: 104 LGDKFVELRGGSPEMPNL-----EEGQRITRSSSPADLDQLLQKVGQIAEDISTVSQSVS 158

Query: 164 ----------HIQKIIENIEKPLTTTI-----ANIETISTVLANNISHIDKMMHTT---- 204
                      +Q I++N+ + LT T+      N E++  ++AN       M   T    
Sbjct: 159 NVFGGEQGEAQLQTIMDNV-RELTVTLNGLVQQNAESVERIVANLDGFTADMREMTARNK 217

Query: 205 -QVTPHSSD-----------SKNTFNTITDLITSLDKMIKAIDLQKVNQILENIQVSSNN 252
            Q+    SD           +    + I  ++T+LD+   +  LQ   Q ++++    + 
Sbjct: 218 DQINDAVSDLGAFAANMREITGENKDGIQRIVTNLDR--ASGKLQTTMQAMQDVLGKVDE 275

Query: 253 FVKSSDQVIN---TVHDVRETTQTFQEVGQKIDH 283
              +   ++N     +D+++T  + + V +KID 
Sbjct: 276 GQGTLGTMVNDEEMAYDLKKTMASLESVSRKIDE 309


>gi|83311843|ref|YP_422107.1| ABC-type transport system involved in resistance to organic
           solvents, periplasmic component [Magnetospirillum
           magneticum AMB-1]
 gi|82946684|dbj|BAE51548.1| ABC-type transport system involved in resistance to organic
           solvents, periplasmic component [Magnetospirillum
           magneticum AMB-1]
          Length = 185

 Score = 40.4 bits (93), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 36/65 (55%), Gaps = 2/65 (3%)

Query: 50  DGLSTDSSVRFNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGI 109
           DG++  S+VR +G  VG++V   LD+ Y   ++    +R D  L   T A I T GL G 
Sbjct: 72  DGINVGSAVRLSGTVVGKVVEQSLDERY--RAVLTLQLRKDIQLTLDTAAVIYTDGLLGA 129

Query: 110 TYIEL 114
            +IEL
Sbjct: 130 KFIEL 134


>gi|283956588|ref|ZP_06374067.1| methyl-accepting chemotaxis protein [Campylobacter jejuni subsp.
           jejuni 1336]
 gi|283791837|gb|EFC30627.1| methyl-accepting chemotaxis protein [Campylobacter jejuni subsp.
           jejuni 1336]
          Length = 459

 Score = 40.4 bits (93), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 63/254 (24%), Positives = 105/254 (41%), Gaps = 41/254 (16%)

Query: 184 ETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVNQIL 243
           E +  + A+NI  I+K +   +VT  S+       T+ DL            L   N+ +
Sbjct: 122 EGLKGIFAHNIEFINKALANIEVTARSTFKNALSRTLMDL-----------SLGNQNKDM 170

Query: 244 ENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKM----KSKETSA 299
             I  S N  +     V +TV  +   T T  E G ++D L S   S M     SKET  
Sbjct: 171 SQISSSLNQDISMMKNVYDTVDAI---THTATENGSEVDSLQSAMGSLMDVVNSSKET-- 225

Query: 300 FLENIADSTSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNI 359
            ++    ++ N+ S +  IR+I DQ   +++    IE   +   +  + FA +  ++  +
Sbjct: 226 -VQTFVANSQNITSVVEVIRDIADQ-TNLLALNAAIE--AARAGEHGRGFAVVADEVRKL 281

Query: 360 SALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETV 419
                          A  T R TSE I+  I ++  +  N  QSG + + N+V + +E +
Sbjct: 282 ---------------AERTQRSTSE-ISIAIQTMQQDFVNI-QSGSDQVFNIVSESEERI 324

Query: 420 NHFDDCLNNFERNP 433
           N F       E N 
Sbjct: 325 NKFSQAFKRLEENS 338


>gi|241667293|ref|ZP_04754871.1| hypothetical protein FphipA2_00895 [Francisella philomiragia subsp.
           philomiragia ATCC 25015]
 gi|254875844|ref|ZP_05248554.1| ABC transporter [Francisella philomiragia subsp. philomiragia ATCC
           25015]
 gi|254841865|gb|EET20279.1| ABC transporter [Francisella philomiragia subsp. philomiragia ATCC
           25015]
          Length = 176

 Score = 40.4 bits (93), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 40/143 (27%), Positives = 68/143 (47%), Gaps = 15/143 (10%)

Query: 1   MESKNYYTSVGLFV---VSILFFSFFSIYWLS----RSNQYDGPMAEVIIRIPGSVDGLS 53
           M +K++ TSVG+F+   V  L F  F +   S     SN+Y     E   +  GS   L 
Sbjct: 1   MRNKHFETSVGIFIIIGVLCLIFLTFKVSGTSFKSFGSNEY---TIEADFKNVGS---LR 54

Query: 54  TDSSVRFNGIPVGRIVGLFLDQEYPNH-SLAKALIRPDTPLYPSTTATIRTQGLAGITYI 112
           T++SV+  G+ +GR+  + L++ Y    ++    I  D  +  + +A I   G+ G  Y+
Sbjct: 55  TNASVKIAGVEIGRVTKISLEKTYNGFMAVVTIAINSDKKIPANYSAAIAMSGILGDNYV 114

Query: 113 ELSTLRKEKKTIFQIA-TERNQR 134
            L+   ++  +I  I  TE N  
Sbjct: 115 ALTPPSEDIMSIAGIGDTENNSE 137


>gi|328675484|gb|AEB28159.1| Mce-related protein [Francisella cf. novicida 3523]
          Length = 177

 Score = 40.4 bits (93), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 34/130 (26%), Positives = 61/130 (46%), Gaps = 2/130 (1%)

Query: 1   MESKNYYTSVGLF-VVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVR 59
           M +K + TSVG+F +V +L   F +      S +        I     +V  L T++SV+
Sbjct: 1   MRNKYFETSVGIFIIVGVLCLLFLTFKVSGTSFKAFNTQEYTITADFKNVGSLRTNASVK 60

Query: 60  FNGIPVGRIVGLFLDQEYPNH-SLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLR 118
             G+ +GR+  + L++ Y    ++    I  D  +  + +A+I   G+ G  Y+ LS   
Sbjct: 61  IAGVEIGRVTKIALEKSYNGFMAVVTMAINSDKKIPANYSASIAMSGILGDNYVALSPPS 120

Query: 119 KEKKTIFQIA 128
           ++   I  IA
Sbjct: 121 EDIMAIAGIA 130


>gi|91091932|ref|XP_966409.1| PREDICTED: similar to structural maintenance of chromosomes smc3
           isoform 1 [Tribolium castaneum]
 gi|270000783|gb|EEZ97230.1| hypothetical protein TcasGA2_TC011028 [Tribolium castaneum]
          Length = 1203

 Score = 40.4 bits (93), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 66/312 (21%), Positives = 133/312 (42%), Gaps = 47/312 (15%)

Query: 122 KTIFQIATERNQ----RAMITATPSGINYFISNAENTSKKISDSS----------RHIQK 167
           +TI QI+   N+    R  +T T + IN  +S  + T  K S +           R +++
Sbjct: 685 ETIQQISQCENELKSLREELTKTEASINSIVSEMQKTETKNSKAKGIYDKVKGELRLMKE 744

Query: 168 IIENIEK---PLTTTIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLI 224
            + NIE+   P   ++A  ++    + +    ++  +H   ++  S   +   +T+ D I
Sbjct: 745 ELSNIERFRGPKERSLAQCKSSLEAMQSTQEGLESELHQELLSQLSFADQAEVDTLNDDI 804

Query: 225 TSLDKMIKA-----IDLQKVNQILENIQVSSNNFVKSSDQVINTVHDV------RETTQT 273
             L K  K      + L+     LEN+   +NN ++  D+V++ + ++      R+   +
Sbjct: 805 QRLQKENKEAFSTRMKLEAEKNKLENL--LTNNLIRRRDEVLHALQEISLEDRKRQLVNS 862

Query: 274 ---FQEVGQKIDHLLSDFSS-KMKSKETSAFLENIADSTSNMRSSISAIREITDQRQKII 329
               +E+ +KI+ +  + +S + K KE +  L+       N +      ++  D + KI 
Sbjct: 863 KSDLEEIDRKIERVNRELTSMESKVKEMAKRLKTEQGELENWK------KKEKDAQDKID 916

Query: 330 STINTIENITSNLNDSSQKFAELMSKINNISALKENNSLFKDAQRAMHTFRDTSEKINRY 389
                +E   +  N   QK  E + KIN + AL   + L+       H  + +S  + + 
Sbjct: 917 EDAKHLEKYATKQNLLEQKIQECVEKINQLGALPAQD-LYS------HYVKMSSRSLFKE 969

Query: 390 IPSIGNNLQNFS 401
           +    N L+ FS
Sbjct: 970 LEKTNNQLKKFS 981


>gi|223937295|ref|ZP_03629201.1| Mammalian cell entry related domain protein [bacterium Ellin514]
 gi|223894080|gb|EEF60535.1| Mammalian cell entry related domain protein [bacterium Ellin514]
          Length = 325

 Score = 40.4 bits (93), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 51/243 (20%), Positives = 107/243 (44%), Gaps = 26/243 (10%)

Query: 8   TSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRFNGIPVGR 67
           T +G+FV+  +  +F  +  +   N +  P   +  R   ++  L    +V+  G+PVG+
Sbjct: 7   TRLGIFVLLAVLAAFIILELIGGVNIFK-PGYHLRARF-NNIQDLKVGDAVKMAGVPVGQ 64

Query: 68  IVGLFLDQEYPNHSLAKALIR--PDTPLYPSTTATIRTQGLAGITYIELSTLRKEKKTIF 125
           +  +   Q   N +  + ++R   DTP++  + ATI+  GL G  ++ L         + 
Sbjct: 65  VEKI---QLATNEAKVEVVLRLNKDTPVHTDSKATIKFTGLMGNYFVALDFGNPNSPKM- 120

Query: 126 QIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHI-QKIIENIEKP--------- 175
               E+NQ    T  P  ++  I+  ++ +  + + ++      I+N+  P         
Sbjct: 121 ----EQNQLIATTEQPD-LSTLIAKLDDVASGVQNLTKSFTGDKIDNLLGPFTDFMRQNN 175

Query: 176 --LTTTIANIETISTVLANNISHIDKMMHTTQVTPHSSDS-KNTFNTITDLITSLDKMIK 232
             L+  IAN + IS  +A     + K+++   +   +  S  N  NT T++  ++ +  K
Sbjct: 176 PKLSAIIANFQGISGQIAEGKGTVGKLIYDDSLYNSAYASVTNLQNTATEIQQTVAEARK 235

Query: 233 AID 235
            +D
Sbjct: 236 VVD 238


>gi|169342271|ref|ZP_02863351.1| putative phage infection protein [Clostridium perfringens C str.
           JGS1495]
 gi|169299652|gb|EDS81710.1| putative phage infection protein [Clostridium perfringens C str.
           JGS1495]
          Length = 721

 Score = 40.4 bits (93), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 56/253 (22%), Positives = 114/253 (45%), Gaps = 24/253 (9%)

Query: 130 ERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTIANIETISTV 189
           E  Q  M + T SG+N    NAENT   I+ S   +    +NI   L+ +  +++ + + 
Sbjct: 228 EEVQSTMPSIT-SGLNNISQNAENTCTLINTSKESLNSTFDNIRLNLSESQTSLDKVQSN 286

Query: 190 LANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVNQILENIQVS 249
           L +++S +     + ++    S S N  + + + +T++   + AI+ +  N+ + N+  S
Sbjct: 287 L-DDLSSMANDASSAKINALISKSINEIDKVDNSVTAVINFLDAINKKIANEKIANMITS 345

Query: 250 SNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSK----------ETSA 299
             N   S  +    ++D++    + Q V + +   +SD + K++ +          +T  
Sbjct: 346 LKNIQNSLAEEKTKLNDLQSKVNSGQNVDKGLLSSISDLTKKIEGQVDNSLNRFDNDTRP 405

Query: 300 FLENIAD----STSNMRSSISAIREITDQRQKIISTIN--------TIENITSNLNDSSQ 347
            L  IAD    +T      +     + DQ   ++ST N        T E + ++L + S 
Sbjct: 406 ALNTIADGLVTATKGASDLLGKANGLVDQINNLLSTANQGSQLANSTSEKLKNSLEEFSG 465

Query: 348 KFAELMSKINNIS 360
             +EL SK+ ++S
Sbjct: 466 VISELSSKLQDVS 478


>gi|182626487|ref|ZP_02954237.1| putative phage infection protein [Clostridium perfringens D str.
           JGS1721]
 gi|177908173|gb|EDT70737.1| putative phage infection protein [Clostridium perfringens D str.
           JGS1721]
          Length = 721

 Score = 40.4 bits (93), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 56/253 (22%), Positives = 114/253 (45%), Gaps = 24/253 (9%)

Query: 130 ERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTIANIETISTV 189
           E  Q  M + T SG+N    NAENT   I+ S   +    +NI   L+ +  +++ + + 
Sbjct: 228 EEVQSTMPSIT-SGLNNISQNAENTGTLINTSKESLNSTFDNIRLNLSESQTSLDKVQSN 286

Query: 190 LANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVNQILENIQVS 249
           L +++S +     + ++    S S N  + + + +T++   + AI+ +  N+ + N+  S
Sbjct: 287 L-DDLSSMANDASSAKINALISKSINEIDKVDNSVTAVINFLDAINKKIANEKIANMITS 345

Query: 250 SNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSK----------ETSA 299
             N   S  +    ++D++    + Q V + +   +SD + K++ +          +T  
Sbjct: 346 LKNVQNSLAEEKTKLNDLQSKVNSGQNVDKGLLSSISDLTKKIEGQVDNSLNRFDNDTRP 405

Query: 300 FLENIAD----STSNMRSSISAIREITDQRQKIISTIN--------TIENITSNLNDSSQ 347
            L  IAD    +T      +     + DQ   ++ST N        T E + ++L + S 
Sbjct: 406 ALNTIADGLVTATKGASDLLGKANGLVDQINNLLSTANQGSQLANSTSEKLKNSLEEFSG 465

Query: 348 KFAELMSKINNIS 360
             +EL SK+ ++S
Sbjct: 466 VISELSSKLQDVS 478


>gi|168207926|ref|ZP_02633931.1| putative phage infection protein [Clostridium perfringens E str.
           JGS1987]
 gi|170660770|gb|EDT13453.1| putative phage infection protein [Clostridium perfringens E str.
           JGS1987]
          Length = 721

 Score = 40.4 bits (93), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 56/253 (22%), Positives = 114/253 (45%), Gaps = 24/253 (9%)

Query: 130 ERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTIANIETISTV 189
           E  Q  M + T SG+N    NAENT   I+ S   +    +NI   L+ +  +++ + + 
Sbjct: 228 EEVQSTMPSIT-SGLNNISQNAENTGTLINTSKESLNSTFDNIRLNLSESQTSLDKVQSN 286

Query: 190 LANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVNQILENIQVS 249
           L +++S +     + ++    S S N  + + + +T++   + AI+ +  N+ + N+  S
Sbjct: 287 L-DDLSSMANDASSAKINALISKSINEIDKVDNSVTAVINFLDAINKKIANEKIANMITS 345

Query: 250 SNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSK----------ETSA 299
             N   S  +    ++D++    + Q V + +   +SD + K++ +          +T  
Sbjct: 346 LKNIQNSLAEEKTKLNDLQSKVNSGQNVDKGLLSSISDLTKKIEGQVDNSLNRFDNDTRP 405

Query: 300 FLENIAD----STSNMRSSISAIREITDQRQKIISTIN--------TIENITSNLNDSSQ 347
            L  IAD    +T      +     + DQ   ++ST N        T E + ++L + S 
Sbjct: 406 ALNTIADGLVTATKGASDLLGKANGLVDQINNLLSTANQGSQLANSTSEKLKNSLEEFSG 465

Query: 348 KFAELMSKINNIS 360
             +EL SK+ ++S
Sbjct: 466 VISELSSKLQDVS 478


>gi|18311573|ref|NP_563507.1| phage infection protein [Clostridium perfringens str. 13]
 gi|168214949|ref|ZP_02640574.1| putative phage infection protein [Clostridium perfringens CPE str.
           F4969]
 gi|18146257|dbj|BAB82297.1| phage infection protein [Clostridium perfringens str. 13]
 gi|170713633|gb|EDT25815.1| putative phage infection protein [Clostridium perfringens CPE str.
           F4969]
          Length = 721

 Score = 40.4 bits (93), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 56/253 (22%), Positives = 114/253 (45%), Gaps = 24/253 (9%)

Query: 130 ERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTIANIETISTV 189
           E  Q  M + T SG+N    NAENT   I+ S   +    +NI   L+ +  +++ + + 
Sbjct: 228 EEVQSTMPSIT-SGLNNISQNAENTGTLINTSKESLNSTFDNIRLNLSESQTSLDKVQSN 286

Query: 190 LANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVNQILENIQVS 249
           L +++S +     + ++    S S N  + + + +T++   + AI+ +  N+ + N+  S
Sbjct: 287 L-DDLSSMANDASSAKINALISKSINEIDKVDNSVTAVINFLDAINKKIANEKIANMITS 345

Query: 250 SNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSK----------ETSA 299
             N   S  +    ++D++    + Q V + +   +SD + K++ +          +T  
Sbjct: 346 LKNVQNSLAEEKTKLNDLQSKVNSGQNVDKGLLSSISDLTKKIEGQVDNSLNRFDNDTRP 405

Query: 300 FLENIAD----STSNMRSSISAIREITDQRQKIISTIN--------TIENITSNLNDSSQ 347
            L  IAD    +T      +     + DQ   ++ST N        T E + ++L + S 
Sbjct: 406 ALNTIADGLVTATKGASDLLGKANGLVDQINNLLSTANQGSQLANSTSEKLKNSLEEFSG 465

Query: 348 KFAELMSKINNIS 360
             +EL SK+ ++S
Sbjct: 466 VISELSSKLQDVS 478


>gi|168209833|ref|ZP_02635458.1| putative phage infection protein [Clostridium perfringens B str.
           ATCC 3626]
 gi|170712103|gb|EDT24285.1| putative phage infection protein [Clostridium perfringens B str.
           ATCC 3626]
          Length = 721

 Score = 40.0 bits (92), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 56/253 (22%), Positives = 114/253 (45%), Gaps = 24/253 (9%)

Query: 130 ERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTIANIETISTV 189
           E  Q  M + T SG+N    NAENT   I+ S   +    +NI   L+ +  +++ + + 
Sbjct: 228 EEVQSTMPSIT-SGLNNISQNAENTGTLINTSKESLNSTFDNIRLNLSESQTSLDKVQSN 286

Query: 190 LANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVNQILENIQVS 249
           L +++S +     + ++    S S N  + + + +T++   + AI+ +  N+ + N+  S
Sbjct: 287 L-DDLSSMANDASSAKINALISKSINEIDKVDNSVTAVINFLDAINKKIANEKIANMITS 345

Query: 250 SNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSK----------ETSA 299
             N   S  +    ++D++    + Q V + +   +SD + K++ +          +T  
Sbjct: 346 LKNVQNSLAEEKTKLNDLQSKVNSGQNVDKGLLSSISDLTKKIEGQVDNSLNRFDNDTRP 405

Query: 300 FLENIAD----STSNMRSSISAIREITDQRQKIISTIN--------TIENITSNLNDSSQ 347
            L  IAD    +T      +     + DQ   ++ST N        T E + ++L + S 
Sbjct: 406 ALNTIADGLVTATKGASDLLGKANGLVDQINNLLSTANQGSQLANSTSEKLKNSLEEFSG 465

Query: 348 KFAELMSKINNIS 360
             +EL SK+ ++S
Sbjct: 466 VISELSSKLQDVS 478


>gi|77918064|ref|YP_355879.1| ABC transporter protein [Pelobacter carbinolicus DSM 2380]
 gi|77544147|gb|ABA87709.1| ABC-type transport system protein [Pelobacter carbinolicus DSM
           2380]
          Length = 148

 Score = 40.0 bits (92), Expect = 0.75,   Method: Composition-based stats.
 Identities = 33/116 (28%), Positives = 55/116 (47%), Gaps = 4/116 (3%)

Query: 1   MESKNYYTSVGLFVVS-ILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVR 59
           M+  N   +VG+F+V+  + F++ S+  L   + +      +  R  GSV GL   + V 
Sbjct: 1   MKRFNVEMAVGIFLVAGFICFAYLSVK-LGDVDWFGDKTYAISARF-GSVSGLKEGAVVE 58

Query: 60  FNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELS 115
             G+ +G +  + LD E     L    I     L   + A+IRT G+ G  Y+E+S
Sbjct: 59  LAGVKIGTVSRITLDPEKYEAVLGMD-IDAKVQLQEDSIASIRTSGIIGDKYVEVS 113


>gi|163782389|ref|ZP_02177387.1| hypothetical protein HG1285_06365 [Hydrogenivirga sp. 128-5-R1-1]
 gi|159882422|gb|EDP75928.1| hypothetical protein HG1285_06365 [Hydrogenivirga sp. 128-5-R1-1]
          Length = 523

 Score = 40.0 bits (92), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 61/276 (22%), Positives = 124/276 (44%), Gaps = 49/276 (17%)

Query: 49  VDGLSTDSSVRFNGIPVGRIVGLFLDQEYPNHSLAKAL--IRPDTPLYPSTTATIRTQGL 106
           V GLS  + VR +GI  G++  + L+      S  K +  +     L+   +ATI T GL
Sbjct: 47  VGGLSKGAEVRVSGIRAGKVEEITLE-----DSRVKVVFNVERRIRLFKDASATIGTLGL 101

Query: 107 AGITYI----------ELSTLRKEKKTIFQIATERNQRAMITATPSGINYFISNAENTSK 156
            G  Y+          EL+     K       T+R  R + T T  G   F   AEN ++
Sbjct: 102 MGDKYLAVNPGTPSAGELAEGESLKTAEGVADTDRLIREL-TRTAEG---FKLVAENLNR 157

Query: 157 KISDSSRHIQKIIENI--------------EKPLTTTIANI----ETISTVLANNISHID 198
            + ++ R++++ +EN+              ++ L   +A +    E++++ L   IS ID
Sbjct: 158 ILEENRRNLRETLENLNALTQTLRRMAEENQQNLKVVLAEMAQLTESLNSTLPEAISSID 217

Query: 199 KMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVNQILENIQVSSNNF---VK 255
           ++    ++T  +S+++     +   + S+   ++     ++ Q++EN+   S N    VK
Sbjct: 218 RLAD--ELTGIASENREDIRVLVANLKSISDELRG----ELPQLVENMNTLSKNLNEVVK 271

Query: 256 SSDQVINT-VHDVRETTQTFQEVGQKIDHLLSDFSS 290
            + + + T + ++ E T   +    ++D++L+   S
Sbjct: 272 ENRRDLRTAIQNLSEMTARLRRSSNRLDNILAKIES 307


>gi|297569268|ref|YP_003690612.1| Mammalian cell entry related domain protein [Desulfurivibrio
           alkaliphilus AHT2]
 gi|296925183|gb|ADH85993.1| Mammalian cell entry related domain protein [Desulfurivibrio
           alkaliphilus AHT2]
          Length = 148

 Score = 40.0 bits (92), Expect = 0.79,   Method: Composition-based stats.
 Identities = 34/112 (30%), Positives = 53/112 (47%), Gaps = 14/112 (12%)

Query: 10  VGLFVVSILF-FSFFSIYW-----LSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRFNGI 63
           VGLFV++  F F + S+       LS+  QY    AE      G++ GL   + V   G+
Sbjct: 10  VGLFVLAGFFSFVYLSVQLGDFAPLSKRQQYQ-LQAEF-----GNISGLRRGAVVEIAGV 63

Query: 64  PVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELS 115
            VGR+  + L +     +L    I     L   + A+++TQG+ G  YI +S
Sbjct: 64  GVGRVGAIELSER--QRALVTLYIDRAVELSEDSIASVKTQGIIGEKYISIS 113


>gi|325673334|ref|ZP_08153026.1| hypothetical protein HMPREF0724_10808 [Rhodococcus equi ATCC 33707]
 gi|325555924|gb|EGD25594.1| hypothetical protein HMPREF0724_10808 [Rhodococcus equi ATCC 33707]
          Length = 356

 Score = 40.0 bits (92), Expect = 0.83,   Method: Compositional matrix adjust.
 Identities = 40/194 (20%), Positives = 82/194 (42%), Gaps = 32/194 (16%)

Query: 25  IYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRFNGIPVGRIVGLFLDQEYPNHSLAK 84
           +++LSR++ Y   +A        +  GLS    V   G+P GR+ G+ +     +H    
Sbjct: 54  LWYLSRTSPYSAELA--------NASGLSDGDPVYVAGVPAGRVEGIDIAG---DHVRVD 102

Query: 85  ALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKEKKTIFQIATERNQRAMI------- 137
             +    PL   TTA++R + + G  Y+E+            + T  N  A         
Sbjct: 103 FRLDDGQPLGNRTTASVRLETVLGKRYLEV--------VPAGVVTAENADATAANVIPLA 154

Query: 138 -TATPSGINYFISNAENTSKKISDSS-----RHIQKIIENIEKPLTTTIANIETISTVLA 191
            T  P  ++    +A + + +I  +S     R + +++ +  + L   +A +   S V++
Sbjct: 155 RTTVPYSLDDISRDATDAATEIDTASLEAMMRTLSEVMPDDPEQLGRVLAGVSGASAVVS 214

Query: 192 NNISHIDKMMHTTQ 205
            N   ID+++  ++
Sbjct: 215 RNAEQIDQLLEMSR 228


>gi|212702435|ref|ZP_03310563.1| hypothetical protein DESPIG_00452 [Desulfovibrio piger ATCC
          29098]
 gi|212674096|gb|EEB34579.1| hypothetical protein DESPIG_00452 [Desulfovibrio piger ATCC
          29098]
          Length = 317

 Score = 40.0 bits (92), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 38/74 (51%), Gaps = 1/74 (1%)

Query: 1  MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
          M  +++ T+VG FV+  L      I  L     +   + E ++   GSV GL+  + V F
Sbjct: 1  MAKQSFKTAVGAFVIGGLALLVAGIILLGGGRMFSDDI-EYVLYFDGSVSGLNIGAPVVF 59

Query: 61 NGIPVGRIVGLFLD 74
           G+P+G++  + L+
Sbjct: 60 RGVPMGQVTRISLE 73


>gi|330993002|ref|ZP_08316941.1| putative phospholipid ABC transporter-binding protein mlaD
           [Gluconacetobacter sp. SXCC-1]
 gi|329759934|gb|EGG76439.1| putative phospholipid ABC transporter-binding protein mlaD
           [Gluconacetobacter sp. SXCC-1]
          Length = 190

 Score = 39.7 bits (91), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 30/75 (40%), Positives = 37/75 (49%), Gaps = 5/75 (6%)

Query: 49  VDGLSTDSSVRFNGIPVGRIVGLFLDQEYPNHSLAKA--LIRPDTPLYPSTTATIRTQGL 106
           +DGLS  S VR  GI VG++V   +D   P    A+    +RPD  L   T A I +  L
Sbjct: 66  IDGLSIGSDVRLAGITVGQVVAERVD---PKTYAAQVTFTVRPDIRLPDDTAAIITSDSL 122

Query: 107 AGITYIELSTLRKEK 121
            G  YI LS    EK
Sbjct: 123 LGGKYIALSPGGDEK 137


>gi|257092689|ref|YP_003166330.1| Mammalian cell entry related domain-containing protein [Candidatus
           Accumulibacter phosphatis clade IIA str. UW-1]
 gi|257045213|gb|ACV34401.1| Mammalian cell entry related domain protein [Candidatus
           Accumulibacter phosphatis clade IIA str. UW-1]
          Length = 311

 Score = 39.7 bits (91), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 57/271 (21%), Positives = 103/271 (38%), Gaps = 52/271 (19%)

Query: 24  SIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRFNGIPVGRIVGLFLDQEYPNHSLA 83
           SI+W    ++      E  +    +V GLS    VR+ GI VG++  + LD +   + L 
Sbjct: 24  SIWWFGGRHEA---TKEYTVVTRQNVTGLSLQGQVRYRGIRVGKVQSIELDPQDVRNILV 80

Query: 84  KALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKEKKTIFQIATERNQRAMITATPSG 143
           +  +    P+   TTA +  QG+ GI +I L     +                  ATP  
Sbjct: 81  RINVDRAVPVTQGTTAKLGYQGITGIAHILLEDRGAD------------------ATP-- 120

Query: 144 INYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTIANIETISTVLANNISHIDKMMHT 203
               +   E  S +I+  S     +IE +    T T+     + T  AN +   +   H 
Sbjct: 121 ----LVGGEGESPRIAMQS----SLIEELSDAGTATLRQARDLLTS-ANQVLDAENRQHL 171

Query: 204 TQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVNQIL--ENIQVSSNNFVK---SSD 258
           T +  +   +    N  T               +++ Q+L  EN+++      +   ++ 
Sbjct: 172 TNILANLDATTGNANAAT---------------RQLRQLLAPENVRLLQTTLARAEQAAG 216

Query: 259 QVINTVHDVRETTQTFQEVGQKIDHLLSDFS 289
           +    + + R      Q V +K+D L+ D S
Sbjct: 217 EAAPALVEARRLLVRLQSVSEKLDQLIGDPS 247


>gi|315932334|gb|EFV11277.1| methyl-accepting chemotaxis protein (MCP) signaling domain protein
           [Campylobacter jejuni subsp. jejuni 327]
          Length = 459

 Score = 39.7 bits (91), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 63/254 (24%), Positives = 104/254 (40%), Gaps = 41/254 (16%)

Query: 184 ETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVNQIL 243
           E +  + A+NI  I+K +   +VT  S+       T+ DL            L   N+ +
Sbjct: 122 EGLKGIFAHNIEFINKALANIEVTARSTFKNALSRTLMDL-----------SLGNQNKDM 170

Query: 244 ENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKM----KSKETSA 299
             I  S N  +     V +TV  +   T T  E G ++D L S   S M     SKET  
Sbjct: 171 SQISSSLNQDISMMKNVYDTVDAI---THTATENGSEVDSLQSAMGSLMDVVNSSKET-- 225

Query: 300 FLENIADSTSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNI 359
            ++    ++ N+ S +  IR+I DQ   +++    IE   +   +  + FA +  ++  +
Sbjct: 226 -VQTFVANSQNITSVVEVIRDIADQ-TNLLALNAAIE--AARAGEHGRGFAVVADEVRKL 281

Query: 360 SALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETV 419
                          A  T R TSE I+  I ++  +  N  QSG   + N+V + +E +
Sbjct: 282 ---------------AERTQRSTSE-ISIAIQTMQQDFVNI-QSGSEQVFNIVSESEERI 324

Query: 420 NHFDDCLNNFERNP 433
           N F       E N 
Sbjct: 325 NKFSQAFKRLEENS 338


>gi|121534947|ref|ZP_01666766.1| Mammalian cell entry related domain protein [Thermosinus
           carboxydivorans Nor1]
 gi|121306546|gb|EAX47469.1| Mammalian cell entry related domain protein [Thermosinus
           carboxydivorans Nor1]
          Length = 424

 Score = 39.7 bits (91), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 53/293 (18%), Positives = 113/293 (38%), Gaps = 48/293 (16%)

Query: 49  VDGLSTDSSVRFNGIPVGRIVGLFLDQEY---PNHSLAKALIRPDTPLYPSTTATIRTQG 105
           V GL   + VR+ G+ VGR+      QE    P       LI P   +      TI T G
Sbjct: 46  VSGLKEGNIVRYAGVEVGRV------QEVAVVPEGVKVHLLINPGVKIPQGAQFTIGTDG 99

Query: 106 LAGITYIELSTLRKEKKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHI 165
           L G  +I +         +   A  R +       P G++  I+ A+     I    + +
Sbjct: 100 LLGEKFINILPPATNSGFLSPGAHVRGE------DPQGLDQLIATADRVLLDIQALVKSL 153

Query: 166 QKII--ENIEKPLTTTIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDL 223
            +++  E ++  +   + N   I+    N+++ +   M           +KN+   I D 
Sbjct: 154 NEVLGDEKVKGAMKEALLNAREIT----NHLNELSASMARM--------AKNSEGDIQDT 201

Query: 224 ITSLDKMIKAIDLQKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDH 283
           + +L  M  +         L ++    +  +   D    T  D+RET +  +    +++ 
Sbjct: 202 VRNLRTMSGS---------LRDVAARVDRLMTEVDNNGRTAKDLRETIENLKTTSARVEK 252

Query: 284 LLSDFSSKMKSKETSAFLENIADSTSNMRSSISAIREITDQRQKIISTINTIE 336
           + +     +   ET+           N++ ++   RE +++  +++  +N+++
Sbjct: 253 MAASLEGVVTDPETA----------RNLKETLRNAREASEKANRMLGKVNSVK 295


>gi|284039748|ref|YP_003389678.1| hypothetical protein Slin_4901 [Spirosoma linguale DSM 74]
 gi|283819041|gb|ADB40879.1| Mammalian cell entry related domain protein [Spirosoma linguale DSM
           74]
          Length = 328

 Score = 39.7 bits (91), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 29/106 (27%), Positives = 46/106 (43%), Gaps = 2/106 (1%)

Query: 10  VGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRFNGIPVGRIV 69
           VGL  V  L   +F   +L  S+ +       +I    ++DGL   + VR NG+ VG++ 
Sbjct: 9   VGLLAVVSLMMLYFGFRFLKGSDFFSSTHKYQVIY--SNIDGLVASNPVRINGLTVGQVK 66

Query: 70  GLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELS 115
            + + QE  N  L    ++    +   T A +   GL G   I L 
Sbjct: 67  SIEILQEQQNKMLVTLELKKGIIVTQGTRAVLADDGLLGGKLIRLG 112


>gi|305431779|ref|ZP_07400946.1| methyl-accepting chemotaxis protein [Campylobacter coli JV20]
 gi|304444863|gb|EFM37509.1| methyl-accepting chemotaxis protein [Campylobacter coli JV20]
          Length = 459

 Score = 39.7 bits (91), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 63/254 (24%), Positives = 104/254 (40%), Gaps = 41/254 (16%)

Query: 184 ETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVNQIL 243
           E +  + A+NI  I+K +   +VT  S+       T+ DL            L   N+ +
Sbjct: 122 EGLKGIFAHNIEFINKALANIEVTARSTFKNALSRTLMDL-----------SLGNQNKDM 170

Query: 244 ENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKM----KSKETSA 299
             I  S N  +     V +TV  +   T T  E G ++D L S   S M     SKET  
Sbjct: 171 SQISSSLNQDISMMKNVYDTVDAI---THTATENGSEVDSLQSAMGSLMDVVNSSKET-- 225

Query: 300 FLENIADSTSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNI 359
            ++    ++ N+ S +  IR+I DQ   +++    IE   +   +  + FA +  ++  +
Sbjct: 226 -VQTFVANSQNITSVVEVIRDIADQ-TNLLALNAAIE--AARAGEHGRGFAVVADEVRKL 281

Query: 360 SALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETV 419
                          A  T R TSE I+  I ++  +  N  QSG   + N+V + +E +
Sbjct: 282 ---------------AERTQRSTSE-ISIAIQTMQQDFVNI-QSGSEQVFNIVSESEERI 324

Query: 420 NHFDDCLNNFERNP 433
           N F       E N 
Sbjct: 325 NKFSQAFKRLEENS 338


>gi|295693417|ref|YP_003602027.1| DNA repair atpase [Lactobacillus crispatus ST1]
 gi|295031523|emb|CBL51002.1| DNA repair ATPase [Lactobacillus crispatus ST1]
          Length = 831

 Score = 39.7 bits (91), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 31/117 (26%), Positives = 55/117 (47%), Gaps = 3/117 (2%)

Query: 318 IREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNISALKENNSLFKDAQRAMH 377
           ++E+TDQR K+  T N   +      D  QK A L  +  +++ L++      D Q+ M 
Sbjct: 194 LKEMTDQRDKLAQTKNEFNDYEQLHQDFVQKRAALNRQKKDLAVLQKQEQDLHDLQKEMG 253

Query: 378 TFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFERNPQ 434
            ++ T   + + +  I  N QN+ ++   DI    R LQ+T+   +  L +   N Q
Sbjct: 254 NYQ-TLLDLQKQVKDIDFNGQNYQKA--QDIMAQGRNLQKTIQSVEAQLQDLGENDQ 307


>gi|242278701|ref|YP_002990830.1| mammalian cell entry related domain protein [Desulfovibrio
           salexigens DSM 2638]
 gi|242121595|gb|ACS79291.1| Mammalian cell entry related domain protein [Desulfovibrio
           salexigens DSM 2638]
          Length = 385

 Score = 39.7 bits (91), Expect = 0.94,   Method: Compositional matrix adjust.
 Identities = 78/423 (18%), Positives = 162/423 (38%), Gaps = 110/423 (26%)

Query: 10  VGLFVV--SILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRFNGIPVGR 67
           +GLF++  +ILF S  +I    +  +    M   +     SV+GL   S ++F G+ +G 
Sbjct: 10  LGLFIIIGTILFVSVLAILGAGKIFEQSVKMETYLNE---SVNGLEVGSPIKFRGVKIGT 66

Query: 68  I--VGLFLD-----------------------------QEYPNHSLAKALIRPDTPLYPS 96
           +  +G   D                             QE   H+L K + R        
Sbjct: 67  VSQIGFVTDHYVDLKQSALRYVYLLGDLNHKMFKTKEGQELV-HALKKEVDR-------G 118

Query: 97  TTATIRTQGLAGITYIELSTLRKEKKTIFQIATERNQRAMITATPSGINYFISNAENTSK 156
             A   + GL G  ++E+  +   K    +IA  + +   + + PS     +S  E+   
Sbjct: 119 LRARPVSLGLTGQLFLEIDYVDPVKNPPLEIAW-KPKHIYVPSAPS----MMSKVESAVA 173

Query: 157 KISDSSRHIQKIIENIEKPLTTTIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNT 216
            ISD+   I K   NI + +    +  +++ST L N                  SD+   
Sbjct: 174 SISDTLEDINK--ANIAEAIEDVRSVAQSMSTFLKN------------------SDTGEI 213

Query: 217 FNTITDLITSLDKMIKAIDL----QKVNQILENIQVSSNNFV----KSSDQVINTVHDVR 268
              +T  +T  +K I  ++      +V+ ++ ++  ++ N       SS  ++  + D+R
Sbjct: 214 SKRLTGTLTEAEKFIARVNQLLADPEVDNLMPDVAAAARNLRTVMESSSGDIVAAMKDIR 273

Query: 269 ETTQTFQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNMRSSISAIREITDQRQKI 328
           + +++ + V   ++  LS    K    + S  L NI+++++ ++                
Sbjct: 274 KASESAKNVTGGMEEYLSGPKGKQTLADLSNTLNNISEASNRIKG--------------- 318

Query: 329 ISTINTIENITSNLNDSSQKFAELMSKINNISALKENN--SLFKDAQRAMHTFRDTSEKI 386
                           ++ +F   +S++N   A ++ N  ++  + +R M   R+ S + 
Sbjct: 319 ----------------AAARFESTLSRVNMTVAGQQGNIEAILDNVRRLMENLRELSNEA 362

Query: 387 NRY 389
            +Y
Sbjct: 363 RQY 365


>gi|168217357|ref|ZP_02642982.1| putative phage infection protein [Clostridium perfringens NCTC
           8239]
 gi|182380576|gb|EDT78055.1| putative phage infection protein [Clostridium perfringens NCTC
           8239]
          Length = 721

 Score = 39.7 bits (91), Expect = 0.98,   Method: Compositional matrix adjust.
 Identities = 56/253 (22%), Positives = 114/253 (45%), Gaps = 24/253 (9%)

Query: 130 ERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTIANIETISTV 189
           E  Q  M + T SG+N    NAENT   I+ S   +    +NI   L+ +  +++ + + 
Sbjct: 228 EEVQSTMPSIT-SGLNNISQNAENTGTLINTSKESLNSTFDNIRLNLSESQTSLDKVQSN 286

Query: 190 LANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVNQILENIQVS 249
           L +++S +     + ++    S S N  + + + +T++   + AI+ +  N+ + N+  S
Sbjct: 287 L-DDLSSMANDASSAKINALISKSINEIDKVDNSVTAVINFLDAINKKIANEKIANMITS 345

Query: 250 SNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSK----------ETSA 299
             N   S  +    ++D++    + Q V + +   +SD + K++ +          +T  
Sbjct: 346 LKNVQNSLAEEKTKLNDLQSKVNSDQNVDKGLLSSISDLTKKIEGQVDNSLNRFDNDTRP 405

Query: 300 FLENIAD----STSNMRSSISAIREITDQRQKIISTIN--------TIENITSNLNDSSQ 347
            L  IAD    +T      +     + DQ   ++ST N        T E + ++L + S 
Sbjct: 406 ALNTIADGLVTATKGASDLLGKANGLVDQINNLLSTANQGSQLANSTSEKLKNSLEEFSG 465

Query: 348 KFAELMSKINNIS 360
             +EL SK+ ++S
Sbjct: 466 VISELSSKLQDVS 478


>gi|156839520|ref|XP_001643450.1| hypothetical protein Kpol_483p11 [Vanderwaltozyma polyspora DSM
            70294]
 gi|156114061|gb|EDO15592.1| hypothetical protein Kpol_483p11 [Vanderwaltozyma polyspora DSM
            70294]
          Length = 2546

 Score = 39.7 bits (91), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 58/240 (24%), Positives = 110/240 (45%), Gaps = 27/240 (11%)

Query: 167  KIIENIEKPLTTTIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITS 226
            KI E  ++ L  +   +E +   L   +  ++    TT        SKN  + +   I +
Sbjct: 1007 KIFEEEKEKLILSKDELEELVIDLNEQLKELETQKETT--------SKNA-DELNKSIAN 1057

Query: 227  LDKMIKAIDLQKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLS 286
            L+  +K  D  K+ ++ E ++V+ NN   S  QV N +  + E  +  + V  +++ L +
Sbjct: 1058 LNTQLKQKD-SKLIELEELVEVTKNNLNDSESQVSNLIAKISELDEENKSVKLEVEKLEN 1116

Query: 287  DF-----SSKMKSKETSAFLENIADSTSNMRSSISAIREITDQRQKIISTINTIENITSN 341
            +      S K   KET      + ++   ++SS     EI   + +  ST++  EN+ ++
Sbjct: 1117 EITEIKNSHKSAQKETDTLQTKLDETELLLQSSK---EEILSLKNEYSSTLSDKENLENS 1173

Query: 342  LNDSSQK-------FAELMSKINNISALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIG 394
               SS+K       F+ L  +  NI+A  EN SL ++       F+D +EK+++Y  +I 
Sbjct: 1174 EKKSSEKIEELEKNFSNLQEQFENITA--ENKSLKEECSGTEEKFKDVNEKLDQYGETIS 1231


>gi|157415454|ref|YP_001482710.1| MCP-domain-containing signal transduction protein [Campylobacter
           jejuni subsp. jejuni 81116]
 gi|157386418|gb|ABV52733.1| putative MCP-domain signal transduction protein [Campylobacter
           jejuni subsp. jejuni 81116]
 gi|307748096|gb|ADN91366.1| Methyl-accepting chemotaxis protein (TlpA) [Campylobacter jejuni
           subsp. jejuni M1]
          Length = 459

 Score = 39.7 bits (91), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 63/254 (24%), Positives = 104/254 (40%), Gaps = 41/254 (16%)

Query: 184 ETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVNQIL 243
           E +  + A+NI  I+K +   +VT  S+       T+ DL            L   N+ +
Sbjct: 122 EGLKGIFAHNIEFINKALANIEVTARSTFKNALSRTLMDL-----------SLGNQNKDM 170

Query: 244 ENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKM----KSKETSA 299
             I  S N  +     V +TV  +   T T  E G ++D L S   S M     SKET  
Sbjct: 171 SQISSSLNQDISMMKNVYDTVDAI---THTATENGSEVDSLQSAMGSLMDVVNSSKET-- 225

Query: 300 FLENIADSTSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNI 359
            ++    ++ N+ S +  IR+I DQ   +++    IE   +   +  + FA +  ++  +
Sbjct: 226 -VQTFVANSQNITSVVEVIRDIADQ-TNLLALNAAIE--AARAGEHGRGFAVVADEVRKL 281

Query: 360 SALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETV 419
                          A  T R TSE I+  I ++  +  N  QSG   + N+V + +E +
Sbjct: 282 ---------------AERTQRSTSE-ISIAIQTMQQDFVNI-QSGSEQVFNIVSESEERI 324

Query: 420 NHFDDCLNNFERNP 433
           N F       E N 
Sbjct: 325 NKFSQAFKRLEENS 338


>gi|215425377|ref|ZP_03423296.1| MCE-family protein mce1B [Mycobacterium tuberculosis T92]
 gi|289748646|ref|ZP_06508024.1| MCE-family protein mce1B [Mycobacterium tuberculosis T92]
 gi|289689233|gb|EFD56662.1| MCE-family protein mce1B [Mycobacterium tuberculosis T92]
          Length = 346

 Score = 39.7 bits (91), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 38/124 (30%), Positives = 56/124 (45%), Gaps = 10/124 (8%)

Query: 1   MESKNYYTSVGLFVVSILFFS--FFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSV 58
           M+       +G+  V +LFF+     I+   R ++ +G  AE       +V GL     V
Sbjct: 1   MKITGTVVKLGIVSVVLLFFTVMIIVIFGQMRFDRTNGYTAEF-----SNVSGLRQGQFV 55

Query: 59  RFNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLR 118
           R +G+ +G++  L L  +       +  I    PLY STTA IR   L G  Y+EL   R
Sbjct: 56  RASGVEIGKVKALHL-VDGGRRVRVEFNIDRSVPLYQSTTAQIRYSDLIGNRYVELK--R 112

Query: 119 KEKK 122
            E K
Sbjct: 113 GEGK 116


>gi|15607311|ref|NP_214684.1| MCE-family protein MCE1B [Mycobacterium tuberculosis H37Rv]
 gi|15839548|ref|NP_334585.1| virulence factor mce family protein [Mycobacterium tuberculosis
           CDC1551]
 gi|148659934|ref|YP_001281457.1| MCE-family protein Mce1B [Mycobacterium tuberculosis H37Ra]
 gi|148821362|ref|YP_001286116.1| MCE-family protein mce1B [Mycobacterium tuberculosis F11]
 gi|167970291|ref|ZP_02552568.1| MCE-family protein mce1B [Mycobacterium tuberculosis H37Ra]
 gi|215406163|ref|ZP_03418344.1| MCE-family protein mce1B [Mycobacterium tuberculosis 02_1987]
 gi|215433090|ref|ZP_03431009.1| MCE-family protein mce1B [Mycobacterium tuberculosis EAS054]
 gi|215448449|ref|ZP_03435201.1| MCE-family protein mce1B [Mycobacterium tuberculosis T85]
 gi|218755904|ref|ZP_03534700.1| MCE-family protein mce1B [Mycobacterium tuberculosis GM 1503]
 gi|253797092|ref|YP_003030093.1| MCE-family protein mce1B [Mycobacterium tuberculosis KZN 1435]
 gi|254233559|ref|ZP_04926885.1| MCE-family protein mce1B [Mycobacterium tuberculosis C]
 gi|254366622|ref|ZP_04982666.1| MCE-family protein mce1B [Mycobacterium tuberculosis str. Haarlem]
 gi|254549109|ref|ZP_05139556.1| MCE-family protein mce1B [Mycobacterium tuberculosis '98-R604
           INH-RIF-EM']
 gi|289552422|ref|ZP_06441632.1| MCE-family protein mce1B [Mycobacterium tuberculosis KZN 605]
 gi|289747937|ref|ZP_06507315.1| MCE-family protein mce1b [Mycobacterium tuberculosis 02_1987]
 gi|289756235|ref|ZP_06515613.1| virulence factor mce family protein [Mycobacterium tuberculosis
           EAS054]
 gi|289760272|ref|ZP_06519650.1| virulence factor mce family protein [Mycobacterium tuberculosis
           T85]
 gi|289764286|ref|ZP_06523664.1| MCE-family protein mce1B [Mycobacterium tuberculosis GM 1503]
 gi|297632648|ref|ZP_06950428.1| MCE-family protein mce1B [Mycobacterium tuberculosis KZN 4207]
 gi|297729623|ref|ZP_06958741.1| MCE-family protein mce1B [Mycobacterium tuberculosis KZN R506]
 gi|306774260|ref|ZP_07412597.1| MCE-family protein mce1B [Mycobacterium tuberculosis SUMu001]
 gi|306779004|ref|ZP_07417341.1| MCE-family protein mce1B [Mycobacterium tuberculosis SUMu002]
 gi|306782792|ref|ZP_07421114.1| MCE-family protein mce1B [Mycobacterium tuberculosis SUMu003]
 gi|306787159|ref|ZP_07425481.1| MCE-family protein mce1B [Mycobacterium tuberculosis SUMu004]
 gi|306791715|ref|ZP_07430017.1| MCE-family protein mce1B [Mycobacterium tuberculosis SUMu005]
 gi|306795759|ref|ZP_07434061.1| MCE-family protein mce1B [Mycobacterium tuberculosis SUMu006]
 gi|306801755|ref|ZP_07438423.1| MCE-family protein mce1B [Mycobacterium tuberculosis SUMu008]
 gi|306805966|ref|ZP_07442634.1| MCE-family protein mce1B [Mycobacterium tuberculosis SUMu007]
 gi|306970362|ref|ZP_07483023.1| MCE-family protein mce1B [Mycobacterium tuberculosis SUMu009]
 gi|306974594|ref|ZP_07487255.1| MCE-family protein mce1B [Mycobacterium tuberculosis SUMu010]
 gi|307082303|ref|ZP_07491473.1| MCE-family protein mce1B [Mycobacterium tuberculosis SUMu011]
 gi|307082647|ref|ZP_07491760.1| MCE-family protein mce1B [Mycobacterium tuberculosis SUMu012]
 gi|313656949|ref|ZP_07813829.1| MCE-family protein mce1B [Mycobacterium tuberculosis KZN V2475]
 gi|2213507|emb|CAB09753.1| MCE-FAMILY PROTEIN MCE1B [Mycobacterium tuberculosis H37Rv]
 gi|13879660|gb|AAK44399.1| virulence factor mce family protein [Mycobacterium tuberculosis
           CDC1551]
 gi|124603352|gb|EAY61627.1| MCE-family protein mce1B [Mycobacterium tuberculosis C]
 gi|134152134|gb|EBA44179.1| MCE-family protein mce1B [Mycobacterium tuberculosis str. Haarlem]
 gi|148504086|gb|ABQ71895.1| MCE-family protein Mce1B [Mycobacterium tuberculosis H37Ra]
 gi|148719889|gb|ABR04514.1| MCE-family protein mce1B [Mycobacterium tuberculosis F11]
 gi|253318595|gb|ACT23198.1| MCE-family protein mce1B [Mycobacterium tuberculosis KZN 1435]
 gi|289437054|gb|EFD19547.1| MCE-family protein mce1B [Mycobacterium tuberculosis KZN 605]
 gi|289688465|gb|EFD55953.1| MCE-family protein mce1b [Mycobacterium tuberculosis 02_1987]
 gi|289696822|gb|EFD64251.1| virulence factor mce family protein [Mycobacterium tuberculosis
           EAS054]
 gi|289711792|gb|EFD75808.1| MCE-family protein mce1B [Mycobacterium tuberculosis GM 1503]
 gi|289715836|gb|EFD79848.1| virulence factor mce family protein [Mycobacterium tuberculosis
           T85]
 gi|308217094|gb|EFO76493.1| MCE-family protein mce1B [Mycobacterium tuberculosis SUMu001]
 gi|308328032|gb|EFP16883.1| MCE-family protein mce1B [Mycobacterium tuberculosis SUMu002]
 gi|308332312|gb|EFP21163.1| MCE-family protein mce1B [Mycobacterium tuberculosis SUMu003]
 gi|308336194|gb|EFP25045.1| MCE-family protein mce1B [Mycobacterium tuberculosis SUMu004]
 gi|308339694|gb|EFP28545.1| MCE-family protein mce1B [Mycobacterium tuberculosis SUMu005]
 gi|308343701|gb|EFP32552.1| MCE-family protein mce1B [Mycobacterium tuberculosis SUMu006]
 gi|308347574|gb|EFP36425.1| MCE-family protein mce1B [Mycobacterium tuberculosis SUMu007]
 gi|308351473|gb|EFP40324.1| MCE-family protein mce1B [Mycobacterium tuberculosis SUMu008]
 gi|308352200|gb|EFP41051.1| MCE-family protein mce1B [Mycobacterium tuberculosis SUMu009]
 gi|308356149|gb|EFP45000.1| MCE-family protein mce1B [Mycobacterium tuberculosis SUMu010]
 gi|308360104|gb|EFP48955.1| MCE-family protein mce1B [Mycobacterium tuberculosis SUMu011]
 gi|308367652|gb|EFP56503.1| MCE-family protein mce1B [Mycobacterium tuberculosis SUMu012]
 gi|323717159|gb|EGB26368.1| MCE-family protein mce1B [Mycobacterium tuberculosis CDC1551A]
 gi|328456879|gb|AEB02302.1| MCE-family protein mce1B [Mycobacterium tuberculosis KZN 4207]
 gi|328864222|gb|AEB53194.1| MCE family protein 1B [Mycobacterium tuberculosis]
          Length = 346

 Score = 39.7 bits (91), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 38/124 (30%), Positives = 56/124 (45%), Gaps = 10/124 (8%)

Query: 1   MESKNYYTSVGLFVVSILFFS--FFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSV 58
           M+       +G+  V +LFF+     I+   R ++ +G  AE       +V GL     V
Sbjct: 1   MKITGTVVKLGIVSVVLLFFTVMIIVIFGQMRFDRTNGYTAEF-----SNVSGLRQGQFV 55

Query: 59  RFNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLR 118
           R +G+ +G++  L L  +       +  I    PLY STTA IR   L G  Y+EL   R
Sbjct: 56  RASGVEIGKVKALHL-VDGGRRVRVEFNIDRSVPLYQSTTAQIRYSDLIGNRYVELK--R 112

Query: 119 KEKK 122
            E K
Sbjct: 113 GEGK 116


>gi|260199173|ref|ZP_05766664.1| MCE-family protein mce1B [Mycobacterium tuberculosis T46]
 gi|289441545|ref|ZP_06431289.1| MCE-family protein mce1B [Mycobacterium tuberculosis T46]
 gi|289414464|gb|EFD11704.1| MCE-family protein mce1B [Mycobacterium tuberculosis T46]
          Length = 346

 Score = 39.7 bits (91), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 38/124 (30%), Positives = 56/124 (45%), Gaps = 10/124 (8%)

Query: 1   MESKNYYTSVGLFVVSILFFS--FFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSV 58
           M+       +G+  V +LFF+     I+   R ++ +G  AE       +V GL     V
Sbjct: 1   MKITGTVVKLGIVSVVLLFFTVMIIVIFGQMRFDRTNGYTAEF-----SNVSGLRQGQFV 55

Query: 59  RFNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLR 118
           R +G+ +G++  L L  +       +  I    PLY STTA IR   L G  Y+EL   R
Sbjct: 56  RASGVEIGKVKALHL-VDGGRRVRVEFNIDRSVPLYQSTTAQIRYSDLIGNRYVELK--R 112

Query: 119 KEKK 122
            E K
Sbjct: 113 GEGK 116


>gi|291519706|emb|CBK74927.1| Methyl-accepting chemotaxis protein [Butyrivibrio fibrisolvens
           16/4]
          Length = 689

 Score = 39.3 bits (90), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 56/268 (20%), Positives = 124/268 (46%), Gaps = 34/268 (12%)

Query: 165 IQKIIEN-IEKPLTTTIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDL 223
           + K++ N I+KP++T   NIE I+     + +   +     ++   SS   +  N + D 
Sbjct: 315 MSKVLGNMIKKPVSTLTTNIEKIA---GGDFTVDIQSRGNDEIAFMSSAMGDFVNGMRDS 371

Query: 224 ITSLDKMIKAIDLQKVNQIL------ENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEV 277
           +    K IK +  Q + + L      EN+++++N+   S DQ+ + + D+        E 
Sbjct: 372 L----KEIKDVSHQLIGEALNSKDTAENLELAANDQSVSMDQIRSNIEDMAHAVNEVAEN 427

Query: 278 GQKIDHLLSDFSSKMKSKETSA--FLENIADSTSNMRSSISAIREITDQRQKIISTINTI 335
              +   +SD ++  +  ET+    +E       +M++       ++D    I++++N +
Sbjct: 428 ATTLAQTISDVTTDEEKIETTMNELVEKAGVGQKDMKT-------VSDGMDHIVASMNEM 480

Query: 336 ENITSNLNDSSQKFAELMSKINNISA----LKENNSLFKDAQRAMHTFRDTSEKINRYIP 391
                +++D++Q   +++  IN+IS+    L  N S+  +A RA    +  +  +   I 
Sbjct: 481 AEAVKSVDDAAQAITQIVDLINSISSQTNLLSLNASI--EAARAGEAGKGFA-VVATEIG 537

Query: 392 SIGNNLQNFSQSGLNDIQNLVRKLQETV 419
           ++ NN    S    N I +++R++ + V
Sbjct: 538 ALANN----SADATNQIADIIREMSDRV 561


>gi|294925247|ref|XP_002778876.1| protein kinase, putative [Perkinsus marinus ATCC 50983]
 gi|239887722|gb|EER10671.1| protein kinase, putative [Perkinsus marinus ATCC 50983]
          Length = 646

 Score = 39.3 bits (90), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 46/252 (18%), Positives = 108/252 (42%), Gaps = 12/252 (4%)

Query: 119 KEKKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTT 178
           + +KT+  + +E   R     TP   +  +S    TS +  +S++ I++ +  + KP +T
Sbjct: 23  RGRKTVAMVKSEHTWRKRKNFTPVRRDQ-LSKRGRTSPRNKNSAQSIRRFLAPVSKPSST 81

Query: 179 TIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQK 238
           T   +     +   +++ +D        +  S ++ ++  ++ D   SL     A D+QK
Sbjct: 82  TTGVLPLTLDIRGVHVNFLDGAELAGARSSDSGEASDSKGSMDDDELSL----TAHDIQK 137

Query: 239 VNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMK---SK 295
           + + L + Q  + + +   ++ I  V D R+   T +     +  +L   S +M     K
Sbjct: 138 LRRELLDCQSFNESLIGERERHIQEVKDFRD---TLKRAAANMREILKQMSQRMHLENKK 194

Query: 296 ETSAFLENIADSTSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSK 355
           E     E +     + RS+     +   + + I+     +++  + L++   ++ +L+ +
Sbjct: 195 ELQQQAERLGKLMPSTRSATGHHWKGGTEEKSILDAHKRLQSFKAQLDEEKTQYRKLL-R 253

Query: 356 INNISALKENNS 367
           I    A  E N+
Sbjct: 254 IRRARANTEGNA 265


>gi|31791348|ref|NP_853841.1| MCE-family protein MCE1B [Mycobacterium bovis AF2122/97]
 gi|121636082|ref|YP_976305.1| MCE-family protein mce1B [Mycobacterium bovis BCG str. Pasteur
           1173P2]
 gi|224988555|ref|YP_002643242.1| MCE-family protein [Mycobacterium bovis BCG str. Tokyo 172]
 gi|260185033|ref|ZP_05762507.1| MCE-family protein [Mycobacterium tuberculosis CPHL_A]
 gi|260203315|ref|ZP_05770806.1| MCE-family protein [Mycobacterium tuberculosis K85]
 gi|289445701|ref|ZP_06435445.1| MCE-family protein mce1C [Mycobacterium tuberculosis CPHL_A]
 gi|289572750|ref|ZP_06452977.1| MCE-family protein mce1B [Mycobacterium tuberculosis K85]
 gi|31616933|emb|CAD93040.1| MCE-FAMILY PROTEIN MCE1B [Mycobacterium bovis AF2122/97]
 gi|121491729|emb|CAL70191.1| MCE-family protein mce1B [Mycobacterium bovis BCG str. Pasteur
           1173P2]
 gi|224771668|dbj|BAH24474.1| MCE-family protein [Mycobacterium bovis BCG str. Tokyo 172]
 gi|289418659|gb|EFD15860.1| MCE-family protein mce1C [Mycobacterium tuberculosis CPHL_A]
 gi|289537181|gb|EFD41759.1| MCE-family protein mce1B [Mycobacterium tuberculosis K85]
          Length = 346

 Score = 39.3 bits (90), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 38/124 (30%), Positives = 56/124 (45%), Gaps = 10/124 (8%)

Query: 1   MESKNYYTSVGLFVVSILFFS--FFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSV 58
           M+       +G+  V +LFF+     I+   R ++ +G  AE       +V GL     V
Sbjct: 1   MKITGTVVKLGIVSVVLLFFTVMIIVIFGQMRFDRTNGYTAEF-----SNVSGLRQGQFV 55

Query: 59  RFNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLR 118
           R +G+ +G++  L L  +       +  I    PLY STTA IR   L G  Y+EL   R
Sbjct: 56  RASGVEIGKVKALHL-VDGGRRVRVEFNIDRSVPLYQSTTAQIRYSDLIGNRYVELK--R 112

Query: 119 KEKK 122
            E K
Sbjct: 113 GEGK 116


>gi|148252250|ref|YP_001236835.1| hypothetical protein BBta_0661 [Bradyrhizobium sp. BTAi1]
 gi|146404423|gb|ABQ32929.1| hypothetical protein BBta_0661 [Bradyrhizobium sp. BTAi1]
          Length = 273

 Score = 39.3 bits (90), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 25/68 (36%), Positives = 33/68 (48%), Gaps = 2/68 (2%)

Query: 47  GSVDGLSTDSSVRFNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGL 106
           GS  GL     V F+G+  G+I  L ++ E P   +A   +    P+   TTA I  QGL
Sbjct: 45  GSAAGLRKGGPVNFDGVQAGQI--LSINLESPRRIVAMITLDKSAPIRKDTTAGIEFQGL 102

Query: 107 AGITYIEL 114
            GI  I L
Sbjct: 103 TGIAAISL 110


>gi|220909178|ref|YP_002484489.1| Mammalian cell entry related domain-containing protein [Cyanothece
           sp. PCC 7425]
 gi|219865789|gb|ACL46128.1| Mammalian cell entry related domain protein [Cyanothece sp. PCC
           7425]
          Length = 404

 Score = 39.3 bits (90), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 66/338 (19%), Positives = 131/338 (38%), Gaps = 73/338 (21%)

Query: 9   SVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGS-----------VDGLSTDSS 57
           SVGL +++ +      + WL   N             PG+             G+   S+
Sbjct: 10  SVGLLILAGIGLFGGLVLWLRGIN-------------PGARSYRLQVELQDASGVDVGSA 56

Query: 58  VRFNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQ-GLAGITYIELST 116
           VRF G+ VG + GL   +   N  +A+  I     L P       TQ G  G  +I+   
Sbjct: 57  VRFRGVKVGSVTGL---ETATNSVIAEVAINSGELLIPRQAIAETTQSGFIGQVFIDF-- 111

Query: 117 LRKEKKTIFQIATERNQRAMITAT-PSGINYFISNAENTSKKISDSSRHIQKIIENIEKP 175
                         R    +++AT P G++ F  N + +S+ + D  R   +   + ++ 
Sbjct: 112 --------------RPPATLVSATLPEGLSPFPPNCD-SSRVLCDGDRLKGQTGASFDEL 156

Query: 176 LTTTIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAID 235
           + +T A  E +    +N I++ ++ +       ++  +   F+T+   +T+  +      
Sbjct: 157 IRSTTAIAELLDN--SNLIANANRTLL------NADRTLTRFSTVAGELTTAAR------ 202

Query: 236 LQKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQT-----------FQEVGQKIDHL 284
              VNQ+    Q    NF  +++ V    ++V +  Q                GQ++   
Sbjct: 203 --GVNQLTRTAQGELKNFSVAANSVTQAANEVSDLVQANRGTIASTLTNLDASGQELRTA 260

Query: 285 LSDFSSKMKSKETSAFLENIADSTSNMRSSISAIREIT 322
           +S+ S  +   E S  L N+    +N   + + ++++T
Sbjct: 261 ISNLSPFLSRLEKSQLLANLETLAANGAKASANLKDLT 298


>gi|293380436|ref|ZP_06626505.1| conserved hypothetical protein [Lactobacillus crispatus 214-1]
 gi|290923015|gb|EFD99948.1| conserved hypothetical protein [Lactobacillus crispatus 214-1]
          Length = 831

 Score = 39.3 bits (90), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 30/117 (25%), Positives = 55/117 (47%), Gaps = 3/117 (2%)

Query: 318 IREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNISALKENNSLFKDAQRAMH 377
           ++E+TDQR K+  T N   +      D  QK A L  +  +++ L++      D Q+ M 
Sbjct: 194 LKEMTDQRDKLAQTKNEFNDYEQLHQDFVQKRAALNRQKQDLAVLQKQEQDLHDLQKEMG 253

Query: 378 TFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFERNPQ 434
            ++ T   + + +  +  N QN+ ++   DI    R LQ+T+   +  L +   N Q
Sbjct: 254 NYQ-TLLDLQKQVKDVDFNGQNYQKA--QDIMAQGRNLQKTIQSVEAQLQDLGENDQ 307


>gi|332179627|gb|AEE15316.1| methyl-accepting chemotaxis sensory transducer [Thermodesulfobium
           narugense DSM 14796]
          Length = 722

 Score = 39.3 bits (90), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 33/123 (26%), Positives = 65/123 (52%), Gaps = 12/123 (9%)

Query: 282 DHLLSDFSSKMKSKETSAFLENIADSTSNMRSSISAIREITDQRQKIISTINTIENITSN 341
           D L    +SK+ + E+    EN+AD+ +N+  S    +EI++Q Q+++S I++I + + +
Sbjct: 374 DMLEVSKASKLAAGESKKASENMADAATNLSQS---AQEISNQVQQLLSAIDSIASGSES 430

Query: 342 LNDSSQKFAELMSKINNIS--------ALKE-NNSLFKDAQRAMHTFRDTSEKINRYIPS 392
           L  S+   +E  + I + S        A+ E  N++ KDA+      ++T   +N  + S
Sbjct: 431 LAKSASNLSERTAAIADKSVQIATDAKAVDELTNNVNKDAREGAKIIQETQNTMNAIVVS 490

Query: 393 IGN 395
           + N
Sbjct: 491 VEN 493


>gi|255007601|ref|ZP_05279727.1| hypothetical protein Bfra3_00582 [Bacteroides fragilis 3_1_12]
 gi|313145294|ref|ZP_07807487.1| conserved hypothetical protein [Bacteroides fragilis 3_1_12]
 gi|313134061|gb|EFR51421.1| conserved hypothetical protein [Bacteroides fragilis 3_1_12]
          Length = 616

 Score = 39.3 bits (90), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 37/138 (26%), Positives = 68/138 (49%), Gaps = 12/138 (8%)

Query: 300 FLENIADSTSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNI 359
           F E    +TS+ RS     +E  ++++ II+ + +I+  T++ +++S++  ELM + NNI
Sbjct: 438 FFEQKGKATSSQRS---VEQENLEKKKAIIAQLTSIDE-TTDADEASKEVRELMKEWNNI 493

Query: 360 S--ALKENNSLFKDAQRAMHTFRD------TSEKINRYIPSIGNNLQNFSQSGLNDIQNL 411
                KE + L+K     +    D      +++K++ +  SIGN     SQS   + + L
Sbjct: 494 GHVPFKEKDKLYKQYHGLIDQLFDRFNISASNKKLSNFKSSIGNIQSGGSQSIYREREKL 553

Query: 412 VRKLQETVNHFDDCLNNF 429
           VR  +   N      NN 
Sbjct: 554 VRTYENMKNELQTYENNL 571


>gi|89054062|ref|YP_509513.1| virulence factor MCE-like protein-related protein [Jannaschia sp.
           CCS1]
 gi|88863611|gb|ABD54488.1| Mammalian cell entry-related protein [Jannaschia sp. CCS1]
          Length = 808

 Score = 39.3 bits (90), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 75/427 (17%), Positives = 165/427 (38%), Gaps = 61/427 (14%)

Query: 68  IVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQG------LAGITYIELSTLRKEK 121
           I+ L  D++     LA  LI  +TPL PS+   +          +A +  + +  L    
Sbjct: 389 ILELHEDEDPDGQQLATDLI--ETPLMPSSPPNVTEASADLDAIVARVAALPIEDLMNSA 446

Query: 122 KTIFQIATERNQRAMITATPSGINYFISNAENTSKK---------ISDSSRHIQKIIENI 172
                  T  +    I A P+ +N  +S A +             +SD+++ +Q++   I
Sbjct: 447 IDALDGITRLSTGEEINALPANLNELVSEARSIVAAEEIATILTDLSDAAQSVQELFTGI 506

Query: 173 EK--PLTTTIANIETISTVLAN----------NISHIDKMMHTTQVTPHSSDSKNTFNTI 220
                LTT +A +E   T++AN           ++ +++++      P ++ + +     
Sbjct: 507 ADSDGLTTALAALEGSDTIMANLEGFSGRLPGVLTSVEELIAQIDTAPLTAAATSA---- 562

Query: 221 TDLITSLDKMIKAIDLQKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEV--G 278
            +++  +D ++ A   + +   L  + ++    V + D V   + D+     T Q +  G
Sbjct: 563 DEVLQRIDTILSAPSAETLPDDLAAL-IAEARAVVAGDDVATILTDLAGAADTLQTLVTG 621

Query: 279 QKIDHLLSDFSSKMKSKET-----SAFLENIADSTSNMRSSISA--IREITDQRQKIIST 331
                 LS   + ++  +T       F E + D  +++   I+   +  +T         
Sbjct: 622 IADSEGLSTTLTALEGTDTIIANLQGFTEGLPDVLTSVEEVIAGVDVSPVTAAANSADRV 681

Query: 332 INTIENITSN---------LNDSSQKFAELMSKINNISALKENNSLFKDAQRAMHTFRDT 382
           +  IE+I S+         LN +  +   +++ +    A +        A  A    +  
Sbjct: 682 LLRIEDILSSESADGLPDTLNTALTELGAILATLREGGAAENLTGTLSSADSAFSALQSA 741

Query: 383 SEKINRYIP---SIGNNLQNFSQ-----SGLN-DIQNLVRKLQETVNHFDDCLNNFERNP 433
           +E++   +    S+  +LQ  +      S +N D++  +  + +  + F       ERNP
Sbjct: 742 AEQVPAIVTRLNSLVTSLQGLAADYDDSSPVNRDLRAAIADISQAADAFRSLARAIERNP 801

Query: 434 QDIVWGR 440
             ++ GR
Sbjct: 802 NSLITGR 808


>gi|239631138|ref|ZP_04674169.1| conserved hypothetical protein [Lactobacillus paracasei subsp.
           paracasei 8700:2]
 gi|239525603|gb|EEQ64604.1| conserved hypothetical protein [Lactobacillus paracasei subsp.
           paracasei 8700:2]
          Length = 1056

 Score = 39.3 bits (90), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 47/218 (21%), Positives = 96/218 (44%), Gaps = 27/218 (12%)

Query: 225 TSLDKMI-KAIDLQKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDH 283
           +S D+++ K  D Q+V           NN   + DQV + + +        ++    +  
Sbjct: 92  SSFDRLVGKVADAQRVE----------NNLKGALDQVNSQLSEQGSKANDAKDHISNLKQ 141

Query: 284 LLSDFSSKMKSKETSAFLEN--IADSTSNMRSSISAIREITDQ----RQKIISTINTIEN 337
              +  SK+K   +SA LEN  + D+ S  + + +A R++++Q    RQK+ +    ++ 
Sbjct: 142 EEGELDSKLKLASSSAKLENAQLGDNASESQKTAAAQRQLSEQMDLSRQKVDNLKQQLKE 201

Query: 338 ITSNLNDSSQKFAELMSKINNISALKEN-----NSLFKDAQRAMHTFRDTSEK-INRYIP 391
             +   D+S +  ++  K+N+      N     + L K++Q A     + ++      + 
Sbjct: 202 TVTAYGDNSSEATQMKVKLNDAETSVANLGNQMDKLGKESQDASSKLDEIAKNTAAERLQ 261

Query: 392 SIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNF 429
           ++ N  Q+  Q     +QN  +K QE     DD ++N 
Sbjct: 262 TVANGFQSAGQG----LQNFNQKAQEAWTQTDDAVDNL 295


>gi|256843685|ref|ZP_05549173.1| conserved hypothetical protein [Lactobacillus crispatus 125-2-CHN]
 gi|256615105|gb|EEU20306.1| conserved hypothetical protein [Lactobacillus crispatus 125-2-CHN]
          Length = 831

 Score = 39.3 bits (90), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 30/117 (25%), Positives = 55/117 (47%), Gaps = 3/117 (2%)

Query: 318 IREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNISALKENNSLFKDAQRAMH 377
           ++E+TDQR K+  T N   +      D  QK A L  +  +++ L++      D Q+ M 
Sbjct: 194 LKEMTDQRDKLAQTKNEFNDYEQLHQDFVQKRAALNRQKQDLAVLQKQEQDLHDLQKEMG 253

Query: 378 TFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFERNPQ 434
            ++ T   + + +  +  N QN+ ++   DI    R LQ+T+   +  L +   N Q
Sbjct: 254 NYQ-TLLDLQKQVKDVDFNGQNYQKA--QDIMAQGRNLQKTIQSVEAQLQDLGENDQ 307


>gi|27545303|ref|NP_775383.1| laminin subunit beta-4 precursor [Danio rerio]
 gi|82243519|sp|Q8JHV6|LAMB4_DANRE RecName: Full=Laminin subunit beta-4; Flags: Precursor
 gi|21538981|gb|AAM61768.1|AF468050_1 laminin beta 4 [Danio rerio]
          Length = 1827

 Score = 39.3 bits (90), Expect = 1.3,   Method: Composition-based stats.
 Identities = 51/277 (18%), Positives = 113/277 (40%), Gaps = 43/277 (15%)

Query: 197  IDKMMHTTQVTPHSSDSKNTFNTITDLITSL-DKMIKAIDLQKVNQILENIQVSSNNFVK 255
            +DK+  T   T +  +  +T   I  + T L D+++K  D++K+   + +IQ+      K
Sbjct: 1529 MDKINRTK--TKYEQEKTDTKALIEKVKTYLQDELVKPEDIEKLANAVLSIQLP-----K 1581

Query: 256  SSDQVINTVHDVRETTQTFQEVGQKIDHL--LSDFSSKMKSKETSAF----------LEN 303
            S D++ + + D+++      E    +++L   +  +  MK +               +E 
Sbjct: 1582 SPDEIKDMIEDIKKILANITEFNDDLEYLEKQAKIAGNMKERAKEILNRTELINVKEIEK 1641

Query: 304  IADSTSNMRSSISAIREITDQ-----RQKIISTINTIENITSNLNDSSQKFAELMSKINN 358
              + T+ +   I    +  +Q     R+K+  T   ++NI  +LN +  K     + ++ 
Sbjct: 1642 ALNDTAKLHDKIFNDLDEAEQNNDVIREKVNETEPKLKNIEDHLNLTRAK-----TLLDE 1696

Query: 359  ISALKENNSLFK--------DAQRAMHTFRDTSEKINRYIPS-----IGNNLQNFSQSGL 405
            I ALK    + +         A  A+++  DT + +           + +  QN S    
Sbjct: 1697 IEALKNKTEMNRAQGKEAKDTADAALNSANDTGKDLEELKEQFEKLKLNSTNQNVSSEAN 1756

Query: 406  NDIQNLVRKLQETVNHFDDCLNNFERNPQDIVWGREK 442
              ++N+  + +    H +D +   E   + I+   E+
Sbjct: 1757 ERLKNITMEAENLAKHVEDKMKEIEDLEEKILLSNER 1793


>gi|195472759|ref|XP_002088666.1| GE11346 [Drosophila yakuba]
 gi|194174767|gb|EDW88378.1| GE11346 [Drosophila yakuba]
          Length = 8015

 Score = 39.3 bits (90), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 57/209 (27%), Positives = 93/209 (44%), Gaps = 53/209 (25%)

Query: 261  INTVHDVRETTQTFQEVGQ-KIDHLLSDFSSK--MKSKETSAFLENIADSTSNMRSSISA 317
            +NTV ++R   Q F E GQ K+ +LL +   K  M +++  A    I + T  ++     
Sbjct: 5463 LNTVKNLR---QGF-ETGQNKLRYLL-ELKEKVIMNTEQNGAA--KIQEDTEALKQDFDK 5515

Query: 318  IR-EITDQRQKIISTINTIENI-------------------TSN--LNDSSQKFAEL--- 352
            +  ++ D RQK+ + +  +E I                   TSN  LND S+K A L   
Sbjct: 5516 LLVDLNDVRQKLANRLAQLEEIFKLYKILVEWLEDVEPSVKTSNEFLNDLSEKRAALEKF 5575

Query: 353  -------------MSKINNISALKENNSL-FKDAQRAMHTFRDTSEKINRYIPSIGNNLQ 398
                         + KIN    LKE+NSL  KD Q  +  F D   ++N+ I S+ N + 
Sbjct: 5576 RVIQRDINGHNDIVEKINQ--RLKEDNSLDLKDFQPGLTKFDDLQTQVNKIIESLENQVN 5633

Query: 399  NFS--QSGLNDIQNLVRKLQETVNHFDDC 425
            +    +   N++Q+ +R+ +  V    DC
Sbjct: 5634 SHEKYKQAYNELQDWLRRTRIEVEQCADC 5662


>gi|51246138|ref|YP_066022.1| hypothetical protein DP2286 [Desulfotalea psychrophila LSv54]
 gi|50877175|emb|CAG37015.1| conserved hypothetical protein [Desulfotalea psychrophila LSv54]
          Length = 173

 Score = 39.3 bits (90), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 35/119 (29%), Positives = 56/119 (47%), Gaps = 18/119 (15%)

Query: 10  VGLFVVS--ILFFSFFSIY----WLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRFNGI 63
           VG+F+++  + FF  F+      W +RS++Y  P    I     SV GL   + V   G+
Sbjct: 33  VGVFIIAGCLCFFWLFTALGGADW-NRSDKY--P----IFGFFTSVSGLKVGAEVEMAGV 85

Query: 64  PVGRIVGLFLDQEYPNHSLAKALIR--PDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            +GR+  + LD       +AK  +    +  L   T A+++T G+ G  YI LS    E
Sbjct: 86  EIGRVKSIILD---TTRYVAKVELSLNKEVELSDDTIASVKTSGIIGDKYINLSAGGSE 141


>gi|212527966|ref|XP_002144140.1| transcription factor SipA3, putative [Penicillium marneffei ATCC
           18224]
 gi|210073538|gb|EEA27625.1| transcription factor SipA3, putative [Penicillium marneffei ATCC
           18224]
          Length = 1374

 Score = 39.3 bits (90), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 38/214 (17%), Positives = 89/214 (41%), Gaps = 35/214 (16%)

Query: 136 MITATPSGINYFISNA---ENTSKKISDSSRHIQKIIENIEKPLTTTIANIETISTVLAN 192
           +++  P G+     ++    +T+   +D   H+++ ++   K      + +      + +
Sbjct: 16  LVSVVPVGLKEAALDSPTFRSTTIHFADQLEHVERWLDGYAKAAGKLASELAVFEQSMTS 75

Query: 193 NISHIDKMMHTTQ-----------VTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVNQ 241
            +S++   ++ ++           V  H    K+T+ ++   I   D+++       V+ 
Sbjct: 76  FMSYMTNPLNVSEAVIDHDYTLLAVRRHGDCMKDTWGSLLGSIKKADRLV-------VDP 128

Query: 242 ILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAFL 301
           I   IQ    NF              +ET +T ++  +  DHLLS +S + K KE SA  
Sbjct: 129 IKAFIQGDLRNF--------------KETRRTLEQTQRNYDHLLSRYSGQAKQKEASALR 174

Query: 302 ENIADSTSNMRSSISAIREITDQRQKIISTINTI 335
           E+        ++ + A  + + Q  +I +T++ +
Sbjct: 175 EDAFQLHEARKAYLKASLDFSIQAPQIRNTLDKL 208


>gi|303327435|ref|ZP_07357876.1| paraquat-inducible protein B [Desulfovibrio sp. 3_1_syn3]
 gi|302862375|gb|EFL85308.1| paraquat-inducible protein B [Desulfovibrio sp. 3_1_syn3]
          Length = 321

 Score = 39.3 bits (90), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 35/68 (51%), Gaps = 1/68 (1%)

Query: 1  MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
          M S+ Y T VG FV+  +      +  L+ +  +   + E ++   GSV GLS  + V F
Sbjct: 1  MTSQAYKTMVGAFVLGGIGLFALGLVLLAGNRLFSNDL-EYVLYFDGSVSGLSIGAPVVF 59

Query: 61 NGIPVGRI 68
           G+P+G +
Sbjct: 60 RGVPMGSV 67


>gi|146343648|ref|YP_001208696.1| ABC transporter [Bradyrhizobium sp. ORS278]
 gi|146196454|emb|CAL80481.1| conserved hypothetical protein; putative ABC transporter; putative
           signal peptide [Bradyrhizobium sp. ORS278]
          Length = 274

 Score = 39.3 bits (90), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 25/68 (36%), Positives = 33/68 (48%), Gaps = 2/68 (2%)

Query: 47  GSVDGLSTDSSVRFNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGL 106
           GS  GL     V F+G+  G+I  L ++ E P   +A   +    P+   TTA I  QGL
Sbjct: 45  GSAAGLRKGGPVNFDGVQAGQI--LSINLESPRKIVAMITLDKSAPIRKDTTAGIEFQGL 102

Query: 107 AGITYIEL 114
            GI  I L
Sbjct: 103 TGIAAISL 110


>gi|73974020|ref|XP_532269.2| PREDICTED: similar to laminin, alpha 4 precursor [Canis familiaris]
          Length = 1806

 Score = 39.3 bits (90), Expect = 1.4,   Method: Composition-based stats.
 Identities = 58/291 (19%), Positives = 119/291 (40%), Gaps = 34/291 (11%)

Query: 113 ELSTLRKEKKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENI 172
           +L+ L   +  + Q A +  Q     A     N   S+     +K  D+S ++ + I N 
Sbjct: 557 KLANLSNLRHDLVQEAVDHAQNLQQEADELSRNLHSSDMNGLVQKALDAS-NVYENIANY 615

Query: 173 EKPLTTTIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDK--- 229
                 T A    I+  + + +S ID     TQ+  H  +S+N  N   +L    D    
Sbjct: 616 VNEANETAAWALNITDRIYDAVSGID-----TQIIYHKDESENLLNQARELQAKTDPSND 670

Query: 230 --------------MIKAIDLQKVNQILENIQVSSNNFVKSS-DQVINTVHDVRETTQTF 274
                           K+    ++N  ++ +Q +          Q      +  +TT   
Sbjct: 671 EAVADTNRRVDGALARKSALRNRLNDAIKRLQATERGDAHQRLGQSKLITEEASKTTVEV 730

Query: 275 QEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNMRSSISAIREITDQRQKIISTINT 334
           Q+    +   L+++S  ++S ++SA+        + + S+  A+R +T+   +++  + T
Sbjct: 731 QQAAAPMADNLTNWSQNLQSFDSSAY-------NTAVDSAQDAVRNLTEVVPQLLDQLRT 783

Query: 335 IENI--TSNLNDSSQKFAELMSKINNISALKENNSLFKDAQRAMHTFRDTS 383
           +E     SN++ S Q+  EL+++  ++++ K   S+  D Q A+     TS
Sbjct: 784 VEQKRPASNVSASIQRIRELIAQTRSVAS-KIQVSMMFDGQSAVEVHPKTS 833


>gi|326333293|ref|ZP_08199540.1| virulence factor Mce family protein [Nocardioidaceae bacterium
           Broad-1]
 gi|325948937|gb|EGD41030.1| virulence factor Mce family protein [Nocardioidaceae bacterium
           Broad-1]
          Length = 343

 Score = 39.3 bits (90), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 61/294 (20%), Positives = 117/294 (39%), Gaps = 38/294 (12%)

Query: 11  GLFVVSILFFSFFSIYWLSRSNQYDGPMAEVII-RIPGSVDGLSTDSSVRFNGIPVGRIV 69
           G+F+V    F+    YW+        P   V    +  +V GL    SVR  G+ VG++ 
Sbjct: 19  GIFLVVAALFT----YWVGVVTAAHRPGDRVTYDAVFANVSGLQKGDSVRIAGVDVGKVT 74

Query: 70  GLFLDQEYPNHSLAKALIRPDTP----LYPSTTATIRTQGLAGITYIELSTLRKEKKTIF 125
            L + ++      A   +  D P    L  ST AT++ + L G   ++LS    + + I 
Sbjct: 75  ALAVQRD------ATVRVSFDVPRDQKLNASTEATVQYRNLIGDRIVQLSRPDPDARPIK 128

Query: 126 Q---IATERNQRAM-ITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTIA 181
               I   + + A+ +    +G     +       +I+  S  + KI++     ++T + 
Sbjct: 129 AGDTIPISQTRPALDLDLLLNGFKPLFAGL--APAQINAFSGDLIKILQGQSSAISTLVQ 186

Query: 182 NIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVNQ 241
              +++T L N    I +++        + D K    TI  LI    K++  ++ Q+  Q
Sbjct: 187 RAASLTTTLGNRQELIGEVIRNLNTVVGTLDDKR--ETIQALIDQFSKLLDGLE-QQDTQ 243

Query: 242 ILEN--------------IQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKI 281
           IL+               ++    +      Q+  T + + +   T Q+V QK+
Sbjct: 244 ILDAAAQTDRFARDAASLVEAGREDLAADLTQLTKTANGINQEQATLQQVLQKL 297


>gi|212527968|ref|XP_002144141.1| transcription factor SipA3, putative [Penicillium marneffei ATCC
           18224]
 gi|210073539|gb|EEA27626.1| transcription factor SipA3, putative [Penicillium marneffei ATCC
           18224]
          Length = 1063

 Score = 39.3 bits (90), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 38/214 (17%), Positives = 89/214 (41%), Gaps = 35/214 (16%)

Query: 136 MITATPSGINYFISNA---ENTSKKISDSSRHIQKIIENIEKPLTTTIANIETISTVLAN 192
           +++  P G+     ++    +T+   +D   H+++ ++   K      + +      + +
Sbjct: 16  LVSVVPVGLKEAALDSPTFRSTTIHFADQLEHVERWLDGYAKAAGKLASELAVFEQSMTS 75

Query: 193 NISHIDKMMHTTQ-----------VTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVNQ 241
            +S++   ++ ++           V  H    K+T+ ++   I   D+++       V+ 
Sbjct: 76  FMSYMTNPLNVSEAVIDHDYTLLAVRRHGDCMKDTWGSLLGSIKKADRLV-------VDP 128

Query: 242 ILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAFL 301
           I   IQ    NF              +ET +T ++  +  DHLLS +S + K KE SA  
Sbjct: 129 IKAFIQGDLRNF--------------KETRRTLEQTQRNYDHLLSRYSGQAKQKEASALR 174

Query: 302 ENIADSTSNMRSSISAIREITDQRQKIISTINTI 335
           E+        ++ + A  + + Q  +I +T++ +
Sbjct: 175 EDAFQLHEARKAYLKASLDFSIQAPQIRNTLDKL 208


>gi|224372407|ref|YP_002606779.1| methyl-accepting chemotaxis sensory transducer [Nautilia
           profundicola AmH]
 gi|223588539|gb|ACM92275.1| methyl-accepting chemotaxis sensory transducer [Nautilia
           profundicola AmH]
          Length = 651

 Score = 38.9 bits (89), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 52/225 (23%), Positives = 100/225 (44%), Gaps = 39/225 (17%)

Query: 211 SDSKNTFNTITDLITSLDKMIKAIDLQKVNQILENIQVSSNNFVKSSDQVINTVHDVRET 270
           +D K+  + I D + +L        L+K+ + + N ++ SN   ++S Q+  T HDV + 
Sbjct: 349 TDVKDEISEIADAVNTL--------LEKIRETVVNSKIISNKNAQTSQQLAKTAHDVGKK 400

Query: 271 TQTFQEVGQKIDHLLSDFSSKMKSKETSAF--LENIADSTSNMRSSISAIREITDQRQKI 328
            +T  E+ Q + + + + ++ M S + SA   L  I ++ + +     A +EI    QKI
Sbjct: 401 VETESELIQNVGNEVENVANTMNSSKDSAIETLNEIKETQNELE---EANKEIDFLTQKI 457

Query: 329 ISTINTIENITSNLNDSSQKFAELMSKINNISALKENNSLFKDAQRAMHTFRDTSEKINR 388
           IS               S K AEL  KI +   L EN    ++ +  ++  RD +++ N 
Sbjct: 458 ISV--------------SDKEAELAEKIKH---LNENT---QEVKNVLNVIRDIADQTNL 497

Query: 389 YIPSIGNNLQNFSQSG------LNDIQNLVRKLQETVNHFDDCLN 427
              +         + G       ++++ L  K Q+++   D  +N
Sbjct: 498 LALNAAIEAARAGEHGRGFAVVADEVRKLAEKTQKSLAEIDATIN 542


>gi|91201079|emb|CAJ74137.1| similar to ABC-transporter component [Candidatus Kuenenia
           stuttgartiensis]
          Length = 181

 Score = 38.9 bits (89), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 40/69 (57%), Gaps = 5/69 (7%)

Query: 48  SVDGLSTDSSVRFNGIPVGRIVGLFLDQEYPNHSLAKAL-IRPDTPLYPSTTATIRTQGL 106
           +V GL  +++V   G+ VG++  + L+    N+ +  ++ IR D  L     A+IRT+GL
Sbjct: 80  TVKGLKKNTAVEIAGVEVGKVDNIVLE----NYEVVVSMKIRKDIKLQEDAIASIRTKGL 135

Query: 107 AGITYIELS 115
            G  Y+E++
Sbjct: 136 LGEKYVEIT 144


>gi|256828809|ref|YP_003157537.1| Mammalian cell entry related domain protein [Desulfomicrobium
           baculatum DSM 4028]
 gi|256577985|gb|ACU89121.1| Mammalian cell entry related domain protein [Desulfomicrobium
           baculatum DSM 4028]
          Length = 152

 Score = 38.9 bits (89), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 32/135 (23%), Positives = 62/135 (45%), Gaps = 7/135 (5%)

Query: 9   SVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRFNGIPVGRI 68
           S+GLF++  L  + +    L+ +  + G    +  +   +V+GL   S+V  +G+ VG++
Sbjct: 11  SIGLFIIIGLVCTAYLAMTLANTTFFSGDSYTITAKFT-AVNGLRAGSNVEISGVAVGKV 69

Query: 69  VGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIEL-----STLRKEKKT 123
             + LDQ      +  + I     +   +TA I+T GL G  Y+ +       L K+K+ 
Sbjct: 70  SSISLDQTLYQAVITMS-IENAVGIPVDSTAAIKTSGLIGDKYVSIIPGADDVLLKDKEV 128

Query: 124 IFQIATERNQRAMIT 138
           +       +   MI+
Sbjct: 129 LMDTQAALDIEEMIS 143


>gi|78223055|ref|YP_384802.1| exodeoxyribonuclease VII large subunit [Geobacter metallireducens
           GS-15]
 gi|123571798|sp|Q39UJ7|EX7L_GEOMG RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|78194310|gb|ABB32077.1| Exodeoxyribonuclease VII large subunit [Geobacter metallireducens
           GS-15]
          Length = 453

 Score = 38.9 bits (89), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 44/228 (19%), Positives = 96/228 (42%), Gaps = 20/228 (8%)

Query: 141 PSGINY----FISNAENTSKK---ISDSSRHIQKIIENIEKPLTTTIANIETISTVLANN 193
           P G+      FI   E  +K+     +  R I  + + I    + T A I  I  VL   
Sbjct: 104 PRGVGALQLAFIQLKEKLAKEGLFAEEHKRPIPSLPQRIGVVTSATGAAIHDILNVLNRR 163

Query: 194 ISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVNQILENIQVSSNNF 253
            ++++ ++   +V       +   + I + I   ++   A+D+  V +   +++   + +
Sbjct: 164 FANVEVLIRPVKV-----QGEGAADEIAEAIIDFNRY-GAVDVMIVGRGGGSLE---DLW 214

Query: 254 VKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNMRS 313
             + ++V   VH  R        VG +ID  ++DF + +++   SA  E +  S   + S
Sbjct: 215 AFNEEKVARAVH--RSRIPIISAVGHEIDFTIADFVADLRAPTPSAAAELVVKSKEELAS 272

Query: 314 SISAIRE--ITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNI 359
            +  +R   I   R+ +      +E+++  L D +     L  ++++I
Sbjct: 273 KVEFLRHRLIQTLRRILADAGGELESLSRALRDPTVLLGHLSQRLDDI 320


>gi|262047716|ref|ZP_06020669.1| DNA repair ATPase [Lactobacillus crispatus MV-3A-US]
 gi|260572001|gb|EEX28568.1| DNA repair ATPase [Lactobacillus crispatus MV-3A-US]
          Length = 831

 Score = 38.9 bits (89), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 30/117 (25%), Positives = 54/117 (46%), Gaps = 3/117 (2%)

Query: 318 IREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNISALKENNSLFKDAQRAMH 377
           ++E+TDQR K+  T N   +      D  QK A L  +  +++ L++      D Q+ M 
Sbjct: 194 LKEMTDQRDKLAQTKNEFNDYEQLHQDFVQKRAALNRQKQDLAVLQKQEQDLHDLQKEMG 253

Query: 378 TFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFERNPQ 434
            ++ T   + + +  +  N QN+ ++   DI    R LQ+T+   +  L     N Q
Sbjct: 254 NYQ-TLLDLQKQVKDVDFNGQNYQKA--QDIMAQGRNLQKTIQSVEAQLQGLGENDQ 307


>gi|187250743|ref|YP_001875225.1| organic solvents resistance ABC transporter periplasmic protein
           [Elusimicrobium minutum Pei191]
 gi|186970903|gb|ACC97888.1| ABC-type transport system involved in resistance to organic
           solvents, periplasmic component [Elusimicrobium minutum
           Pei191]
          Length = 430

 Score = 38.9 bits (89), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 51/232 (21%), Positives = 97/232 (41%), Gaps = 21/232 (9%)

Query: 8   TSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRFNGIPVGR 67
           T VG+F V+ +     S+Y L   N   G   +V +R    V GL   S+V+ NG+ VG+
Sbjct: 5   TKVGIFAVAGVILFGISVYMLG--NISTGGEYKVNVRFS-DVTGLPGKSTVKLNGVDVGK 61

Query: 68  IVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKEKKTI--- 124
           +  + ++ +   H L    I+    +Y      I T  + G  ++ ++  +  K  +   
Sbjct: 62  VRRIKMNGD---HVLVTVGIKDGVEIYRDAAFKITTSSIIGSKFLSIAQGKPGKGILKNG 118

Query: 125 --FQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTIAN 182
                A E +   M+  T + +  F+ ++ N    + +        + N+   L   IA+
Sbjct: 119 DTIDGANEPSMDQMVQETLASVKQFV-DSINGDGGLGEDLNATLSNVRNLSANLNELIAS 177

Query: 183 IETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAI 234
           ++      A++IS++         T    D     ++I D I + D MI A+
Sbjct: 178 LKPYLENSAHDISYM---------TADLRDLIAKADSIVDKIDNGDGMIGAL 220


>gi|227878117|ref|ZP_03996097.1| DNA repair ATPase [Lactobacillus crispatus JV-V01]
 gi|256850153|ref|ZP_05555583.1| conserved hypothetical protein [Lactobacillus crispatus MV-1A-US]
 gi|312984134|ref|ZP_07791481.1| conserved hypothetical protein [Lactobacillus crispatus CTV-05]
 gi|227862287|gb|EEJ69826.1| DNA repair ATPase [Lactobacillus crispatus JV-V01]
 gi|256713125|gb|EEU28116.1| conserved hypothetical protein [Lactobacillus crispatus MV-1A-US]
 gi|310894488|gb|EFQ43563.1| conserved hypothetical protein [Lactobacillus crispatus CTV-05]
          Length = 831

 Score = 38.9 bits (89), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 30/117 (25%), Positives = 54/117 (46%), Gaps = 3/117 (2%)

Query: 318 IREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNISALKENNSLFKDAQRAMH 377
           ++E+TDQR K+  T N   +      D  QK A L  +  +++ L++      D Q+ M 
Sbjct: 194 LKEMTDQRDKLAQTKNEFNDYEQLHQDFVQKRAALNRQKQDLAVLQKQEQDLHDLQKEMG 253

Query: 378 TFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFERNPQ 434
            ++ T   + + +  +  N QN+ ++   DI    R LQ+T+   +  L     N Q
Sbjct: 254 NYQ-TLLDLQKQVKDVDFNGQNYQKA--QDIMAQGRNLQKTIQSVEAQLQGLGENDQ 307


>gi|149236996|ref|XP_001524375.1| hypothetical protein LELG_04347 [Lodderomyces elongisporus NRRL
           YB-4239]
 gi|146451910|gb|EDK46166.1| hypothetical protein LELG_04347 [Lodderomyces elongisporus NRRL
           YB-4239]
          Length = 919

 Score = 38.9 bits (89), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 50/193 (25%), Positives = 94/193 (48%), Gaps = 20/193 (10%)

Query: 195 SHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVNQILENIQVSSNNFV 254
           S IDK +   ++   +SD K T  T+   I   D+ I  + LQ     +E+++VS NN V
Sbjct: 378 SSIDKHLDNIKLRKINSDLKATNETLLKDIAVKDQEIAQLQLQ-----IEDMKVSHNNKV 432

Query: 255 KSSDQVINTVHDVRETTQTFQEVGQKIDHL-LSDFSSKMKSKETSAFLENIADSTSNMRS 313
              +QVI    D  E  +  Q++  K+D   + +  SK+ +K  +A + ++ D  +   +
Sbjct: 433 NKLNQVI---EDGEEKLR-LQKLESKLDKKEVENLESKVTAK--NAQIRDLTDEKTAEAN 486

Query: 314 SISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNISA--LKENNSLFKD 371
            ++ ++   +Q  K++S +       + LNDSS+   +L+S +++  A    E N   +D
Sbjct: 487 LVADLKHKLEQLTKLVSALR------NELNDSSKMKNDLLSNMSSKEAEFALERNKYIED 540

Query: 372 AQRAMHTFRDTSE 384
             R    F + S+
Sbjct: 541 IARWKAKFEEASD 553


>gi|57640565|ref|YP_183043.1| methyl-accepting chemotaxis protein [Thermococcus kodakarensis
           KOD1]
 gi|57158889|dbj|BAD84819.1| methyl-accepting chemotaxis protein [Thermococcus kodakarensis
           KOD1]
          Length = 438

 Score = 38.9 bits (89), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 51/251 (20%), Positives = 108/251 (43%), Gaps = 38/251 (15%)

Query: 123 TIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTIAN 182
            I +I+T+  Q A  T   +       NA    K+ISD +    + I N+ K +   +A 
Sbjct: 194 AIEEISTQSQQVAEFTVESA-------NAAEKGKEISDEAALKVEKINNVSKEMEKAVAI 246

Query: 183 IETISTVLANNISHIDKMMHTTQV--------TPHSSDSKNTFNTITDLITSLDKMIKAI 234
           +   S  +   +  I  +   T +           + +    F  + D +  L +  +  
Sbjct: 247 LSDYSEKIGQIVDVITDIAEQTNLLALNAAIEAARAGEQGRGFAVVADSVRELAEQSRN- 305

Query: 235 DLQKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSS-KMK 293
             +++  +++ +Q       +S  +V+N++H   E T+  QEV + I  L++ F     +
Sbjct: 306 SAKQIGDLIKEMQ-------ESVGKVVNSIH---ENTEATQEVAESIQELIAAFDDIARR 355

Query: 294 SKETSAFLENIADSTSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELM 353
           + E ++ +  I++      SS+          Q ++ST++ I    S + + SQ+  E +
Sbjct: 356 ANEIASMMNEISNGIDQQASSV----------QGLVSTVDYISAQNSEVVEQSQRVVEEL 405

Query: 354 SKI-NNISALK 363
           S + +N+ +LK
Sbjct: 406 STVMDNVRSLK 416


>gi|327271882|ref|XP_003220716.1| PREDICTED: laminin subunit alpha-5-like [Anolis carolinensis]
          Length = 3663

 Score = 38.9 bits (89), Expect = 1.9,   Method: Composition-based stats.
 Identities = 45/222 (20%), Positives = 92/222 (41%), Gaps = 29/222 (13%)

Query: 190  LANNISHIDKMMHTTQVTPHSSDSKNTFNTI----TDLITSLDKMIKAIDLQKVNQILEN 245
            LA N+S I    +       + ++ N + +I    TD  T+ ++  +A      N ILE+
Sbjct: 2465 LAQNLSSIIHGTNQNGFIQRAINASNAYASIISAVTDAETAANEAKRAATEALTNVILED 2524

Query: 246  IQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLS-DFSSKMKSKETSAFLENI 304
            +  SS               ++++T+   +E G+K    LS D    +++ +T   L  I
Sbjct: 2525 LGASSK--------------EMKKTSAALEEAGKKEQRKLSGDIRGALQAAKTR--LTGI 2568

Query: 305  ADSTSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNISA-LK 363
                 ++ + + +++   D  Q    T   I+N     + +++  A +  K+NN+   L 
Sbjct: 2569 QRKKEDLLNQLQSVKSTLDMVQD--GTAGAIQNAKDAASQANETVARMEEKLNNMQKNLD 2626

Query: 364  ENNSLF-----KDAQRAMHTFRDTSEKINRYIPSIGNNLQNF 400
            E    +     +D  +A+   +DT   +   +P +   L N 
Sbjct: 2627 EWKQQYGDLKNEDLNQAVGEAKDTVSSLESTLPLLLGKLSNL 2668


>gi|157363514|ref|YP_001470281.1| methyl-accepting chemotaxis sensory transducer [Thermotoga
           lettingae TMO]
 gi|157314118|gb|ABV33217.1| methyl-accepting chemotaxis sensory transducer [Thermotoga
           lettingae TMO]
          Length = 657

 Score = 38.9 bits (89), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 49/225 (21%), Positives = 101/225 (44%), Gaps = 28/225 (12%)

Query: 142 SGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTIANIETISTVLANNISHIDKMM 201
           SG+    S AENT+K       H   + EN E+  +TTI   E++  +         +  
Sbjct: 405 SGMEEVASGAENTAK-------HASTLAENSERVRSTTIKTEESMKQLAKAMEKAAAEGQ 457

Query: 202 HTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVNQILENIQV--SSNNFVKSSDQ 259
            + +V     D  N    ITD+I ++ +     +L  +N  +E  +   +   F   +D+
Sbjct: 458 MSMRVVQELVDLSNRIGEITDVIYNIAEQ---TNLLALNAAIEAARAGEAGKGFAVVADE 514

Query: 260 VINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNMRSSISAIR 319
           +     + R+ TQ            ++D   K+KS +T    +   +  + +++S+  ++
Sbjct: 515 IRKLAEESRKATQE-----------VADTLKKIKS-QTELVAKGGQEVVNQLQNSMITLK 562

Query: 320 EITDQRQKIISTINTIENITSNLNDSSQK----FAELMSKINNIS 360
           E  DQ + ++ ++ +  ++T++L  +SQ+      E+ S I+ IS
Sbjct: 563 ESVDQMESMVKSVESFVSMTNDLAATSQEQSGAVEEISSAIDRIS 607


>gi|71650755|ref|XP_814069.1| hypothetical protein [Trypanosoma cruzi strain CL Brener]
 gi|70879010|gb|EAN92218.1| hypothetical protein, conserved [Trypanosoma cruzi]
          Length = 939

 Score = 38.9 bits (89), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 30/101 (29%), Positives = 48/101 (47%), Gaps = 13/101 (12%)

Query: 323 DQRQKIISTINTI-ENITSNLNDSSQKFAELMSKINNISALKENNSLFKDAQRAMHTFRD 381
           D+R+++  TI  + ENITS   +  Q        I N+   +E N+   D +RA H   D
Sbjct: 478 DERRRLNKTIEQLNENITSREQEYEQH-------IRNLR--EERNAACHDLERARHELND 528

Query: 382 T---SEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETV 419
           T   +E + R + +     +N+ Q   +  Q L R LQE +
Sbjct: 529 TQQRAESLQRELDTRTRYFENYRQQAEDHQQQLSRSLQEEM 569


>gi|46581142|ref|YP_011950.1| methyl-accepting chemotaxis protein [Desulfovibrio vulgaris str.
           Hildenborough]
 gi|46450563|gb|AAS97210.1| methyl-accepting chemotaxis protein [Desulfovibrio vulgaris str.
           Hildenborough]
          Length = 801

 Score = 38.9 bits (89), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 43/200 (21%), Positives = 85/200 (42%), Gaps = 26/200 (13%)

Query: 145 NYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTIANIETISTVL--ANNISHIDKM-- 200
            +   NAEN  KK  + +R +  ++E IE      +   +++  +   A  I HI ++  
Sbjct: 574 GHAAENAENARKKADEGARLVGDVVEAIEAVREMALELQQSMQGLATEAEGIGHIMQVIE 633

Query: 201 ----------MHTTQVTPHSSDSKNTFNTITDLITSL-DKMIKAIDLQKVNQILENIQVS 249
                     ++       + D+   F  + D +  L +K + A   ++V Q + NIQ  
Sbjct: 634 DIADQTNLLALNAAIEAARAGDAGRGFAVVADEVRKLAEKTMNAT--REVGQAIRNIQTG 691

Query: 250 SNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMK-----SKETSAFLENI 304
           + N ++++   +  V      T    E    I  ++ D + +++     S++ SA  E I
Sbjct: 692 ARNSMEATSNAVEAVVASNMLTTRSGEALSSIVKMVDDTADQVRGIATASEQQSAASEQI 751

Query: 305 ADSTSNMRSSISAIREITDQ 324
           + +T      I+AI E+T Q
Sbjct: 752 SRATEE----ITAIAEVTAQ 767


>gi|220931276|ref|YP_002508184.1| methyl-accepting chemotaxis sensory transducer [Halothermothrix
           orenii H 168]
 gi|219992586|gb|ACL69189.1| methyl-accepting chemotaxis sensory transducer [Halothermothrix
           orenii H 168]
          Length = 689

 Score = 38.9 bits (89), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 56/254 (22%), Positives = 112/254 (44%), Gaps = 45/254 (17%)

Query: 211 SDSKNTFNTITDLITSLDKMIKAIDLQKVNQILENIQVSSNNFVKSSDQVINTVHDVRET 270
           +DSK+ F  ++D   + ++M+       +  ++ ++  SS+N  K S  +  +V +V  T
Sbjct: 359 ADSKDQFLVLSD---NFNQMVA-----NLKNVVSSLLYSSDNVYKMSQNLSASVQEVSAT 410

Query: 271 TQTFQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNMRSSISAIREITD--QRQKI 328
           ++      +KI   L       K+KET   L+NI     ++  S + I E+ D  Q+Q I
Sbjct: 411 SEEVAATSEKI--ALGAEEQATKTKETEKLLDNIKKGAEDVSESSAKIVEVVDNVQKQSI 468

Query: 329 ----------------ISTINTIENITSNLNDSSQKFAELMSKINNI---SALKENNSLF 369
                           +  ++    +  NL DS  +   ++  IN I   + L   N+  
Sbjct: 469 DGLDVIKKARNHMGKTLEELDLTNEVIDNLRDSIDQINTIIEAINYINEETTLLSFNAAI 528

Query: 370 KDAQ--RAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCL- 426
           + A+   A   F   +E+I         +L N S   L++I ++ R++++ +   +D + 
Sbjct: 529 EAARAGEAGRGFAIVAEEI--------RSLANRSNESLDNIISIFRQIKDAMQQVEDAMD 580

Query: 427 ---NNFERNPQDIV 437
              NN + + Q++V
Sbjct: 581 KSRNNIKSSDQNVV 594


>gi|282889758|ref|ZP_06298297.1| hypothetical protein pah_c004o128 [Parachlamydia acanthamoebae str.
           Hall's coccus]
 gi|281500332|gb|EFB42612.1| hypothetical protein pah_c004o128 [Parachlamydia acanthamoebae str.
           Hall's coccus]
          Length = 671

 Score = 38.9 bits (89), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 29/99 (29%), Positives = 53/99 (53%), Gaps = 3/99 (3%)

Query: 236 LQKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQK--IDHLLSDFSSKMK 293
           L+   Q+  NIQ       +  +Q     ++VRE   T QEV Q   I   L+D   K  
Sbjct: 402 LKTAKQLESNIQAQELVIFQIENQAKKIAYNVREFASTLQEVKQASTITFNLADIGQK-S 460

Query: 294 SKETSAFLENIADSTSNMRSSISAIREITDQRQKIISTI 332
            +E  + ++N+ + +SN+ +++S+++E  +  Q++ISTI
Sbjct: 461 LEEMESIMQNMREGSSNIVNTLSSLQEKIENVQEVISTI 499


>gi|268552863|ref|XP_002634414.1| C. briggsae CBR-EPI-1 protein [Caenorhabditis briggsae]
          Length = 3710

 Score = 38.9 bits (89), Expect = 1.9,   Method: Composition-based stats.
 Identities = 68/308 (22%), Positives = 124/308 (40%), Gaps = 65/308 (21%)

Query: 156  KKISDSSRHIQKIIENIE---KPLTTTIANIETISTVLA---------NNISHIDKMMHT 203
            ++  +   H+   ++N+E     L T IANI + + V A         N+IS I KM++ 
Sbjct: 2130 RRCDECVHHLIGDVDNLELEIDVLGTAIANISSATIVGARLARNKKEFNDISEITKMLND 2189

Query: 204  TQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVNQILENIQVSSNNFVKSSDQVINT 263
             +     +   N F   +D++T+  +++    L +      N  ++S +   +  + +N 
Sbjct: 2190 EE-----NSFGNFFGDASDILTNSTQILH--KLVRTKNHSNNSAIASKSLTVNGTEFLND 2242

Query: 264  V----HDVRETTQTFQEVGQKID----------HLLSDFSSKMKSKETSAFLENIADSTS 309
            V       R++ ++  E+   I            LL +    + S ET++     AD   
Sbjct: 2243 VMKKAQRARQSVRSLAEIALAIGSSSKAVNVDPRLLREAEETLMSLETTS-----ADPYP 2297

Query: 310  NMRSSISA-IREITD-----------QRQKIISTINTIENITSNLNDSSQKFAELMSKI- 356
                S+   ++EI D           Q++   S     E + + LN + Q   E  SK  
Sbjct: 2298 EKAQSVPGKLKEIQDKIQVETDKLEKQKESFESQKKKAEELAAYLNSAQQLLKESKSKTD 2357

Query: 357  --NNISAL----KENN--SLFKDAQRAMHTFRDTSEKINRYI----PSIGNNLQNFSQS- 403
              NN++ +    K  N  +   D    + T +   +KIN  I     SI +N +  SQS 
Sbjct: 2358 KANNVAKMLQLAKVQNLVAAISDDLERVETVKGEFQKINIAIGNITESIKDNREALSQSV 2417

Query: 404  -GLNDIQN 410
              LN+ +N
Sbjct: 2418 NSLNETRN 2425


>gi|309364304|emb|CAP25124.2| CBR-EPI-1 protein [Caenorhabditis briggsae AF16]
          Length = 3820

 Score = 38.5 bits (88), Expect = 2.0,   Method: Composition-based stats.
 Identities = 68/308 (22%), Positives = 124/308 (40%), Gaps = 65/308 (21%)

Query: 156  KKISDSSRHIQKIIENIE---KPLTTTIANIETISTVLA---------NNISHIDKMMHT 203
            ++  +   H+   ++N+E     L T IANI + + V A         N+IS I KM++ 
Sbjct: 2203 RRCDECVHHLIGDVDNLELEIDVLGTAIANISSATIVGARLARNKKEFNDISEITKMLND 2262

Query: 204  TQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVNQILENIQVSSNNFVKSSDQVINT 263
             +     +   N F   +D++T+  +++    L +      N  ++S +   +  + +N 
Sbjct: 2263 EE-----NSFGNFFGDASDILTNSTQILH--KLVRTKNHSNNSAIASKSLTVNGTEFLND 2315

Query: 264  V----HDVRETTQTFQEVGQKID----------HLLSDFSSKMKSKETSAFLENIADSTS 309
            V       R++ ++  E+   I            LL +    + S ET++     AD   
Sbjct: 2316 VMKKAQRARQSVRSLAEIALAIGSSSKAVNVDPRLLREAEETLMSLETTS-----ADPYP 2370

Query: 310  NMRSSISA-IREITD-----------QRQKIISTINTIENITSNLNDSSQKFAELMSKI- 356
                S+   ++EI D           Q++   S     E + + LN + Q   E  SK  
Sbjct: 2371 EKAQSVPGKLKEIQDKIQVETDKLEKQKESFESQKKKAEELAAYLNSAQQLLKESKSKTD 2430

Query: 357  --NNISAL----KENN--SLFKDAQRAMHTFRDTSEKINRYI----PSIGNNLQNFSQS- 403
              NN++ +    K  N  +   D    + T +   +KIN  I     SI +N +  SQS 
Sbjct: 2431 KANNVAKMLQLAKVQNLVAAISDDLERVETVKGEFQKINIAIGNITESIKDNREALSQSV 2490

Query: 404  -GLNDIQN 410
              LN+ +N
Sbjct: 2491 NSLNETRN 2498


>gi|323700844|ref|ZP_08112756.1| Mammalian cell entry related domain protein [Desulfovibrio sp.
           ND132]
 gi|323460776|gb|EGB16641.1| Mammalian cell entry related domain protein [Desulfovibrio
           desulfuricans ND132]
          Length = 383

 Score = 38.5 bits (88), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 78/425 (18%), Positives = 164/425 (38%), Gaps = 96/425 (22%)

Query: 1   MESKNYYTSVGLFVV--SILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSV 58
           M  K  Y  +GL+++  + +  +   I    R  Q   P+         SV+GLS  S V
Sbjct: 1   MVRKKDYFKLGLYIILGTGMLLAVVVILGAGRYFQTTFPLETYFDE---SVNGLSVGSPV 57

Query: 59  RFNGIPVGRIV------GLFLDQEYPN--HSLAKALIRPDTPLYPSTT------------ 98
           +  G+ VGR+        ++ D + P   +   +  + PD  L+   T            
Sbjct: 58  KLRGVQVGRVAEINFVSNIYHDAKSPQSRYVYVRCEVNPD--LFKEMTDDEFVEHVAREA 115

Query: 99  ---ATIRTQGLAGITYIELSTLRKEKKTIFQIATERNQRAMITATPSGINYFISNAENTS 155
                IR   L     + L+T+ ++ KT        N    I  TP     +I +  +T 
Sbjct: 116 KRGMRIRPTSLGLTGQLFLNTIYQDPKT--------NPPLPIDWTPE--YAYIPSVPSTL 165

Query: 156 KKISDSSRHIQKIIENI-EKPLTTTIANIETISTVLANNISHIDKMMHTTQVTPHSSDSK 214
            ++ ++   I K + ++ ++ L + I ++++I       +  ID  M T          +
Sbjct: 166 SRVEEAVTTISKTLSSLRQEDLQSIIKDVKSI-------VGTIDDFMKT-------EGGR 211

Query: 215 NTFNTITDLITSLDKMIKAIDLQKVNQILENIQVSSNNFV--------KSSDQVINTVHD 266
              N + D++ S   ++   D    +   E +   + + +        +S+D +I    +
Sbjct: 212 EAGNRVLDILQSTRSILGRTDRLLADPAAETLIPHTASILSNVDRITSESADNIIKAAAE 271

Query: 267 VRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNMRSSISAIREITDQRQ 326
            R    +F++  Q +   L+D        E +  LENI+ ++S++ ++++          
Sbjct: 272 TRAAIASFKQASQVLSKTLTDPRMDKAMAEIAPSLENISRASSDLAAAVT---------- 321

Query: 327 KIISTINTIENITSNLNDSSQKFAELMSKINNISALKENN--SLFKDAQRAMHTFRDTSE 384
                                K   L++++N ++A +E N  S+ +D +  M   ++ ++
Sbjct: 322 ---------------------KVHTLINRLNGMAASQEANVRSIIEDTREVMQNVKELTD 360

Query: 385 KINRY 389
              RY
Sbjct: 361 DAKRY 365


>gi|95928282|ref|ZP_01311030.1| Mammalian cell entry related [Desulfuromonas acetoxidans DSM 684]
 gi|95135553|gb|EAT17204.1| Mammalian cell entry related [Desulfuromonas acetoxidans DSM 684]
          Length = 148

 Score = 38.5 bits (88), Expect = 2.0,   Method: Composition-based stats.
 Identities = 34/118 (28%), Positives = 55/118 (46%), Gaps = 10/118 (8%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRS----NQYDGPMAEVIIRIPGSVDGLSTDS 56
           M+  N    VGLF    +   F S+ +LS      + +D     V  R  GSV GL   +
Sbjct: 1   MKRFNLEIVVGLF----MLLGFASVVYLSVKLGDVSLFDNDHYRVKARF-GSVSGLKLGA 55

Query: 57  SVRFNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIEL 114
           SV+  G+ +G++  + LD +  +  +A   I+    L     A++RT G+ G  YI +
Sbjct: 56  SVQIGGVDIGKVATISLDPKSYDAVVALD-IKNGIELQDDCIASVRTSGIIGDRYISI 112


>gi|47227314|emb|CAF96863.1| unnamed protein product [Tetraodon nigroviridis]
          Length = 1788

 Score = 38.5 bits (88), Expect = 2.0,   Method: Composition-based stats.
 Identities = 36/174 (20%), Positives = 81/174 (46%), Gaps = 9/174 (5%)

Query: 262  NTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNMRSSISAIREI 321
            ++V ++ E   + Q V QK++   S+  +KM+  + ++ +E +   + N  SS    R  
Sbjct: 1063 DSVAELSEQIDSLQRVKQKLEKERSE--AKMEIDDLASTVEQL---SKNKASSEKTSRLF 1117

Query: 322  TDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNIS-ALKENNSLFKDAQRAMHTFR 380
             DQ  +  +  + ++     LNDS+ + A   ++   +S  L+E  ++    QR+ ++F 
Sbjct: 1118 EDQMNEAKAKADELQR---QLNDSNTQRARAQTESGELSRKLEEREAMVSQLQRSKNSFS 1174

Query: 381  DTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFERNPQ 434
             + E++ + +     NLQ +++       +L   LQ + +  D     +E   +
Sbjct: 1175 QSVEELKKQLDEENKNLQGWTRFSPKAKSSLAHALQSSRHDCDLLREQYEEEQE 1228


>gi|295694980|ref|YP_003588218.1| methyl-accepting chemotaxis sensory transducer [Bacillus tusciae
           DSM 2912]
 gi|295410582|gb|ADG05074.1| methyl-accepting chemotaxis sensory transducer [Bacillus tusciae
           DSM 2912]
          Length = 563

 Score = 38.5 bits (88), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 38/204 (18%), Positives = 92/204 (45%), Gaps = 30/204 (14%)

Query: 183 IETISTVLAN-NISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVNQ 241
           +E IS + A  N+  ++  +   +   H       F  + D +  L +  K     ++ +
Sbjct: 383 VEVISGIAAQTNLLALNAAIEAARAGEHG----RGFVVVADEVRKLAEQSKG-SADEIAR 437

Query: 242 ILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAFL 301
           ++E+IQ  + + V++ D V     +VR   +  QE G++ +H+L+              +
Sbjct: 438 LIESIQADTGHSVEAMDTV---TREVRSGMEAVQEAGREFEHILT-------------AV 481

Query: 302 ENIADSTSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAEL----MSKIN 357
             +AD    +    +A  E++   Q+I +T++ +  I     +++ + AE     ++ + 
Sbjct: 482 RRVADQIQEIS---AATEELSAGAQEISATVSHMAKIAEGAMETTSRAAEASEEQLAAME 538

Query: 358 NISALKENNS-LFKDAQRAMHTFR 380
            +S+  ++ S + ++ Q  +H F+
Sbjct: 539 QVSSAAQSLSRMAQELQEMIHRFK 562


>gi|311234818|gb|ADP87672.1| methyl-accepting chemotaxis sensory transducer with Cache sensor
           [Desulfovibrio vulgaris RCH1]
          Length = 813

 Score = 38.5 bits (88), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 43/200 (21%), Positives = 85/200 (42%), Gaps = 26/200 (13%)

Query: 145 NYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTIANIETISTVL--ANNISHIDKM-- 200
            +   NAEN  KK  + +R +  ++E IE      +   +++  +   A  I HI ++  
Sbjct: 586 GHAAENAENARKKADEGARLVGDVVEAIEAVREMALELQQSMQGLATEAEGIGHIMQVIE 645

Query: 201 ----------MHTTQVTPHSSDSKNTFNTITDLITSL-DKMIKAIDLQKVNQILENIQVS 249
                     ++       + D+   F  + D +  L +K + A   ++V Q + NIQ  
Sbjct: 646 DIADQTNLLALNAAIEAARAGDAGRGFAVVADEVRKLAEKTMNAT--REVGQAIRNIQTG 703

Query: 250 SNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMK-----SKETSAFLENI 304
           + N ++++   +  V      T    E    I  ++ D + +++     S++ SA  E I
Sbjct: 704 ARNSMEATSNAVEAVVASNMLTTRSGEALSSIVKMVDDTADQVRGIATASEQQSAASEQI 763

Query: 305 ADSTSNMRSSISAIREITDQ 324
           + +T      I+AI E+T Q
Sbjct: 764 SRATEE----ITAIAEVTAQ 779


>gi|148926194|ref|ZP_01809879.1| putative MCP-domain signal transduction protein [Campylobacter
           jejuni subsp. jejuni CG8486]
 gi|205356213|ref|ZP_03222979.1| putative MCP-domain signal transduction protein [Campylobacter
           jejuni subsp. jejuni CG8421]
 gi|145845365|gb|EDK22458.1| putative MCP-domain signal transduction protein [Campylobacter
           jejuni subsp. jejuni CG8486]
 gi|205345818|gb|EDZ32455.1| putative MCP-domain signal transduction protein [Campylobacter
           jejuni subsp. jejuni CG8421]
          Length = 459

 Score = 38.5 bits (88), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 62/254 (24%), Positives = 104/254 (40%), Gaps = 41/254 (16%)

Query: 184 ETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVNQIL 243
           E +  + A+NI  I+K +   +VT  S+       T+ DL            L   N+ +
Sbjct: 122 EGLKGIFAHNIEFINKALANIEVTARSTFKNALSRTLMDL-----------SLGNQNKDM 170

Query: 244 ENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKM----KSKETSA 299
             I  S N  +     V +TV  +   + T  E G ++D L S   S M     SKET  
Sbjct: 171 SQISSSLNQDISMMKNVYDTVDAI---SHTATENGSEVDSLQSAMGSLMDVVNSSKET-- 225

Query: 300 FLENIADSTSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNI 359
            ++    ++ N+ S +  IR+I DQ   +++    IE   +   +  + FA +  ++  +
Sbjct: 226 -VQTFVANSQNITSVVEVIRDIADQ-TNLLALNAAIE--AARAGEHGRGFAVVADEVRKL 281

Query: 360 SALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETV 419
                          A  T R TSE I+  I ++  +  N  QSG   + N+V + +E +
Sbjct: 282 ---------------AERTQRSTSE-ISIAIQTMQQDFVNI-QSGSEQVFNIVSESEERI 324

Query: 420 NHFDDCLNNFERNP 433
           N F       E N 
Sbjct: 325 NKFSQAFKRLEENS 338


>gi|120601618|ref|YP_966018.1| methyl-accepting chemotaxis sensory transducer [Desulfovibrio
           vulgaris DP4]
 gi|120561847|gb|ABM27591.1| methyl-accepting chemotaxis sensory transducer [Desulfovibrio
           vulgaris DP4]
          Length = 813

 Score = 38.5 bits (88), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 43/200 (21%), Positives = 85/200 (42%), Gaps = 26/200 (13%)

Query: 145 NYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTIANIETISTVL--ANNISHIDKM-- 200
            +   NAEN  KK  + +R +  ++E IE      +   +++  +   A  I HI ++  
Sbjct: 586 GHAAENAENARKKADEGARLVGDVVEAIEAVREMALELQQSMQGLATEAEGIGHIMQVIE 645

Query: 201 ----------MHTTQVTPHSSDSKNTFNTITDLITSL-DKMIKAIDLQKVNQILENIQVS 249
                     ++       + D+   F  + D +  L +K + A   ++V Q + NIQ  
Sbjct: 646 DIADQTNLLALNAAIEAARAGDAGRGFAVVADEVRKLAEKTMNAT--REVGQAIRNIQTG 703

Query: 250 SNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMK-----SKETSAFLENI 304
           + N ++++   +  V      T    E    I  ++ D + +++     S++ SA  E I
Sbjct: 704 ARNSMEATSNAVEAVVASNMLTTRSGEALSSIVKMVDDTADQVRGIATASEQQSAASEQI 763

Query: 305 ADSTSNMRSSISAIREITDQ 324
           + +T      I+AI E+T Q
Sbjct: 764 SRATEE----ITAIAEVTAQ 779


>gi|171915776|ref|ZP_02931246.1| paraquat-inducible protein B [Verrucomicrobium spinosum DSM 4136]
          Length = 553

 Score = 38.5 bits (88), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 25/133 (18%), Positives = 66/133 (49%), Gaps = 11/133 (8%)

Query: 316 SAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNISALKENNSLFKDAQR- 374
           S + ++ ++   I++ IN +      + D+ QKF     ++    A  E  ++  +A++ 
Sbjct: 420 SGLVQLEEKVNAILAKINALP-----IEDTLQKFGTTADEVTKTVA--ETRAVVDEAKKL 472

Query: 375 -AMHTFRDTSEKINRYIPSIGNNLQNFSQSG--LNDIQNLVRKLQETVNHFDDCLNNFER 431
            A H  ++ + ++N  +  + +++++   +G    D++  + +L+  +  F    +  E 
Sbjct: 473 LAAHATQNMTAEVNATLKELRSSVESLGPAGNVQGDLRRTLDELRAALRAFKTLSDTVEE 532

Query: 432 NPQDIVWGREKGS 444
            P  +++GREKG+
Sbjct: 533 KPNSLIFGREKGA 545


>gi|229022606|ref|ZP_04179132.1| Phage infection protein [Bacillus cereus AH1272]
 gi|228738697|gb|EEL89167.1| Phage infection protein [Bacillus cereus AH1272]
          Length = 925

 Score = 38.5 bits (88), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 60/263 (22%), Positives = 111/263 (42%), Gaps = 24/263 (9%)

Query: 165 IQKIIENIEKPLTTTIA-----NIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNT 219
           I+KI   +   LT T A     +I+ +S  LA+     +K+ H      H   SK     
Sbjct: 152 IEKIKSEVSSTLTKTYAEKMFDSIKDVSKGLADGADGANKL-HDGSSELHDGSSK----- 205

Query: 220 ITDLITSLDKMIKAIDLQKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQ 279
           +TD + +L    K+ +++   Q L +    SN  V  S +V N ++ +   T   Q    
Sbjct: 206 VTDGLHTLQG--KSEEMKDGVQKLAD---GSNKLVDGSGKVTNGLNTLNSKTGEMQIGIG 260

Query: 280 KIDHLLSDFSSKMKSKETSAFLENIADSTSNMRSSISAIREITDQRQKIISTINTI-ENI 338
           K+       ++ + +      +  + D +  +   ++ +   T + QK I  + +  E +
Sbjct: 261 KLQDGSGKVTAGLNTLNGKTGIGKLQDGSGKVTDGLNVLNGKTGEMQKGIGELRSGSEKV 320

Query: 339 TSNLNDSSQKFAELMSKINNISALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQ 398
           T+ LN    K  EL +    +S     N + K A          S++I + +  + N +Q
Sbjct: 321 TNGLNTMVSKTDELKTGTTELS-----NGMEKLA-GGQSQLEKGSQEIQKGLQELNNKVQ 374

Query: 399 NFSQSGLNDIQNLVRKLQETVNH 421
           N S +GL ++Q+ V  +  TVN 
Sbjct: 375 N-SVAGLGEMQSKVPSILNTVNE 396


>gi|88596392|ref|ZP_01099629.1| methyl-accepting chemotaxis protein [Campylobacter jejuni subsp.
           jejuni 84-25]
 gi|88191233|gb|EAQ95205.1| methyl-accepting chemotaxis protein [Campylobacter jejuni subsp.
           jejuni 84-25]
          Length = 417

 Score = 38.5 bits (88), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 64/254 (25%), Positives = 106/254 (41%), Gaps = 41/254 (16%)

Query: 184 ETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVNQIL 243
           E +  + A+NI  I+K +   +VT  S+       T+ DL            L   N+ +
Sbjct: 122 EGLKGIFAHNIEFINKALANIEVTARSTFKNALSRTLMDL-----------SLGNQNKDM 170

Query: 244 ENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKM----KSKETSA 299
             I  S N  +     V +TV  +   + T  E G ++D L S   S M     SKET  
Sbjct: 171 SQISSSLNQDISMMKNVYDTVDAI---SHTATENGSEVDSLQSAMGSLMDVVNSSKET-- 225

Query: 300 FLENIADSTSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNI 359
            ++    ++ N+ S +  IR+I DQ   +++    IE   +   +  + FA +  ++   
Sbjct: 226 -VQTFVANSQNITSVVEVIRDIADQ-TNLLALNAAIE--AARAGEHGRGFAVVADEVR-- 279

Query: 360 SALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETV 419
                     K A+R   T R TSE I+  I ++  +  N  QSG   + N+V + +E +
Sbjct: 280 ----------KLAER---TQRSTSE-ISIAIQTMQQDFVNI-QSGSEQVFNIVSESEERI 324

Query: 420 NHFDDCLNNFERNP 433
           N F       E N 
Sbjct: 325 NKFSQAFKRLEENS 338


>gi|119384013|ref|YP_915069.1| hypothetical protein Pden_1268 [Paracoccus denitrificans PD1222]
 gi|119373780|gb|ABL69373.1| Mammalian cell entry related domain protein [Paracoccus
           denitrificans PD1222]
          Length = 155

 Score = 38.5 bits (88), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 27/68 (39%), Positives = 39/68 (57%), Gaps = 5/68 (7%)

Query: 49  VDGLSTDSSVRFNGIPVGRIVGLFLDQEYPNHSLAKALIR-PDTPLYPS-TTATIRTQGL 106
           VDG+   + VR  G+ VGR+  + L+   P    A+A +R PD+   PS + A I++ GL
Sbjct: 50  VDGIEVGTDVRVAGVRVGRVSAVDLN---PQTYHAEARLRLPDSIRLPSDSAALIQSDGL 106

Query: 107 AGITYIEL 114
            G  YIEL
Sbjct: 107 LGGAYIEL 114


>gi|110800651|ref|YP_697280.1| putative phage infection protein [Clostridium perfringens ATCC
           13124]
 gi|110675298|gb|ABG84285.1| putative phage infection protein [Clostridium perfringens ATCC
           13124]
          Length = 721

 Score = 38.5 bits (88), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 51/241 (21%), Positives = 109/241 (45%), Gaps = 23/241 (9%)

Query: 142 SGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTIANIETISTVLANNISHIDKMM 201
           SG+N    NA+NT   I+ S   +    +NI   L+ +  +++ + + L +++S +    
Sbjct: 239 SGLNNISQNAQNTGSLINTSKESLNSTFDNIRLNLSESQTSLDKVQSNL-DDLSSMANDA 297

Query: 202 HTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVNQILENIQVSSNNFVKSSDQVI 261
            + ++    S S N  + + + +T++   + AI+ +  N+ + N+  S  N   S  +  
Sbjct: 298 SSAKINALISKSINEIDKVDNSVTAVINFLDAINKKIANEKIANMITSLKNVQNSLAEEK 357

Query: 262 NTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSK----------ETSAFLENIAD----S 307
             ++D++    + Q V + +   +SD + K++ +          +T   L  IAD    +
Sbjct: 358 TKLNDLQSKVNSGQNVDKGLLSSISDLTKKIEGQVDNSLNRFDNDTRPALNTIADGLVTA 417

Query: 308 TSNMRSSISAIREITDQRQKIISTIN--------TIENITSNLNDSSQKFAELMSKINNI 359
           T      +     + DQ   ++ST N        T E + ++L + S   +EL SK+ ++
Sbjct: 418 TKGASDLLGKANGLVDQINNLLSTANQGSQLANSTSEKLKNSLEEFSGVISELSSKLQDV 477

Query: 360 S 360
           S
Sbjct: 478 S 478


>gi|78222006|ref|YP_383753.1| virulence factor MCE-like protein-related protein [Geobacter
           metallireducens GS-15]
 gi|78193261|gb|ABB31028.1| Mammalian cell entry-related protein [Geobacter metallireducens
           GS-15]
          Length = 150

 Score = 38.5 bits (88), Expect = 2.2,   Method: Composition-based stats.
 Identities = 31/106 (29%), Positives = 49/106 (46%), Gaps = 3/106 (2%)

Query: 10  VGLFV-VSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRFNGIPVGRI 68
           VG+FV + IL   + S+  L +     G   EV      SV GL   ++V   G+ VGR+
Sbjct: 10  VGIFVAIGILCLGWLSVK-LGKMELVGGDHYEVYAEF-DSVSGLKEGAAVEIAGVEVGRV 67

Query: 69  VGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIEL 114
             + LD ++ + +     I     L     A++RT G+ G  +I L
Sbjct: 68  DRIALDPKFNDRARVSMRIANGVKLQDDVIASVRTSGIIGDKFILL 113


>gi|27376085|ref|NP_767614.1| hypothetical protein bll0974 [Bradyrhizobium japonicum USDA 110]
 gi|27349224|dbj|BAC46239.1| bll0974 [Bradyrhizobium japonicum USDA 110]
          Length = 273

 Score = 38.5 bits (88), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 33/68 (48%), Gaps = 2/68 (2%)

Query: 47  GSVDGLSTDSSVRFNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGL 106
           GS  GL     V F+G+  G+I+ + LD   P   +A  ++    P+   T A I  QGL
Sbjct: 46  GSASGLRRGGPVNFDGVLAGQILSIKLDN--PRKVVALVMLDNSAPIRKDTVAGIEFQGL 103

Query: 107 AGITYIEL 114
            G+  + L
Sbjct: 104 TGVAAVSL 111


>gi|116749876|ref|YP_846563.1| hypothetical protein Sfum_2448 [Syntrophobacter fumaroxidans MPOB]
 gi|116698940|gb|ABK18128.1| Mammalian cell entry related domain protein [Syntrophobacter
           fumaroxidans MPOB]
          Length = 333

 Score = 38.5 bits (88), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 41/197 (20%), Positives = 78/197 (39%), Gaps = 15/197 (7%)

Query: 10  VGLFVVS---ILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRFNGIPVG 66
           VGL ++    +L    F++  L RS  Y     E++       DG++  S V + G+ VG
Sbjct: 10  VGLLILVSFVVLMAGIFAVSDL-RSLWYKKKTIELLFPY---ADGITKGSPVWYAGLEVG 65

Query: 67  RIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKEKKTIFQ 126
            +  + + Q   +       I PD  +   + A IR  G+ G  Y+E+S    + + +  
Sbjct: 66  EVSNIRIAQGASDRIAVTVTISPDARVRKDSRADIRNLGMMGAKYVEISPGSPDAELLGP 125

Query: 127 IATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENI--EKPLTTTIANIE 184
             T   +       PS ++  +        ++ D      K++  +  E  LT  I N  
Sbjct: 126 GETLEGK------GPSSLSEVMETGHAVVARLGDLINETHKLVREVRTESALTDAIRNAN 179

Query: 185 TISTVLANNISHIDKMM 201
                + +N   + K++
Sbjct: 180 GFLVDMRDNGKDLKKVL 196


>gi|57168069|ref|ZP_00367208.1| methyl-accepting chemotaxis protein (tlpA) [Campylobacter coli
           RM2228]
 gi|57020443|gb|EAL57112.1| methyl-accepting chemotaxis protein (tlpA) [Campylobacter coli
           RM2228]
          Length = 459

 Score = 38.5 bits (88), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 62/254 (24%), Positives = 104/254 (40%), Gaps = 41/254 (16%)

Query: 184 ETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVNQIL 243
           E +  + A+NI  I+K +   +VT  S+       T+ DL            L   N+ +
Sbjct: 122 EGLKGIFAHNIEFINKALANIEVTARSTFKNALSRTLMDL-----------SLGNQNKDM 170

Query: 244 ENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKM----KSKETSA 299
             I  S N  +     V +TV  +   + T  E G ++D L S   S M     SKET  
Sbjct: 171 SQISSSLNQDISMMKNVYDTVDAI---SHTATENGSEVDSLQSAMGSLMDVVNSSKET-- 225

Query: 300 FLENIADSTSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNI 359
            ++    ++ N+ S +  IR+I DQ   +++    IE   +   +  + FA +  ++  +
Sbjct: 226 -VQTFVANSQNITSVVEVIRDIADQ-TNLLALNAAIE--AARAGEHGRGFAVVADEVRKL 281

Query: 360 SALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETV 419
                          A  T R TSE I+  I ++  +  N  QSG   + N+V + +E +
Sbjct: 282 ---------------AERTQRSTSE-ISIAIQTMQQDFVNI-QSGSEQVFNIVSESEERI 324

Query: 420 NHFDDCLNNFERNP 433
           N F       E N 
Sbjct: 325 NKFSQAFKRLEENS 338


>gi|298527562|ref|ZP_07014971.1| MCE-family protein [Mycobacterium tuberculosis 94_M4241A]
 gi|298497356|gb|EFI32650.1| MCE-family protein [Mycobacterium tuberculosis 94_M4241A]
          Length = 197

 Score = 38.5 bits (88), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 35/111 (31%), Positives = 53/111 (47%), Gaps = 8/111 (7%)

Query: 10  VGLFVVSILFFSFF--SIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRFNGIPVGR 67
           +G+  V +LFF+     I+   R ++ +G  AE       +V GL     VR +G+ +G+
Sbjct: 10  LGIVSVVLLFFTVMIIVIFGQMRFDRTNGYTAEF-----SNVSGLRQGQFVRASGVEIGK 64

Query: 68  IVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLR 118
           +  L L  +       +  I    PLY STTA IR   L G  Y+EL  +R
Sbjct: 65  VKALHL-VDGGRRVRVEFNIDRSVPLYQSTTAQIRYSDLIGNRYVELKRVR 114


>gi|295687671|ref|YP_003591364.1| methyl-accepting chemotaxis sensory transducer [Caulobacter segnis
           ATCC 21756]
 gi|295429574|gb|ADG08746.1| methyl-accepting chemotaxis sensory transducer [Caulobacter segnis
           ATCC 21756]
          Length = 648

 Score = 38.5 bits (88), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 53/282 (18%), Positives = 128/282 (45%), Gaps = 33/282 (11%)

Query: 122 KTIFQIATERNQRAM--ITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTT 179
           KT F  A +R Q+A+  I    SG+N       + + +I+D+S ++ +  E     L  T
Sbjct: 331 KTNFNAAADRMQQAIQAIGRATSGVN-------SGADEIADASDNLSRRTEQQAASLEET 383

Query: 180 IANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKM-IKAIDLQK 238
            A ++ I+  +    S   +      V    +D++ + + ++  ++++ ++   +  + +
Sbjct: 384 AAALDEITATVRKTASGAKEASQV--VATARTDAERSGSIVSQAVSAMSEIETSSSQISQ 441

Query: 239 VNQILENIQVSSNNFVKSSDQVINTVHDVR--ETTQTFQEVGQKIDHLLSDFSSKMKSKE 296
           +  +++ I   +N    ++      V   R  E  + F  V Q++  L     S   +KE
Sbjct: 442 IIGVIDEIAFQTNLLALNAG-----VEAARAGEAGKGFAVVAQEVRALAQ--RSAEAAKE 494

Query: 297 TSAFLENIADSTSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKI 356
             A    I+ ST  + + +  + +  +  Q+I+  + TI+ + + +  S+ + A  ++++
Sbjct: 495 IKAL---ISTSTQQVEAGVDLVGQTGEALQRIVDQVATIDALVTEIAASAAEQATGLNEV 551

Query: 357 NNI-----SALKENNSLFKDAQRAMHTF----RDTSEKINRY 389
           N+        +++N ++ ++A  A H+     R  SE + R+
Sbjct: 552 NSAVNQMDQVVQQNAAMVEEATAATHSLKGEARSLSEMVARF 593


>gi|224369298|ref|YP_002603462.1| ABC-type transporter involved in resistance to organic solvents,
           periplasmic binding component [Desulfobacterium
           autotrophicum HRM2]
 gi|223692015|gb|ACN15298.1| ABC-type transporter involved in resistance to organic solvents,
           periplasmic binding component [Desulfobacterium
           autotrophicum HRM2]
          Length = 149

 Score = 38.5 bits (88), Expect = 2.4,   Method: Composition-based stats.
 Identities = 35/110 (31%), Positives = 50/110 (45%), Gaps = 10/110 (9%)

Query: 10  VGLFVVSILFFSFFSIYWLS--RSNQYDGPMAEVIIRIPGSVDGLSTDSSVRFNGIPVGR 67
           VG FV+  L    + +  L   R NQ D           GSV GL   + V   G+ VG+
Sbjct: 10  VGFFVIIGLVCCAYIVVQLGGLRINQGDQYTLNAFF---GSVAGLKPGADVEMAGVAVGQ 66

Query: 68  IVGLFLDQEYPNHSLAKALIRPDTPLYPS--TTATIRTQGLAGITYIELS 115
           +  + LD+E     +AK  I  D  +  S    A+++T G+ G  YI LS
Sbjct: 67  VASISLDRE---RFVAKVEISLDKKILLSEDVIASVKTSGIIGDKYINLS 113


>gi|86150896|ref|ZP_01069112.1| methyl-accepting chemotaxis protein [Campylobacter jejuni subsp.
           jejuni 260.94]
 gi|315124656|ref|YP_004066660.1| methyl-accepting chemotaxis protein [Campylobacter jejuni subsp.
           jejuni ICDCCJ07001]
 gi|85842066|gb|EAQ59312.1| methyl-accepting chemotaxis protein [Campylobacter jejuni subsp.
           jejuni 260.94]
 gi|315018378|gb|ADT66471.1| methyl-accepting chemotaxis protein [Campylobacter jejuni subsp.
           jejuni ICDCCJ07001]
          Length = 459

 Score = 38.5 bits (88), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 62/254 (24%), Positives = 104/254 (40%), Gaps = 41/254 (16%)

Query: 184 ETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVNQIL 243
           E +  + A+NI  I+K +   +VT  S+       T+ DL            L   N+ +
Sbjct: 122 EGLKGIFAHNIEFINKALANIEVTARSTFKNALSRTLMDL-----------SLGNQNKDM 170

Query: 244 ENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKM----KSKETSA 299
             I  S N  +     V +TV  +   + T  E G ++D L S   S M     SKET  
Sbjct: 171 SQISSSLNQDISMMKNVYDTVDAI---SHTATENGSEVDSLQSAMGSLMDVVNSSKET-- 225

Query: 300 FLENIADSTSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNI 359
            ++    ++ N+ S +  IR+I DQ   +++    IE   +   +  + FA +  ++  +
Sbjct: 226 -VQTFVANSQNITSVVEVIRDIADQ-TNLLALNAAIE--AARAGEHGRGFAVVADEVRKL 281

Query: 360 SALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETV 419
                          A  T R TSE I+  I ++  +  N  QSG   + N+V + +E +
Sbjct: 282 ---------------AERTQRSTSE-ISIAIQTMQQDFVNI-QSGSEQVFNIVSESEERI 324

Query: 420 NHFDDCLNNFERNP 433
           N F       E N 
Sbjct: 325 NKFSQAFKRLEENS 338


>gi|121613515|ref|YP_001000865.1| methyl-accepting chemotaxis protein [Campylobacter jejuni subsp.
           jejuni 81-176]
 gi|167005777|ref|ZP_02271535.1| methyl-accepting chemotaxis protein [Campylobacter jejuni subsp.
           jejuni 81-176]
 gi|218562802|ref|YP_002344581.1| bipartate energy taxis response protein CetA [Campylobacter jejuni
           subsp. jejuni NCTC 11168]
 gi|87249307|gb|EAQ72268.1| methyl-accepting chemotaxis protein [Campylobacter jejuni subsp.
           jejuni 81-176]
 gi|112360508|emb|CAL35305.1| bipartate energy taxis response protein cetA [Campylobacter jejuni
           subsp. jejuni NCTC 11168]
 gi|315927249|gb|EFV06594.1| methyl-accepting chemotaxis protein (MCP) signaling domain protein
           [Campylobacter jejuni subsp. jejuni DFVF1099]
          Length = 459

 Score = 38.5 bits (88), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 62/254 (24%), Positives = 104/254 (40%), Gaps = 41/254 (16%)

Query: 184 ETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVNQIL 243
           E +  + A+NI  I+K +   +VT  S+       T+ DL            L   N+ +
Sbjct: 122 EGLKGIFAHNIEFINKALANIEVTARSTFKNALSRTLMDL-----------SLGNQNKDM 170

Query: 244 ENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKM----KSKETSA 299
             I  S N  +     V +TV  +   + T  E G ++D L S   S M     SKET  
Sbjct: 171 SQISSSLNQDISMMKNVYDTVDAI---SHTATENGSEVDSLQSAMGSLMDVVNSSKET-- 225

Query: 300 FLENIADSTSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNI 359
            ++    ++ N+ S +  IR+I DQ   +++    IE   +   +  + FA +  ++  +
Sbjct: 226 -VQTFVANSQNITSVVEVIRDIADQ-TNLLALNAAIE--AARAGEHGRGFAVVADEVRKL 281

Query: 360 SALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETV 419
                          A  T R TSE I+  I ++  +  N  QSG   + N+V + +E +
Sbjct: 282 ---------------AERTQRSTSE-ISIAIQTMQQDFVNI-QSGSEQVFNIVSESEERI 324

Query: 420 NHFDDCLNNFERNP 433
           N F       E N 
Sbjct: 325 NKFSQAFKRLEENS 338


>gi|156371064|ref|XP_001628586.1| predicted protein [Nematostella vectensis]
 gi|156215566|gb|EDO36523.1| predicted protein [Nematostella vectensis]
          Length = 1586

 Score = 38.5 bits (88), Expect = 2.4,   Method: Composition-based stats.
 Identities = 77/358 (21%), Positives = 142/358 (39%), Gaps = 65/358 (18%)

Query: 110  TYIELSTLRKEKKTIFQI----------ATERNQRAMITAT----------PS-GINYFI 148
            T I+L+ LR+    + Q+          A +R Q AM  A           P  GI+   
Sbjct: 1208 TSIDLAELRRMLGEVEQLHVTTRANASKARDRAQNAMRDADELYKNGTAPLPDLGIDAIR 1267

Query: 149  SNAENTSKKISDSSRHIQKIIENIEKPLTTTIANIETISTVLANNISHIDKMMHTTQVTP 208
            + A  T  K S+ +    KI+ +++  +T+  A    +   +A     +D++        
Sbjct: 1268 AKANETKAKASEKAMEAMKILSDLKGLVTSFDAKEADVRKKMAEWPGLMDQLEKLLAAI- 1326

Query: 209  HSSDSKNTFNTITDLITSLDKMIKAID-LQKVNQILENIQVSSNNFVKSSDQVINTVHDV 267
               D+ N         T+ D  IK  D LQK  ++LE +Q       K ++ + N+  + 
Sbjct: 1327 ---DNANA--------TAWDAFIKGEDTLQKAKEMLETMQ-------KFNEIIENSRKEA 1368

Query: 268  RETTQTFQEVGQKIDHLLSDFSSKMKSKETSAFL---ENIA----DSTSNMRSSISAIR- 319
             +  Q   E    I+ L++  S+  KS   +A L   + +A    D     + +  A R 
Sbjct: 1369 EKAEQNIPE----IERLIA--SANAKSDNATASLGDAQQVAGEAKDKAGQAQKTADAARM 1422

Query: 320  ---EITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINN-ISALKENNSLFKDAQRA 375
               +I  + Q +    +T+        D  Q+  + + +  + I+A KE ++   +A  A
Sbjct: 1423 KAEKIRIEAQNLTLPTDTVSTPAKRAADKLQELKDRVGRERDAIAAAKEKST---NATAA 1479

Query: 376  MHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQ---ETVNHFDDCLNNFE 430
                RD  +++ R +  +   + N     +N +  L +KL    E+    D  L N E
Sbjct: 1480 SKRARDKIDEVLRKLNELLKEIDNLDMVDMNKLDELEKKLDNEIESERKVDGALANVE 1537


>gi|86150382|ref|ZP_01068608.1| methyl-accepting chemotaxis protein [Campylobacter jejuni subsp.
           jejuni CF93-6]
 gi|85839207|gb|EAQ56470.1| methyl-accepting chemotaxis protein [Campylobacter jejuni subsp.
           jejuni CF93-6]
          Length = 459

 Score = 38.5 bits (88), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 62/254 (24%), Positives = 104/254 (40%), Gaps = 41/254 (16%)

Query: 184 ETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVNQIL 243
           E +  + A+NI  I+K +   +VT  S+       T+ DL            L   N+ +
Sbjct: 122 EGLKGIFAHNIEFINKALANIEVTARSTFKNALSRTLMDL-----------SLGNQNKDM 170

Query: 244 ENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKM----KSKETSA 299
             I  S N  +     V +TV  +   + T  E G ++D L S   S M     SKET  
Sbjct: 171 SQISSSLNQDISMMKNVYDTVDAI---SHTATENGSEVDSLQSAMGSLMDVVNSSKET-- 225

Query: 300 FLENIADSTSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNI 359
            ++    ++ N+ S +  IR+I DQ   +++    IE   +   +  + FA +  ++  +
Sbjct: 226 -VQTFVANSQNITSVVEVIRDIADQ-TNLLALNAAIE--AARAGEHGRGFAVVADEVRKL 281

Query: 360 SALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETV 419
                          A  T R TSE I+  I ++  +  N  QSG   + N+V + +E +
Sbjct: 282 ---------------AERTQRSTSE-ISIAIQTMQQDFVNI-QSGSEQVFNIVSESEERI 324

Query: 420 NHFDDCLNNFERNP 433
           N F       E N 
Sbjct: 325 NKFSQAFKRLEENS 338


>gi|284926414|gb|ADC28766.1| bipartate energy taxis response protein cetA [Campylobacter jejuni
           subsp. jejuni IA3902]
          Length = 459

 Score = 38.5 bits (88), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 62/254 (24%), Positives = 104/254 (40%), Gaps = 41/254 (16%)

Query: 184 ETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVNQIL 243
           E +  + A+NI  I+K +   +VT  S+       T+ DL            L   N+ +
Sbjct: 122 EGLKGIFAHNIEFINKALANIEVTARSTFKNALSRTLMDL-----------SLGNQNKDM 170

Query: 244 ENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKM----KSKETSA 299
             I  S N  +     V +TV  +   + T  E G ++D L S   S M     SKET  
Sbjct: 171 SQISSSLNQDISMMKNVYDTVDAI---SHTATENGSEVDSLQSAMGSLMDVVNSSKET-- 225

Query: 300 FLENIADSTSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNI 359
            ++    ++ N+ S +  IR+I DQ   +++    IE   +   +  + FA +  ++  +
Sbjct: 226 -VQTFVANSQNITSVVEVIRDIADQ-TNLLALNAAIE--AARAGEHGRGFAVVADEVRKL 281

Query: 360 SALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETV 419
                          A  T R TSE I+  I ++  +  N  QSG   + N+V + +E +
Sbjct: 282 ---------------AERTQRSTSE-ISIAIQTMQQDFVNI-QSGSEQVFNIVSESEERI 324

Query: 420 NHFDDCLNNFERNP 433
           N F       E N 
Sbjct: 325 NKFSQAFKRLEENS 338


>gi|110637171|ref|YP_677378.1| ABC transporter permease [Cytophaga hutchinsonii ATCC 33406]
 gi|110279852|gb|ABG58038.1| ABC transporter-related permease with MCE domain [Cytophaga
           hutchinsonii ATCC 33406]
          Length = 308

 Score = 38.5 bits (88), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 39/143 (27%), Positives = 66/143 (46%), Gaps = 8/143 (5%)

Query: 49  VDGLSTDSSVRFNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAG 108
           VDGL+  + V  NG  VG++  L L+QE  N  L    +R D  +  +T A I ++ L G
Sbjct: 46  VDGLAPSNPVLINGYQVGKVKELVLNQEDNNSILVSIDVRKDILVGDATYAEI-SKDLLG 104

Query: 109 ITYIELSTLRKEKKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKI 168
              I L      K+ +     +   +  +T      +   S A      +  +  H+ K+
Sbjct: 105 SMSIVLKMGSNTKQAVNGDTIKGGFQLSLT------DMLGSKAYPVIDHLDTTLVHLSKM 158

Query: 169 I-ENIEKPLTTTIANIETISTVL 190
           + +++ K L  T+AN+E IS +L
Sbjct: 159 LDDDMRKKLYGTLANLEAISGIL 181


>gi|325675360|ref|ZP_08155044.1| virulence factor mce family protein [Rhodococcus equi ATCC 33707]
 gi|325553331|gb|EGD23009.1| virulence factor mce family protein [Rhodococcus equi ATCC 33707]
          Length = 416

 Score = 38.5 bits (88), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 57/242 (23%), Positives = 103/242 (42%), Gaps = 26/242 (10%)

Query: 51  GLSTDSSVRFNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYP-STTATIRTQGLAGI 109
           G+ T++ V + G+PVGR+  L L Q+  + +L   +I    P  P S  A +  +   G 
Sbjct: 51  GIFTNAEVTYRGVPVGRVGDLTLTQDGVSVAL---MIDDSAPQIPASAKAVVANRSAIGE 107

Query: 110 TYIELSTLRKEKK--TIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQK 167
            Y++L     E    T   +  E+N     TATP  +   I + +  ++ +   S H   
Sbjct: 108 QYVDLQPDTDEGPFLTDGSVILEKN-----TATPIPVEDLIGSVDRLARSVPTDSLHT-T 161

Query: 168 IIENIEKPLTTTIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSL 227
           ++E + K LT    +++ +   L       D+ +  T      SD +  F+T  D   ++
Sbjct: 162 VVE-LGKALTGKGGDLQVLVDSLGRFTETADEALPETLAL--ISDGRTVFDTQADQAGAI 218

Query: 228 DKMIKAIDLQKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSD 287
                 +D     QI   ++ SS+  V+   ++I T  D  +T      V +  D L +D
Sbjct: 219 RTFSDGLD-----QIAAQLK-SSDPDVR---RLIGTGKDASDTVGKL--VAESGDALTTD 267

Query: 288 FS 289
            +
Sbjct: 268 LT 269


>gi|315928778|gb|EFV08050.1| methyl-accepting chemotaxis protein (MCP) signaling domain protein
           [Campylobacter jejuni subsp. jejuni 305]
          Length = 379

 Score = 38.1 bits (87), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 62/254 (24%), Positives = 106/254 (41%), Gaps = 41/254 (16%)

Query: 184 ETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVNQIL 243
           E +  + A+NI  I+K +   +VT  S     TF        +L + +  + L   N+ +
Sbjct: 42  EGLKGIFAHNIEFINKALANIEVTARS-----TFK------NALSRTLMDLSLGNQNKDM 90

Query: 244 ENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKM----KSKETSA 299
             I  S N  +     V +TV  +   + T  E G ++D L S   S M     SKET  
Sbjct: 91  SQISSSLNQDISMMKNVYDTVDAI---SHTATENGSEVDSLQSAMGSLMDVVNSSKET-- 145

Query: 300 FLENIADSTSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNI 359
            ++    ++ N+ S +  IR+I DQ   +++    IE   +   +  + FA +  ++  +
Sbjct: 146 -VQTFVANSQNITSVVEVIRDIADQ-TNLLALNAAIE--AARAGEHGRGFAVVADEVRKL 201

Query: 360 SALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETV 419
                          A  T R TSE I+  I ++  +  N  QSG   + N+V + +E +
Sbjct: 202 ---------------AERTQRSTSE-ISIAIQTMQQDFVNI-QSGSEQVFNIVSESEERI 244

Query: 420 NHFDDCLNNFERNP 433
           N F       E N 
Sbjct: 245 NKFSQAFKRLEENS 258


>gi|311692920|gb|ADP95793.1| methyl-accepting chemotaxis sensory transducer [marine bacterium
           HP15]
          Length = 521

 Score = 38.1 bits (87), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 74/354 (20%), Positives = 155/354 (43%), Gaps = 46/354 (12%)

Query: 97  TTATIRTQGLAGITYIELSTLR-KEKKTIFQIATERNQRAMITATPSGINYFISNAENTS 155
           T   +R Q L  I  IEL+ +R KE     ++  E   R  +  T S  N  I + + + 
Sbjct: 186 TALLVRRQVLRAIKAIELAAMRLKEGDLTHRV--EIMGRDELAQTASAFNELIDSLQYSV 243

Query: 156 KKISDSSRHIQK-----------IIENIEKPLTTTI--AN-IETISTVLANNISHIDKMM 201
            K+   SR +             + E  +K     +  AN ++ +S  +A+  SH++ + 
Sbjct: 244 MKVVQVSRSVDDSAEALVGTSDLVAEGAQKQAGAAVDAANTMDLMSQEIASIASHVEDLR 303

Query: 202 HTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVNQILENIQVSSNNFVKSSDQVI 261
            T Q +   S++            +LD++++ I   +V     +I  S  +FV S+ ++ 
Sbjct: 304 ATAQESLQGSEAGRD---------ALDRLLQEIS--QVKDAFASITDSVGDFVSSTTEIT 352

Query: 262 NTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNM--RSSISA-- 317
           N+++ V++ +      GQ     L+      ++ E       +A+   ++  RS+++A  
Sbjct: 353 NSINQVKDLS------GQTNLLALNAAIEAARAGENGRGFSVVAEEVRSLAQRSALAANS 406

Query: 318 IREITDQRQKIISTIN-TIENITSNLNDSSQKFAELMSKINNISAL-KENNSLFKDAQRA 375
           I E+T+  +     +N  +E  +S L+ S     EL   ++  + L   +N    +  +A
Sbjct: 407 INELTENLEAQSHRVNVALEEGSSALDGSQSLLEELERVLSEATRLVGSSNDGVDEIAQA 466

Query: 376 MHTFRDTSEKINRYIPSI------GNNLQNFSQSGLNDIQNLVRKLQETVNHFD 423
           +H      ++I   I  I      GN + +  ++ +  ++ L ++L ++V+HF+
Sbjct: 467 VHKQNKGGKEIAGSIERIAEMGKDGNQISHTVRTSVASLRELSKELAQSVSHFE 520


>gi|312886976|ref|ZP_07746580.1| DEAD-like helicase [Mucilaginibacter paludis DSM 18603]
 gi|311300288|gb|EFQ77353.1| DEAD-like helicase [Mucilaginibacter paludis DSM 18603]
          Length = 1840

 Score = 38.1 bits (87), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 41/76 (53%), Gaps = 7/76 (9%)

Query: 218  NTITDLITSLDKMIKAIDLQKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEV 277
            N + DL T     ++ +  Q   ++L+ ++V   N   S  Q++  + +V+++  TFQE+
Sbjct: 1086 NVVRDLQT-----LENLGAQITRKMLKGLRVRQANLRASLAQIVFDIQNVKDSGITFQEM 1140

Query: 278  GQKIDHLLSDFSSKMK 293
            G  IDHL  D S K K
Sbjct: 1141 G--IDHLFVDESHKFK 1154


>gi|170059208|ref|XP_001865262.1| conserved hypothetical protein [Culex quinquefasciatus]
 gi|167878090|gb|EDS41473.1| conserved hypothetical protein [Culex quinquefasciatus]
          Length = 743

 Score = 38.1 bits (87), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 44/182 (24%), Positives = 87/182 (47%), Gaps = 27/182 (14%)

Query: 188 TVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMI-----KAIDLQK-VNQ 241
           T+L   I H +  + T+Q+                 I+SL+K +     K  DL+K V+ 
Sbjct: 101 TMLKKEIEHQNTELATSQLKSQHK------------ISSLEKELAHSVKKVTDLEKHVST 148

Query: 242 ILENIQVSSNNFVKSSDQ--VINTVHD--VRETTQTFQEVGQKIDHLLSDFSSKMKSKET 297
           + +  QV+    VK+ +Q  ++    D  + E  +  +E  QK D+     +S+++  + 
Sbjct: 149 LRKREQVAKEELVKTKNQFNILKQSSDDELFELRRAVKEWEQKYDYETGQLNSEIR--DL 206

Query: 298 SAFLENIADSTSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKIN 357
           +  + +I D  S ++  + + +E+TD  Q   S  N+ ++    L+DS ++ AE  SKI 
Sbjct: 207 NQQMMDIEDQLSMVQEELDSYKELTDSLQ---SKANSYDSTKKELDDSQERLAEAESKIK 263

Query: 358 NI 359
           ++
Sbjct: 264 SL 265


>gi|162453383|ref|YP_001615750.1| two-component hybrid sensor and regulator [Sorangium cellulosum 'So
           ce 56']
 gi|161163965|emb|CAN95270.1| two-component hybrid sensor and regulator [Sorangium cellulosum 'So
           ce 56']
          Length = 1676

 Score = 38.1 bits (87), Expect = 2.8,   Method: Composition-based stats.
 Identities = 52/288 (18%), Positives = 119/288 (41%), Gaps = 52/288 (18%)

Query: 154 TSKKISDSSRHIQKIIENIEKPLTTTIANIETISTVLANNISHIDKMMHTTQVTPHSSDS 213
           T K ++DS       + ++   LT+ + NI  ++T +AN    + K + T  V     + 
Sbjct: 321 TWKDLTDS-------VNSMAGNLTSQVRNIAAVTTAVAN--GDLSKKI-TVDVKGEILEL 370

Query: 214 KNTFNTITDLITSLDKMIKAIDLQKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQT 273
           KNT NT+ D + S           +V ++   +          ++  +    DVR    T
Sbjct: 371 KNTINTMVDQLNSF--------ASEVTRVAREV---------GTEGKLGGQADVRGVAGT 413

Query: 274 FQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNMRSSISAIREITDQRQKIISTIN 333
           ++++   ++ + S+ +++++         NIA  T+ +     + +   D + +I+   N
Sbjct: 414 WKDLTDSVNSMASNLTAQVR---------NIATVTTAVAKGDLSKKITVDVKGEILELKN 464

Query: 334 TIENITSNLNDSSQKFAELMSKINNISALKENNSLFKDAQRAMHTFRDTSEKINRYIPSI 393
           TI  +   LN  + +   +  ++     L        D +    T++D ++ +N    ++
Sbjct: 465 TINTMVDQLNSFASEVTRVAREVGTEGKLGGQ----ADVRGVAGTWKDLTDSVNSMAGNL 520

Query: 394 GNNLQN------------FSQSGLNDIQNLVRKLQETVNHFDDCLNNF 429
            + ++N             S+    D++  + +L+ T+N   D L +F
Sbjct: 521 TSQVRNIAAVTTAVANGDLSEKITVDVKGEILELKNTINTMVDQLRSF 568


>gi|108763156|ref|YP_631905.1| Mce family protein [Myxococcus xanthus DK 1622]
 gi|108467036|gb|ABF92221.1| Mce family protein [Myxococcus xanthus DK 1622]
          Length = 509

 Score = 38.1 bits (87), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 29/137 (21%), Positives = 66/137 (48%), Gaps = 5/137 (3%)

Query: 299 AFLENIADSTSNMRSSISAIREITDQRQKIISTINTIENI---TSNLNDSSQKFAELMSK 355
           A  E+++  T++++    A+RE+    +   S    +EN+   + +++ + ++ A+ +  
Sbjct: 137 AVFESLSQITADIQEVTGALREVLGGERGAGSLQRIVENLVRLSDSVDSTVRRNADRLDT 196

Query: 356 I-NNISALKEN-NSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVR 413
           I  N+ A+  +   + +  Q  +    D  E I R +  +  +++N   +G  D++  V 
Sbjct: 197 IVGNVEAISADVRGITQGNQAEITRIIDNIEFITRDVRQVLGSVKNIVGTGEGDVKETVA 256

Query: 414 KLQETVNHFDDCLNNFE 430
            L+ET+   D  L N E
Sbjct: 257 SLKETLKKLDGTLGNLE 273


>gi|300870133|ref|YP_003785004.1| methyl-accepting chemotaxis protein B [Brachyspira pilosicoli
           95/1000]
 gi|300687832|gb|ADK30503.1| methyl-accepting chemotaxis protein B [Brachyspira pilosicoli
           95/1000]
          Length = 940

 Score = 38.1 bits (87), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 68/310 (21%), Positives = 138/310 (44%), Gaps = 47/310 (15%)

Query: 133 QRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTIANIETISTVLAN 192
           QR    +    I   + N  + ++KI   S  I K   ++++     IANI T+S   AN
Sbjct: 596 QRTKFNSVNETIQLLLDNINDITEKIKSQSEAISKTSTSVQQ----MIANIVTVSQG-AN 650

Query: 193 NISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVNQILENIQVSSNN 252
             +   K+++T      + D  N   ++T+ I S+ +  K I    + Q++ NI   +N 
Sbjct: 651 KANTYAKVLYT-----EAQDGSNIGESVTESIQSIKEYSKQI--TNITQVIHNIAEQTN- 702

Query: 253 FVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSN-M 311
            + + +  I   H   E  + F  V  KI  L  D      + E S  +++I + T+  +
Sbjct: 703 -LLAMNAAIEAAH-AGEHGRGFTVVADKIRKLAED------TDENSKIIDDIIEETTQAI 754

Query: 312 RSSISAIREITDQRQKIISTINTIENITSNLNDSSQKF----AELMSKINNISALKEN-- 365
             ++S   + ++  +KI+   NTI ++ +N+++++ +      +++S I+N++++ E   
Sbjct: 755 DHTVSLAFKSSESMEKILEGSNTIADLIANISNANDELDIGRRDILSNISNLNSITEYIQ 814

Query: 366 -----------------NSLFKDAQRAMHTFRDTSEKINRYIPSIGN--NLQNFSQSGLN 406
                             S+ K A+  ++    T   I R + SI N   L N S + + 
Sbjct: 815 ELSIKQMQMSSTVGQNITSVDKLAEDVVNVVNATENDIKRLVSSIENVSELSNASSASME 874

Query: 407 DIQNLVRKLQ 416
            +   +++LQ
Sbjct: 875 TMDKRIKELQ 884


>gi|62733830|gb|AAX95939.1| hypothetical protein LOC_Os11g22930 [Oryza sativa Japonica Group]
 gi|62733884|gb|AAX95993.1| Protein of unknown function (DUF1165), putative [Oryza sativa
           Japonica Group]
 gi|77550283|gb|ABA93080.1| hypothetical protein LOC_Os11g22930 [Oryza sativa Japonica Group]
          Length = 887

 Score = 38.1 bits (87), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 51/218 (23%), Positives = 98/218 (44%), Gaps = 34/218 (15%)

Query: 145 NYFISNAEN--TSKKISDSSRHIQKIIENI----EKPLTTTIANIETISTVLANNISHID 198
           +YF   AE+  TSK ++     ++KI+E+I    E  L   +A+  +     A   + I 
Sbjct: 672 DYFDEEAEDESTSKALAPLDETVKKILEDISLRLESSLDNLVADCGSFQARFAEIQAQIP 731

Query: 199 KMMHTTQVTPHSSDSKNTFNT---------------ITDLITSLDKMIKAIDLQKVNQIL 243
             +  T +TP     ++ FN                I D I +  +++   +  K++Q+ 
Sbjct: 732 DDLANT-ITPAIYLEQHQFNLKKAKQRIADRRDRKDIEDTIQANRQLVHE-EKAKLDQL- 788

Query: 244 ENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAFLEN 303
            +++   +N  +   + I+ +  + E      +VGQK+ +L S    + KS+  SA ++N
Sbjct: 789 -SVRPIQSNIDRLEARKIDLIAQLEECNAELYQVGQKLANLPSAIEEQ-KSRLRSA-IKN 845

Query: 304 IADSTSNMR-------SSISAIREITDQRQKIISTINT 334
           +AD T +++         I AI+E+   RQ  +S I  
Sbjct: 846 VADMTKSLKVISGTDAEDIQAIKEVDQIRQGTVSAIQC 883


>gi|320544548|ref|NP_001188697.1| Muscle-specific protein 300, isoform I [Drosophila melanogaster]
 gi|318068312|gb|ADV36947.1| Muscle-specific protein 300, isoform I [Drosophila melanogaster]
          Length = 11999

 Score = 38.1 bits (87), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 56/209 (26%), Positives = 93/209 (44%), Gaps = 53/209 (25%)

Query: 261  INTVHDVRETTQTFQEVGQ-KIDHLLSDFSSK--MKSKETSAFLENIADSTSNMRSSISA 317
            +NTV ++R   Q F E GQ K+ +LL +   K  M +++  A    I + T  ++     
Sbjct: 5471 LNTVKNLR---QGF-ETGQNKLRYLL-ELKEKVIMNTEQNGAA--KIQEDTEALKQDFDK 5523

Query: 318  IR-EITDQRQKIISTINTIENI-------------------TSN--LNDSSQKFAEL--- 352
            +  ++ D RQK+ + +  +E I                   TS+  LND S+K A L   
Sbjct: 5524 LLVDLNDVRQKLANRLAQLEEIFKLYKILIEWLEDVEPSVKTSDEFLNDLSEKRAALEKF 5583

Query: 353  -------------MSKINNISALKENNSL-FKDAQRAMHTFRDTSEKINRYIPSIGNNLQ 398
                         + KIN    LKE+NSL  KD Q  +  F D   ++N+ I S+ N + 
Sbjct: 5584 RVIQRDINGHNDIVEKINQ--RLKEDNSLDLKDFQPGLTKFDDLQTQVNKIIESLENQVN 5641

Query: 399  NFS--QSGLNDIQNLVRKLQETVNHFDDC 425
            +    +   N++Q+ +R+ +  V    DC
Sbjct: 5642 SHEKYKQAYNELQDWLRRTRIEVEQCADC 5670


>gi|320544546|ref|NP_001188696.1| Muscle-specific protein 300, isoform H [Drosophila melanogaster]
 gi|318068311|gb|ADV36946.1| Muscle-specific protein 300, isoform H [Drosophila melanogaster]
          Length = 11986

 Score = 38.1 bits (87), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 56/209 (26%), Positives = 93/209 (44%), Gaps = 53/209 (25%)

Query: 261  INTVHDVRETTQTFQEVGQ-KIDHLLSDFSSK--MKSKETSAFLENIADSTSNMRSSISA 317
            +NTV ++R   Q F E GQ K+ +LL +   K  M +++  A    I + T  ++     
Sbjct: 5471 LNTVKNLR---QGF-ETGQNKLRYLL-ELKEKVIMNTEQNGAA--KIQEDTEALKQDFDK 5523

Query: 318  IR-EITDQRQKIISTINTIENI-------------------TSN--LNDSSQKFAEL--- 352
            +  ++ D RQK+ + +  +E I                   TS+  LND S+K A L   
Sbjct: 5524 LLVDLNDVRQKLANRLAQLEEIFKLYKILIEWLEDVEPSVKTSDEFLNDLSEKRAALEKF 5583

Query: 353  -------------MSKINNISALKENNSL-FKDAQRAMHTFRDTSEKINRYIPSIGNNLQ 398
                         + KIN    LKE+NSL  KD Q  +  F D   ++N+ I S+ N + 
Sbjct: 5584 RVIQRDINGHNDIVEKINQ--RLKEDNSLDLKDFQPGLTKFDDLQTQVNKIIESLENQVN 5641

Query: 399  NFS--QSGLNDIQNLVRKLQETVNHFDDC 425
            +    +   N++Q+ +R+ +  V    DC
Sbjct: 5642 SHEKYKQAYNELQDWLRRTRIEVEQCADC 5670


>gi|212224351|ref|YP_002307587.1| methyl-accepting chemotaxis protein [Thermococcus onnurineus NA1]
 gi|212009308|gb|ACJ16690.1| methyl-accepting chemotaxis protein [Thermococcus onnurineus NA1]
          Length = 747

 Score = 38.1 bits (87), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 46/222 (20%), Positives = 101/222 (45%), Gaps = 32/222 (14%)

Query: 214 KNTFNTITDLITSLDKMIKAIDLQKVNQILENIQVSSNNFVKSSDQVINTVHDVR--ETT 271
           + T   I   +T + +M ++I  +++  ++ NI   +N    ++      +   R  E  
Sbjct: 543 QETMRDIESAVTKVAEMSRSI--EEITNVITNIAEQTNLLALNA-----AIEAARAGEAG 595

Query: 272 QTFQEVGQKIDHLLSDFSSKMKSKETSAFLENIADS-TSNMRSSISAIRE----ITDQRQ 326
           + F  V Q+I  L  +      SK+ +  ++NI D  T+ +R ++ + R     + +  +
Sbjct: 596 RGFAVVAQEIRKLAEE------SKQAADNIKNIIDQITAEIRDAVDSTRRGVTVVGESAE 649

Query: 327 KIISTINTIENITSNLNDSSQKFAELMSKINNISALKENNSLFKDAQRAMHTFRDTSEKI 386
            +  T N + NI   L D+S +  E+  +I     ++  + + K A RA+     ++E+ 
Sbjct: 650 TLRETTNYLTNIADLLQDASGRMGEVKEQI-----IRTQDEVEK-ALRALENLAASAEET 703

Query: 387 NRYIPSIGNNLQNFS------QSGLNDIQNLVRKLQETVNHF 422
                 + + +Q  +      Q   ND++N+V+ L+E ++ F
Sbjct: 704 TASAEEVSSAVQEQTAATEELQRAANDLKNIVQDLREIISRF 745


>gi|120401976|ref|YP_951805.1| virulence factor Mce family protein [Mycobacterium vanbaalenii
           PYR-1]
 gi|119954794|gb|ABM11799.1| virulence factor Mce family protein [Mycobacterium vanbaalenii
           PYR-1]
          Length = 345

 Score = 38.1 bits (87), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 37/161 (22%), Positives = 68/161 (42%), Gaps = 14/161 (8%)

Query: 52  LSTDSSVRFNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITY 111
           L   + V   GIPVG + G+ L     +H +A   +R D  L   + A I+   + G  Y
Sbjct: 58  LQPGNPVTVAGIPVGEVTGMEL---AGDHVVADFTVRNDVALGEDSRAVIKVTTILGSRY 114

Query: 112 IELSTLRKEKKTIFQIATERNQRAMITATPSGINYFISNAENT-----SKKISDSSRHIQ 166
           + L     E +    +   R   A  T  P  +   +++   T     S K ++S   + 
Sbjct: 115 LSL-----EPEGPGSLPDRRFDLAH-TEVPYDLQEALTDVATTFEQVDSDKFAESLAILG 168

Query: 167 KIIENIEKPLTTTIANIETISTVLANNISHIDKMMHTTQVT 207
           + ++ + + +   + N  T+ST+LA     +  ++ TT V 
Sbjct: 169 RQLQGLPEVVPQALQNTHTLSTILAQRRDQLGALLETTDVV 209


>gi|303245889|ref|ZP_07332171.1| Mammalian cell entry related domain protein [Desulfovibrio
          fructosovorans JJ]
 gi|302492672|gb|EFL52540.1| Mammalian cell entry related domain protein [Desulfovibrio
          fructosovorans JJ]
          Length = 353

 Score = 38.1 bits (87), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 38/80 (47%), Gaps = 2/80 (2%)

Query: 1  MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
          M +K   T +GLFV+  L     +I  L     +  P    I+  P SV GL   + V F
Sbjct: 18 MSAKANKTLIGLFVLGALALGLGAIVALGSGTLFT-PKLRCIMFFPNSVSGLEVGAPVLF 76

Query: 61 NGIPVGRIVGLFLDQEYPNH 80
           G+P+G + G+ +  + P H
Sbjct: 77 RGVPLGTVKGIRILAD-PEH 95


>gi|320544542|ref|NP_001188694.1| Muscle-specific protein 300, isoform D [Drosophila melanogaster]
 gi|318068309|gb|ADV36944.1| Muscle-specific protein 300, isoform D [Drosophila melanogaster]
          Length = 12345

 Score = 38.1 bits (87), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 56/209 (26%), Positives = 93/209 (44%), Gaps = 53/209 (25%)

Query: 261  INTVHDVRETTQTFQEVGQ-KIDHLLSDFSSK--MKSKETSAFLENIADSTSNMRSSISA 317
            +NTV ++R   Q F E GQ K+ +LL +   K  M +++  A    I + T  ++     
Sbjct: 5830 LNTVKNLR---QGF-ETGQNKLRYLL-ELKEKVIMNTEQNGAA--KIQEDTEALKQDFDK 5882

Query: 318  IR-EITDQRQKIISTINTIENI-------------------TSN--LNDSSQKFAEL--- 352
            +  ++ D RQK+ + +  +E I                   TS+  LND S+K A L   
Sbjct: 5883 LLVDLNDVRQKLANRLAQLEEIFKLYKILIEWLEDVEPSVKTSDEFLNDLSEKRAALEKF 5942

Query: 353  -------------MSKINNISALKENNSL-FKDAQRAMHTFRDTSEKINRYIPSIGNNLQ 398
                         + KIN    LKE+NSL  KD Q  +  F D   ++N+ I S+ N + 
Sbjct: 5943 RVIQRDINGHNDIVEKINQ--RLKEDNSLDLKDFQPGLTKFDDLQTQVNKIIESLENQVN 6000

Query: 399  NFS--QSGLNDIQNLVRKLQETVNHFDDC 425
            +    +   N++Q+ +R+ +  V    DC
Sbjct: 6001 SHEKYKQAYNELQDWLRRTRIEVEQCADC 6029


>gi|169631110|ref|YP_001704759.1| putative Mce family protein [Mycobacterium abscessus ATCC 19977]
 gi|169243077|emb|CAM64105.1| Putative Mce family protein [Mycobacterium abscessus]
          Length = 337

 Score = 38.1 bits (87), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 67/286 (23%), Positives = 111/286 (38%), Gaps = 55/286 (19%)

Query: 51  GLSTDSSVRFNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGIT 110
           GL   + VR +G+ VG++  + LD +  N  +   ++  D PLY +TT  IR Q L G  
Sbjct: 49  GLIVGNDVRISGVQVGKVEKIHLDGK--NARITFNVLT-DHPLYQNTTVAIRYQSLVGQR 105

Query: 111 YIELS------------TLRKEKKTI--FQIATERNQRAMI--TATPSGINYFISNAENT 154
           Y+E++            T     +TI  F IA   N    I  T  P+  N      EN 
Sbjct: 106 YVEIAQAPTPSAPLAAGTTIPLGQTIPSFDIAKLFNGFRPIFETLDPAQFNRL---TENI 162

Query: 155 SKKISDSSRHIQKIIENIEKPLTTTIANIETISTVLANNISHIDKMMHTTQVTPHSSDSK 214
            + I    R I  I+ +I+  L  ++     + T++  N+  I K +  T        S 
Sbjct: 163 LQLIQGDERGIGPILRDIDAVLKLSVDRQAALQTII-TNLGDISKDLGGT--------SD 213

Query: 215 NTFNTITDLITSLDKMIKAIDLQKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTF 274
             F  I DL                N +LE  +  ++ F ++    +     +R +    
Sbjct: 214 QLFYLINDL----------------NDVLEPFEKQADEFNRAGADALPV---LRRSVSLL 254

Query: 275 QEVGQKIDHL---LSDFSSKMKSKETS--AFLENIADSTSNMRSSI 315
           + +   +D     L D +S+      +  A L  I D    MR ++
Sbjct: 255 RYIENSVDGAQLPLYDVASRTTPGTPTIMAGLSLIPDLVQGMRDAL 300


>gi|304413073|ref|ZP_07394546.1| periplasmic component of phospholipid ABC transporter [Candidatus
           Regiella insecticola LSR1]
 gi|304283916|gb|EFL92309.1| periplasmic component of phospholipid ABC transporter [Candidatus
           Regiella insecticola LSR1]
          Length = 171

 Score = 38.1 bits (87), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 30/114 (26%), Positives = 51/114 (44%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M++K     VGLFV+       F    ++            I  I  +V GL  +S V+ 
Sbjct: 1   MQTKKSEIGVGLFVLVAFIAVIFLCLKVADIKSIGNQSTYRIYAIFNNVGGLKINSPVKI 60

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIEL 114
            G+ +GR+  + LD++  N  +A  +      +  S++  IRT GL G  ++ L
Sbjct: 61  GGVVIGRVADISLDKKNYNPRVAIDIQENYNHIPNSSSLAIRTAGLLGEQFLAL 114


>gi|315058622|gb|ADT72951.1| Signal transduction protein CetA [Campylobacter jejuni subsp.
           jejuni S3]
          Length = 458

 Score = 37.7 bits (86), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 62/254 (24%), Positives = 104/254 (40%), Gaps = 41/254 (16%)

Query: 184 ETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVNQIL 243
           E +  + A+NI  I+K +   +VT  S+       T+ DL            L   N+ +
Sbjct: 121 EGLKGIFAHNIEFINKALANIEVTARSTFKNALSRTLMDL-----------SLGNQNKDM 169

Query: 244 ENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKM----KSKETSA 299
             I  S N  +     V +TV  +   + T  E G ++D L S   S M     SKET  
Sbjct: 170 SQISSSLNQDISIMKNVYDTVDAI---SHTATENGSEVDSLQSAMGSLMDVVNSSKET-- 224

Query: 300 FLENIADSTSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNI 359
            ++    ++ N+ S +  IR+I DQ   +++    IE   +   +  + FA +  ++  +
Sbjct: 225 -VQTFVANSQNITSVVEVIRDIADQ-TNLLALNAAIE--AARAGEHGRGFAVVADEVRKL 280

Query: 360 SALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETV 419
                          A  T R TSE I+  I ++  +  N  QSG   + N+V + +E +
Sbjct: 281 ---------------AERTQRSTSE-ISIAIQTMQQDFVNI-QSGSEQVFNIVSESEERI 323

Query: 420 NHFDDCLNNFERNP 433
           N F       E N 
Sbjct: 324 NKFSQAFKRLEENS 337


>gi|57505414|ref|ZP_00371342.1| hemolysin secretion protein precursor (hylB) [Campylobacter
           upsaliensis RM3195]
 gi|57016239|gb|EAL53025.1| hemolysin secretion protein precursor (hylB) [Campylobacter
           upsaliensis RM3195]
          Length = 460

 Score = 37.7 bits (86), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 61/258 (23%), Positives = 113/258 (43%), Gaps = 43/258 (16%)

Query: 184 ETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVNQIL 243
           E +  + A+NI  I+K +   +VT     +K+TF        +L K +  + L   N+ +
Sbjct: 121 EGLKGIFAHNIEFINKALSNIEVT-----AKSTFK------NALSKTLMDLSLGSQNKDM 169

Query: 244 ENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMK----SKET-S 298
             I  S N  + + + + + VH +   TQ   E G ++  L    ++ M+    SKET  
Sbjct: 170 SRITTSLNADINAMNNIYDVVHSI---TQVATENGSQVISLQESMNTLMEVVNSSKETVE 226

Query: 299 AFLENIADSTSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINN 358
           AF+ N    + N+ S +  IR+I DQ   +++    IE   +   +  + FA +  ++  
Sbjct: 227 AFVAN----SQNITSVVEVIRDIADQTN-LLALNAAIE--AARAGEHGRGFAVVADEVR- 278

Query: 359 ISALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQET 418
                         Q A  T + TSE I+  I ++  +  N  QSG   + ++V   +E 
Sbjct: 279 --------------QLAERTQKSTSE-ISIAIQTMQQDFDNI-QSGSEQVFDIVSNSEER 322

Query: 419 VNHFDDCLNNFERNPQDI 436
           +++F       E N  ++
Sbjct: 323 ISNFSQAFKRLEENSSEL 340


>gi|326679113|ref|XP_692838.5| PREDICTED: laminin subunit beta-1 [Danio rerio]
          Length = 1779

 Score = 37.7 bits (86), Expect = 3.5,   Method: Composition-based stats.
 Identities = 41/230 (17%), Positives = 91/230 (39%), Gaps = 38/230 (16%)

Query: 155  SKKISDSSRHIQKIIENIEKPLTTTIANIETISTVLANNISHIDKMMHTTQVTPHSSDSK 214
            S K  D++  + K +  + + L T    +  I+T+             T  V   + ++ 
Sbjct: 1430 SVKALDNADEVHKNLTAVSEELQTMAKKLRDIATL-------------TQTVKTQAKETL 1476

Query: 215  NTFNTITDLITSLDKMIKAIDLQKVNQILENIQVSSNNFVKSSDQV------------IN 262
            +      D+    +KM+K   +QK+   L        +  K + QV            +N
Sbjct: 1477 DKAQNKKDMFEKSNKMLKNF-IQKIKDFLNEEGADPESIEKVAQQVLAISLPVNRTVIVN 1535

Query: 263  TVHDVRETTQTFQEVGQKIDHL------LSDFSSKMKSKETSA--FLENIADSTSNMRSS 314
             V  ++++      V    +H       ++D   K +  +T A    +NI  +   + +S
Sbjct: 1536 LVEQIKDSIVNLTNVEGVFNHTSEQLAKVNDLLKKAQDAKTQADGVSDNINKTKEALETS 1595

Query: 315  ISAIREITDQRQKIISTINTIENITSNLNDS----SQKFAELMSKINNIS 360
             +AI++  ++    +  +  I+NIT+ ++D          ++M ++ N+S
Sbjct: 1596 QNAIKKAEEEMSTALKNLKNIQNITAMVDDKLLNLDNNLTDVMMRLVNLS 1645


>gi|220675880|emb|CAX12738.1| novel protein similar to vertebrate laminin beta family [Danio rerio]
          Length = 1779

 Score = 37.7 bits (86), Expect = 3.5,   Method: Composition-based stats.
 Identities = 41/230 (17%), Positives = 91/230 (39%), Gaps = 38/230 (16%)

Query: 155  SKKISDSSRHIQKIIENIEKPLTTTIANIETISTVLANNISHIDKMMHTTQVTPHSSDSK 214
            S K  D++  + K +  + + L T    +  I+T+             T  V   + ++ 
Sbjct: 1430 SVKALDNADEVHKNLTAVSEELQTMAKKLRDIATL-------------TQTVKTQAKETL 1476

Query: 215  NTFNTITDLITSLDKMIKAIDLQKVNQILENIQVSSNNFVKSSDQV------------IN 262
            +      D+    +KM+K   +QK+   L        +  K + QV            +N
Sbjct: 1477 DKAQNKKDMFEKSNKMLKNF-IQKIKDFLNEEGADPESIEKVAQQVLAISLPVNRTVIVN 1535

Query: 263  TVHDVRETTQTFQEVGQKIDHL------LSDFSSKMKSKETSA--FLENIADSTSNMRSS 314
             V  ++++      V    +H       ++D   K +  +T A    +NI  +   + +S
Sbjct: 1536 LVEQIKDSIVNLTNVEGVFNHTSEQLAKVNDLLKKAQDAKTQADGVSDNINKTKEALETS 1595

Query: 315  ISAIREITDQRQKIISTINTIENITSNLNDS----SQKFAELMSKINNIS 360
             +AI++  ++    +  +  I+NIT+ ++D          ++M ++ N+S
Sbjct: 1596 QNAIKKAEEEMSTALKNLKNIQNITAMVDDKLLNLDNNLTDVMMRLVNLS 1645


>gi|291518437|emb|CBK73658.1| Methyl-accepting chemotaxis protein [Butyrivibrio fibrisolvens
           16/4]
          Length = 559

 Score = 37.7 bits (86), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 60/281 (21%), Positives = 121/281 (43%), Gaps = 35/281 (12%)

Query: 144 INYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTIANIETISTVLANNISHIDKMMHT 203
           IN  +   EN + +++  + H+  I  +++  +   I  +++    LA  I  ID+ M T
Sbjct: 213 INADLEVLENAASELAKGNVHVD-IDFDVDNEIGRVINQLKSAIDSLAYCIDEIDEKMST 271

Query: 204 TQVTPHS----SDSKNTFNTITDLITSLDKMIKAIDLQKVNQILENIQVSSNNFVKSSDQ 259
                 +     D +  F  I D I S  + I    + ++ ++ E +   +N    + + 
Sbjct: 272 MASGNFNINFDKDFRGDFKAIQDAIDSFSRQISD-SMTEIMEVSEMVSDGANQIAGAGEN 330

Query: 260 VINTVHD----VRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNMRSSI 315
           + +TV      V + + T  E+  +I +  +D +S   SKE     ENI +    M+  +
Sbjct: 331 LADTVTSQANIVDDLSVTVAEITDQISNNSTDATSI--SKEVEVVAENIVEGNKRMQDVV 388

Query: 316 SAIREITDQRQ---KIISTINTIENITSNL-----------NDSSQKFAELMSKINNISA 361
            A+  I+   Q   KII TIN I + T+ L            ++ + FA + ++++ ++ 
Sbjct: 389 HAMDAISSSSQEISKIIDTINAIADQTNLLSLNASIEAARAGEAGKGFAVVATEVSQLAG 448

Query: 362 ----LKEN-----NSLFKDAQRAMHTFRDTSEKINRYIPSI 393
                 +N     N+  K  +  +    DT+EK+N  +  +
Sbjct: 449 QTVEAAQNTAGLINASLKSVEEGIAIANDTAEKLNGMVSQV 489


>gi|291225083|ref|XP_002732531.1| PREDICTED: serine/threonine protein phosphatase 4 regulatory
           subunit, putative-like [Saccoglossus kowalevskii]
          Length = 614

 Score = 37.7 bits (86), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 46/194 (23%), Positives = 86/194 (44%), Gaps = 32/194 (16%)

Query: 243 LENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAF-- 300
           LE  +V++++ V+SSD V++    V   T+T Q        + S     +K+KET     
Sbjct: 229 LEEKEVNTSSNVESSDNVLDQTATVSGDTETMQ--------VTSSEEQTVKTKETDCTET 280

Query: 301 -------LENIADSTSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELM 353
                  LE   D  S++  +   +  + +  +++ +   T  N TS L+++S K   L 
Sbjct: 281 DCSMVTSLEETTDKVSSLEETTDKVTSLEETTERVANLDETDNNATS-LDETSDKMPSLE 339

Query: 354 SKINNISALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSG-----LNDI 408
              +N+++L E++         M +  D S K+   +    +NL +  ++G     L + 
Sbjct: 340 ETSDNMASLVESSD--------MSSLEDGSNKVT-SLEETSDNLTSLEETGNKSSSLEET 390

Query: 409 QNLVRKLQETVNHF 422
            N V  L+ET N  
Sbjct: 391 SNKVTSLEETSNKV 404


>gi|57238062|ref|YP_179311.1| methyl-accepting chemotaxis protein [Campylobacter jejuni RM1221]
 gi|57166866|gb|AAW35645.1| methyl-accepting chemotaxis protein [Campylobacter jejuni RM1221]
          Length = 459

 Score = 37.7 bits (86), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 62/254 (24%), Positives = 104/254 (40%), Gaps = 41/254 (16%)

Query: 184 ETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVNQIL 243
           E +  + A+NI  I+K +   +VT  S+       T+ DL            L   N+ +
Sbjct: 122 EGLKGIFAHNIEFINKALANIEVTARSTFKNALSRTLMDL-----------SLGNQNKDM 170

Query: 244 ENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKM----KSKETSA 299
             I  S N  +     V +TV  +   + T  E G ++D L S   S M     SKET  
Sbjct: 171 SQISSSLNQDISIMKNVYDTVDAI---SHTATENGSEVDSLQSAMGSLMDVVNSSKET-- 225

Query: 300 FLENIADSTSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNI 359
            ++    ++ N+ S +  IR+I DQ   +++    IE   +   +  + FA +  ++  +
Sbjct: 226 -VQTFVANSQNITSVVEVIRDIADQ-TNLLALNAAIE--AARAGEHGRGFAVVADEVRKL 281

Query: 360 SALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETV 419
                          A  T R TSE I+  I ++  +  N  QSG   + N+V + +E +
Sbjct: 282 ---------------AERTQRSTSE-ISIAIQTMQQDFVNI-QSGSEQVFNIVSESEERI 324

Query: 420 NHFDDCLNNFERNP 433
           N F       E N 
Sbjct: 325 NKFSQAFKRLEENS 338


>gi|254823474|ref|ZP_05228475.1| virulence factor Mce family protein [Mycobacterium intracellulare
           ATCC 13950]
          Length = 346

 Score = 37.7 bits (86), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 31/112 (27%), Positives = 50/112 (44%), Gaps = 9/112 (8%)

Query: 9   SVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRFNGIPVGRI 68
           SV L + +++ F  F      R+N Y    +        ++ GL     VR +G+ VG++
Sbjct: 14  SVVLLIFTVMIFVVFGQMRFDRTNGYSAEFS--------NISGLRAGQFVRASGVEVGKV 65

Query: 69  VGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
             + L  +    +  K  +    PLY STTA IR   L G  Y+E+   + E
Sbjct: 66  DKVEL-VDGGKRARVKFNVDRSIPLYQSTTAQIRYLDLIGNRYLEIKRGQGE 116


>gi|145491423|ref|XP_001431711.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 gi|124398816|emb|CAK64313.1| unnamed protein product [Paramecium tetraurelia]
          Length = 774

 Score = 37.7 bits (86), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 41/189 (21%), Positives = 93/189 (49%), Gaps = 17/189 (8%)

Query: 261 INTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKET-SAFLENIADSTSNMRSSISAIR 319
           +  + D+++T+Q  Q    +++  L+D  +K+K  E     L  + DST      I++++
Sbjct: 263 LGMLDDLQKTSQDLQFANGQLNQQLNDLRNKLKDLEGIKNELNQLRDSTKKKDQEIASLK 322

Query: 320 -EITDQRQKIISTINTIENITSNLNDSSQKFAE-------LMSKINNISALKENNSLFKD 371
            ++ D +++I      +++ T  LN+   K+ +       L   + N   L+E +S   D
Sbjct: 323 MQLNDAQKQISDLQKQVQDQTRLLNEIQYKYRQAEQDKMKLQKDLQN--CLEELDSA--D 378

Query: 372 AQRAM-HTFRDTSEKINRYIPSI---GNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLN 427
            Q+ +    +D +EK+N+ +  +    + LQN ++   N + +L+R++Q+  N   D   
Sbjct: 379 GQKDVAEQLKDDNEKLNQEVDQLHEENDKLQNENEDLKNRLNDLLRQIQDKDNKLKDLQT 438

Query: 428 NFERNPQDI 436
           +  +  Q++
Sbjct: 439 DLNKKNQEL 447


>gi|297584868|ref|YP_003700648.1| methyl-accepting chemotaxis sensory transducer [Bacillus
           selenitireducens MLS10]
 gi|297143325|gb|ADI00083.1| methyl-accepting chemotaxis sensory transducer [Bacillus
           selenitireducens MLS10]
          Length = 601

 Score = 37.7 bits (86), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 68/308 (22%), Positives = 134/308 (43%), Gaps = 54/308 (17%)

Query: 127 IATERNQRAMITA---TPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTIANI 183
           IAT   Q A +T    T +G N  I + E  S+++  SS H+ +        +  +++ +
Sbjct: 298 IATVEEQSASLTEIAETNNGFNQRIRDIEGASEEMKASSDHVSESTRGGISLMRESVSRM 357

Query: 184 ETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVNQIL 243
           E IS  +  + S +D +M         +D+  TF        +++K+ +  +L  +N  +
Sbjct: 358 EVISHDVDQSTSKVDALM-------KQADNMMTFT------ATINKIAEKTNLLALNASI 404

Query: 244 ENIQVS--SNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAFL 301
           E  +       F   ++++     DV  T      +G+ ++ L+ DF S     E  A  
Sbjct: 405 EAARAGEYGKGFAVVAEEIRILSSDVNTT------IGE-MNQLIEDFQS-----EALAIA 452

Query: 302 ENIADSTSN-------MRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMS 354
           + + DS+ N       M ++I+ + EI D  + +++ I+     TS+L+  +++ AE+  
Sbjct: 453 QELKDSSQNTHEEQQQMETNIAQLGEIEDLMKDLVAKID---QSTSSLSTMAKESAEINQ 509

Query: 355 KINNISALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRK 414
            +  ++ L    + + D   A  +  D +  INR     GN  +N +             
Sbjct: 510 SLEELTTLSSKTNDYID--EASESVSDQNHMINRMNDHTGNLNENAA------------S 555

Query: 415 LQETVNHF 422
           L+ET+N F
Sbjct: 556 LKETMNRF 563


>gi|42524507|ref|NP_969887.1| ABC-type organic solvent transporter, solute-binding periplasmic
           protein. [Bdellovibrio bacteriovorus HD100]
 gi|39576716|emb|CAE80880.1| ABC-type organic solvent transporter, solute-binding periplasmic
           protein [Bdellovibrio bacteriovorus HD100]
          Length = 458

 Score = 37.7 bits (86), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 62/270 (22%), Positives = 117/270 (43%), Gaps = 46/270 (17%)

Query: 10  VGLFVVSILFFSFFSIYWLSRSNQ--YDGPMAEVIIRIPGSVDGLSTDSSVRFNGIPVGR 67
           VGL V  I+  S  ++  +  S+   Y G   +    +P +  GL  +S+VR  GIPVG 
Sbjct: 11  VGLMV--IVVGSLIAVMSMQVSDDPSYLGRSKKAWFLLP-NAGGLVKNSAVRSAGIPVGV 67

Query: 68  IVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKEKKTIFQI 127
           I  + L        +    I+ + PL  S +  I+ QG+ G  +IE+         +   
Sbjct: 68  IKDIRLQDGMARIDIT---IKSEVPLTTSASVEIKAQGILGDKHIEVYPGSPTDPPL--- 121

Query: 128 ATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKP----------LT 177
             E N + +     +G+       EN   ++SD +  ++++ +N+++           L 
Sbjct: 122 --EDNAQILSIKDGAGM-------ENLMAQVSDVASSLKEVAKNLKEATSEDGTRAHVLG 172

Query: 178 TTIANIETISTVLA-------NNISHIDKMMHTT-----QVTPHSSDS--KNTFNTITDL 223
             + NIET++  LA       + I  I   +H       +V    SDS  K T+  +++ 
Sbjct: 173 RIVKNIETLTGDLAQMTTENKDKIGDIVDDIHGITANLQEVMNDKSDSGLKETWKKLSNT 232

Query: 224 ITSLDKMIKAIDLQK--VNQILENIQVSSN 251
           + +LD +   I+  +  + +++ + Q S N
Sbjct: 233 VKNLDDITTRINKGEGALGKLISDEQTSEN 262


>gi|56416420|ref|YP_153494.1| hypothetical protein AM074 [Anaplasma marginale str. St. Maries]
 gi|254994651|ref|ZP_05276841.1| Conserved family protein [Anaplasma marginale str. Mississippi]
 gi|255002759|ref|ZP_05277723.1| Conserved family protein [Anaplasma marginale str. Puerto Rico]
 gi|255003891|ref|ZP_05278692.1| Conserved family protein [Anaplasma marginale str. Virginia]
 gi|56387652|gb|AAV86239.1| hypothetical protein AM074 [Anaplasma marginale str. St. Maries]
          Length = 151

 Score = 37.7 bits (86), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 34/66 (51%), Gaps = 2/66 (3%)

Query: 49  VDGLSTDSSVRFNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAG 108
           VDGL   S VR +G+ VG +  L LDQ   N  + K  ++    L   ++AT+    L G
Sbjct: 50  VDGLRVGSEVRVSGVNVGSVTALHLDQN--NMPVVKMCVQKGVSLPVDSSATVTYADLLG 107

Query: 109 ITYIEL 114
             Y+++
Sbjct: 108 KKYVDI 113


>gi|220904329|ref|YP_002479641.1| Mammalian cell entry related domain protein [Desulfovibrio
          desulfuricans subsp. desulfuricans str. ATCC 27774]
 gi|219868628|gb|ACL48963.1| Mammalian cell entry related domain protein [Desulfovibrio
          desulfuricans subsp. desulfuricans str. ATCC 27774]
          Length = 322

 Score = 37.7 bits (86), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 34/68 (50%), Gaps = 1/68 (1%)

Query: 1  MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
          M ++ Y T+VG FV+  L         L     +   M + ++   GSV GLST + V F
Sbjct: 1  MNAQKYRTTVGAFVLGGLSLLALGFIVLGGGRLFSNDM-QYVLYFDGSVSGLSTGAPVVF 59

Query: 61 NGIPVGRI 68
           G+P+G +
Sbjct: 60 RGVPMGSV 67


>gi|184157380|ref|YP_001845719.1| Phage-related minor tail protein [Acinetobacter baumannii ACICU]
 gi|183208974|gb|ACC56372.1| Phage-related minor tail protein [Acinetobacter baumannii ACICU]
          Length = 1461

 Score = 37.7 bits (86), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 25/76 (32%), Positives = 47/76 (61%), Gaps = 1/76 (1%)

Query: 304 IADSTSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNISALK 363
           +ADS+S +   ++AI ++    ++I+  +N   + T ++ND+ ++F EL    +  +ALK
Sbjct: 478 LADSSSKINIQLNAIAQLYKGNKEIVQVVNDARDGTISMNDAVKRFNELRISKDIYNALK 537

Query: 364 ENNSLF-KDAQRAMHT 378
           EN+S F K+A+ A  T
Sbjct: 538 ENSSEFEKNAKEAKTT 553


>gi|301772688|ref|XP_002921763.1| PREDICTED: coiled-coil domain-containing protein 46-like
           [Ailuropoda melanoleuca]
          Length = 955

 Score = 37.7 bits (86), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 62/249 (24%), Positives = 108/249 (43%), Gaps = 50/249 (20%)

Query: 194 ISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVNQILENIQVSSNNF 253
           + H  +  H +Q   HS++  +        I +L+K ++A +++  NQI E        F
Sbjct: 666 LEHEQEKTHLSQ--QHSAEKDSLVRDHEREIENLEKQLRAANMEHENQIQE--------F 715

Query: 254 VKSSDQVI----NTVHDVRET--------TQTFQEVGQKIDHLLSDFSSKMKSKETSAFL 301
            K   QVI      VH +RE          Q   E+G     LL +   +  +++    +
Sbjct: 716 KKRDSQVIADMEAQVHKLREELIHVNSQRKQQLIELG-----LLREEEKQRAARDHETAV 770

Query: 302 ENIADSTSNMRSSI----SAIREITDQRQKIISTINTIE-NITSNLNDSSQKFAELMSKI 356
             +   +  M+  +    +A  E+T   +K  S +  IE   T  L  SSQ  AEL +  
Sbjct: 771 YKLKAESEKMKMELKKTHAAETEVT--LEKANSRLKQIEKEYTQKLAKSSQIIAELQT-- 826

Query: 357 NNISALKENNSLFKDA-----QRAMHTFRDTSEKI----NRYIPSIGNNLQNFSQSGLND 407
            +IS+LKE NS  + A     Q  +  F D  +++    +R I ++ + L+N +    N 
Sbjct: 827 -SISSLKEENSRQQLAAERRLQDVIQKFEDEKQQLIRDNDRAIKALQDELENRA----NQ 881

Query: 408 IQNLVRKLQ 416
           ++   +KLQ
Sbjct: 882 VRCAEKKLQ 890


>gi|195342674|ref|XP_002037925.1| GM18531 [Drosophila sechellia]
 gi|194132775|gb|EDW54343.1| GM18531 [Drosophila sechellia]
          Length = 8290

 Score = 37.7 bits (86), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 56/209 (26%), Positives = 93/209 (44%), Gaps = 53/209 (25%)

Query: 261  INTVHDVRETTQTFQEVGQ-KIDHLLSDFSSK--MKSKETSAFLENIADSTSNMRSSISA 317
            +NTV ++R   Q F E GQ K+ +LL +   K  M +++  A    I + T  ++     
Sbjct: 5738 LNTVKNLR---QGF-ETGQNKLRYLL-ELKEKVIMNTEQNGAA--KIQEDTEALKQDFDK 5790

Query: 318  IR-EITDQRQKIISTINTIENI-------------------TSN--LNDSSQKFAEL--- 352
            +  ++ D RQK+ + +  +E I                   TS+  LND S+K A L   
Sbjct: 5791 LLVDLNDVRQKLANRLAQLEEIFKLYKILVEWLEDVEPSVKTSDEFLNDLSEKRAALEKF 5850

Query: 353  -------------MSKINNISALKENNSL-FKDAQRAMHTFRDTSEKINRYIPSIGNNLQ 398
                         + KIN    LKE+NSL  KD Q  +  F D   ++N+ I S+ N + 
Sbjct: 5851 RVIQRDINGHNDIVEKINQ--RLKEDNSLDLKDFQPGLTKFDDLQTQVNKIIESLENQVN 5908

Query: 399  NFS--QSGLNDIQNLVRKLQETVNHFDDC 425
            +    +   N++Q+ +R+ +  V    DC
Sbjct: 5909 SHEKYKQAYNELQDWLRRTRIEVEQCADC 5937


>gi|194856553|ref|XP_001968775.1| GG25055 [Drosophila erecta]
 gi|190660642|gb|EDV57834.1| GG25055 [Drosophila erecta]
          Length = 8391

 Score = 37.7 bits (86), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 56/209 (26%), Positives = 93/209 (44%), Gaps = 53/209 (25%)

Query: 261  INTVHDVRETTQTFQEVGQ-KIDHLLSDFSSK--MKSKETSAFLENIADSTSNMRSSISA 317
            +NTV ++R   Q F E GQ K+ +LL +   K  M +++  A    I + T  ++     
Sbjct: 5839 LNTVKNLR---QGF-ETGQNKLRYLL-ELKEKVIMNTEQNGAA--KIQEDTEALKQDFDK 5891

Query: 318  IR-EITDQRQKIISTINTIENI-------------------TSN--LNDSSQKFAEL--- 352
            +  ++ D RQK+ + +  +E I                   TS+  LND S+K A L   
Sbjct: 5892 LLVDLNDVRQKLANRLAQLEEIFKLYKILVEWLEDVEPSVKTSDEFLNDLSEKRAALEKF 5951

Query: 353  -------------MSKINNISALKENNSL-FKDAQRAMHTFRDTSEKINRYIPSIGNNLQ 398
                         + KIN    LKE+NSL  KD Q  +  F D   ++N+ I S+ N + 
Sbjct: 5952 RVIQRDINGHNDIVEKINQ--RLKEDNSLDLKDFQPGLTKFDDLQTQVNKIIESLENQVN 6009

Query: 399  NFS--QSGLNDIQNLVRKLQETVNHFDDC 425
            +    +   N++Q+ +R+ +  V    DC
Sbjct: 6010 SHEKYKQAYNELQDWLRRTRIEVEQCADC 6038


>gi|144898204|emb|CAM75068.1| ABC transporter substrate binding protein [Magnetospirillum
           gryphiswaldense MSR-1]
          Length = 170

 Score = 37.7 bits (86), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 36/75 (48%), Gaps = 1/75 (1%)

Query: 48  SVDGLSTDSSVRFNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLA 107
            + GL + + VR NGI VG +    LD    N  +    I  D  L   TTATI  +GL 
Sbjct: 45  GIGGLDSGADVRINGIKVGTVASQSLDPVSYNAGVTLT-IAQDIRLPADTTATIAAEGLL 103

Query: 108 GITYIELSTLRKEKK 122
           G  YI+L   R + +
Sbjct: 104 GGKYIKLIPGRAKDR 118


>gi|320544538|ref|NP_001188692.1| Muscle-specific protein 300, isoform B [Drosophila melanogaster]
 gi|318068307|gb|ADV36942.1| Muscle-specific protein 300, isoform B [Drosophila melanogaster]
          Length = 8382

 Score = 37.7 bits (86), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 56/209 (26%), Positives = 93/209 (44%), Gaps = 53/209 (25%)

Query: 261  INTVHDVRETTQTFQEVGQ-KIDHLLSDFSSK--MKSKETSAFLENIADSTSNMRSSISA 317
            +NTV ++R   Q F E GQ K+ +LL +   K  M +++  A    I + T  ++     
Sbjct: 5830 LNTVKNLR---QGF-ETGQNKLRYLL-ELKEKVIMNTEQNGAA--KIQEDTEALKQDFDK 5882

Query: 318  IR-EITDQRQKIISTINTIENI-------------------TSN--LNDSSQKFAEL--- 352
            +  ++ D RQK+ + +  +E I                   TS+  LND S+K A L   
Sbjct: 5883 LLVDLNDVRQKLANRLAQLEEIFKLYKILIEWLEDVEPSVKTSDEFLNDLSEKRAALEKF 5942

Query: 353  -------------MSKINNISALKENNSL-FKDAQRAMHTFRDTSEKINRYIPSIGNNLQ 398
                         + KIN    LKE+NSL  KD Q  +  F D   ++N+ I S+ N + 
Sbjct: 5943 RVIQRDINGHNDIVEKINQ--RLKEDNSLDLKDFQPGLTKFDDLQTQVNKIIESLENQVN 6000

Query: 399  NFS--QSGLNDIQNLVRKLQETVNHFDDC 425
            +    +   N++Q+ +R+ +  V    DC
Sbjct: 6001 SHEKYKQAYNELQDWLRRTRIEVEQCADC 6029


>gi|188587251|ref|YP_001918796.1| methyl-accepting chemotaxis sensory transducer [Natranaerobius
           thermophilus JW/NM-WN-LF]
 gi|179351938|gb|ACB86208.1| methyl-accepting chemotaxis sensory transducer [Natranaerobius
           thermophilus JW/NM-WN-LF]
          Length = 583

 Score = 37.7 bits (86), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 23/101 (22%), Positives = 55/101 (54%), Gaps = 18/101 (17%)

Query: 326 QKIISTINTIENITSNLNDSSQKFAE----LMSKINNISALKENNSLFKDAQRAMHTFRD 381
           Q++   I+T++ ++ +LN +S+K A+    +  K+ N++A+ E NS              
Sbjct: 495 QELAEAIDTVDKVSQDLNKASEKMAQQESKIQEKVQNLAAIAEENSA------------- 541

Query: 382 TSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNHF 422
            +E+ +  +    ++L+  +++G ND+  L  +++E+V+ F
Sbjct: 542 NTEESSASMEEQSSSLEQIAKAG-NDLAKLAEEMKESVSQF 581


>gi|167525511|ref|XP_001747090.1| hypothetical protein [Monosiga brevicollis MX1]
 gi|163774385|gb|EDQ88014.1| predicted protein [Monosiga brevicollis MX1]
          Length = 420

 Score = 37.7 bits (86), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 44/188 (23%), Positives = 81/188 (43%), Gaps = 29/188 (15%)

Query: 233 AIDLQKVNQILENIQVSSNNFVKSSDQVINTVHD--VRETTQTFQEVGQKIDHLLSDFSS 290
           AI L  V+ ++ +I +S N+ +++   V+ TV+   +  + Q   EV +++ HLLSD  S
Sbjct: 87  AITLDNVHAVIGSISMS-NSPLQALFHVVQTVYSPMLLRSNQWSAEVDKRVQHLLSDLES 145

Query: 291 KMKSKETSAFLENIADSTSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFA 350
            + +   +A      D TS       AIR  +D+        +   N+     + +Q F 
Sbjct: 146 GLGTAMRAA-----PDGTSE------AIRSPSDECSYWAEMASRAANLEE--RERAQMFG 192

Query: 351 ELMSKINNISALKENNSL-------------FKDAQRAMHTFRDTSEKINRYIPSIGNNL 397
           +++S++ N ++   + SL               D  R         E++ R +  IG+ L
Sbjct: 193 DMLSELRNATSSMRSMSLLDLQDLVDRCEEVLDDVWRVTDVTPFPGERMERLMAIIGDAL 252

Query: 398 QNFSQSGL 405
            N  Q  L
Sbjct: 253 LNGIQEQL 260


>gi|222474790|ref|YP_002563205.1| Conserved family protein [Anaplasma marginale str. Florida]
 gi|222418926|gb|ACM48949.1| Conserved family protein [Anaplasma marginale str. Florida]
          Length = 154

 Score = 37.7 bits (86), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 34/66 (51%), Gaps = 2/66 (3%)

Query: 49  VDGLSTDSSVRFNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAG 108
           VDGL   S VR +G+ VG +  L LDQ   N  + K  ++    L   ++AT+    L G
Sbjct: 53  VDGLRVGSEVRVSGVNVGSVTALHLDQN--NMPVVKMCVQKGVSLPVDSSATVTYADLLG 110

Query: 109 ITYIEL 114
             Y+++
Sbjct: 111 KKYVDI 116


>gi|313674214|ref|YP_004052210.1| mammalian cell entry related domain protein [Marivirga tractuosa
           DSM 4126]
 gi|312940912|gb|ADR20102.1| Mammalian cell entry related domain protein [Marivirga tractuosa
           DSM 4126]
          Length = 311

 Score = 37.7 bits (86), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 63/288 (21%), Positives = 120/288 (41%), Gaps = 52/288 (18%)

Query: 15  VSILFFSF---FSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRFNGIPVGRIVGL 71
           + I +F F     I + + +N+Y          +   V+GL+  + V  +G+ VGR+  +
Sbjct: 17  IVIFYFGFNYLKGIDFFNPTNEY--------YAVYDHVNGLTASNPVLLSGLSVGRVSRI 68

Query: 72  FLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKEKKTIFQIATER 131
            + QE  NH      +R D  L   + A + T  L   T                I  +R
Sbjct: 69  EILQERENHLKVYFEVREDISLGEESVAMLATDILGSQT----------------IVIKR 112

Query: 132 NQRAMIT-ATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTIANIETISTVL 190
           N   M+T   P G         + + +I + +  + K ++++ + L + +ANI+      
Sbjct: 113 N---MVTNPLPEGSEIKGDIEPSLTSQIQEQAYPVLKTLDSVGQHLNSILANID------ 163

Query: 191 ANNISHIDKMMHTTQVTPHS----SDSKNTFNTITDLITSLDKM-------IKAIDLQKV 239
            NN   I  +M   +VT  +    S+ + T N + D    +          +KA+ L+K 
Sbjct: 164 -NNEEAIKNIMLNVEVTTQNLAKISEKQATINAVIDDFKKISATLADEKNGLKAL-LKKT 221

Query: 240 NQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSD 287
           N I ++  V++    K  +++  T+ ++  T    Q+    +D LL+D
Sbjct: 222 NGIADS--VNALELAKVVNRLDTTLININNTVAAMQDGEGTVDKLLND 267


>gi|254479912|ref|ZP_05093160.1| mce related protein [marine gamma proteobacterium HTCC2148]
 gi|214039474|gb|EEB80133.1| mce related protein [marine gamma proteobacterium HTCC2148]
          Length = 322

 Score = 37.7 bits (86), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 67/326 (20%), Positives = 130/326 (39%), Gaps = 66/326 (20%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M  K +  ++G FVV  L  +  +I + +    +    + V++   GSV GL+  + V  
Sbjct: 1   MSEKPHTVAIGAFVVGALLIAISTIIF-ALGTGFGKERSTVVMVFEGSVKGLTIGAPVAL 59

Query: 61  NGIPVGRI--VGLFLDQEYPNH-SLAKALIRPDTPLYPSTTA----------TIRTQG-- 105
            G+ +G++  + L LD +      L +A IR +      T A           +R Q   
Sbjct: 60  RGVQIGQVTAIELILDADTVELIMLVEAEIRGENIRRTGTNAESLTEELISRGLRAQLNT 119

Query: 106 ---LAGITYIELSTLRKEKKTIFQI------------ATERNQRAM-----------ITA 139
              L G+ YI+L      K  + +I              ER  R +           + A
Sbjct: 120 QSILTGLLYIQLDFHPNSKLILAEIDSPHLQIPTIPTGLERLTRKLESIDFAKIASDLEA 179

Query: 140 TPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTIANIETISTVLANNISHIDK 199
           T SGIN F+            +S   Q++   ++  L++     + +   L++    +D 
Sbjct: 180 TASGINAFV------------TSESFQELPAQLQDTLSSVTGLSKQLQVQLSSTGPRLDA 227

Query: 200 MMHTTQVTPHSSDSKNT-FNTITDLITSLDKMIKAIDLQKVNQILENIQVSSNNFVKSSD 258
           ++    +T    D+ NT    + +LITS  +++KA  +Q   + ++ ++       K  D
Sbjct: 228 VLDGAAIT---VDTANTELPKLAELITSNLEVLKA-AIQAFEEGMDGVE-------KLVD 276

Query: 259 QVINTVHDVRETTQTFQEVGQKIDHL 284
               TV+++    +   + G+ +  L
Sbjct: 277 HDSATVYELNRALRELSQAGRALQQL 302


>gi|281349281|gb|EFB24865.1| hypothetical protein PANDA_010674 [Ailuropoda melanoleuca]
          Length = 935

 Score = 37.4 bits (85), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 62/249 (24%), Positives = 108/249 (43%), Gaps = 50/249 (20%)

Query: 194 ISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVNQILENIQVSSNNF 253
           + H  +  H +Q   HS++  +        I +L+K ++A +++  NQI E        F
Sbjct: 667 LEHEQEKTHLSQ--QHSAEKDSLVRDHEREIENLEKQLRAANMEHENQIQE--------F 716

Query: 254 VKSSDQVI----NTVHDVRET--------TQTFQEVGQKIDHLLSDFSSKMKSKETSAFL 301
            K   QVI      VH +RE          Q   E+G     LL +   +  +++    +
Sbjct: 717 KKRDSQVIADMEAQVHKLREELIHVNSQRKQQLIELG-----LLREEEKQRAARDHETAV 771

Query: 302 ENIADSTSNMRSSI----SAIREITDQRQKIISTINTIE-NITSNLNDSSQKFAELMSKI 356
             +   +  M+  +    +A  E+T   +K  S +  IE   T  L  SSQ  AEL +  
Sbjct: 772 YKLKAESEKMKMELKKTHAAETEVT--LEKANSRLKQIEKEYTQKLAKSSQIIAELQT-- 827

Query: 357 NNISALKENNSLFKDA-----QRAMHTFRDTSEKI----NRYIPSIGNNLQNFSQSGLND 407
            +IS+LKE NS  + A     Q  +  F D  +++    +R I ++ + L+N +    N 
Sbjct: 828 -SISSLKEENSRQQLAAERRLQDVIQKFEDEKQQLIRDNDRAIKALQDELENRA----NQ 882

Query: 408 IQNLVRKLQ 416
           ++   +KLQ
Sbjct: 883 VRCAEKKLQ 891


>gi|331699191|ref|YP_004335430.1| virulence factor Mce family protein [Pseudonocardia dioxanivorans
           CB1190]
 gi|326953880|gb|AEA27577.1| virulence factor Mce family protein [Pseudonocardia dioxanivorans
           CB1190]
          Length = 443

 Score = 37.4 bits (85), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 56/276 (20%), Positives = 100/276 (36%), Gaps = 60/276 (21%)

Query: 89  PDTPLYPSTTATIRTQGLAGITYIELSTLRKEKKTIFQIATERNQRAMITATPSGINYFI 148
           PD  L     A + +  L    Y+EL+ +      +   A    +R   TA P G++   
Sbjct: 84  PDVQLPADVKAVVVSPSLVTGRYVELAPVWTGGPRLADGAVIPLER---TAVPLGVDDLS 140

Query: 149 SNAENTSKKISDSSRHIQKIIENIEKPLTTTIANIETISTVLANNISHIDKMMHTTQVTP 208
             A   +  +  +  +    + ++   L    AN++     L + I ++ ++  T     
Sbjct: 141 RTATQLADALGPNGANKTGALSDV---LGVAAANLDGNGQALNDTIHNLGQLSTT----- 192

Query: 209 HSSDSKNTFNTITDLITSLDKMIKAIDLQKVNQILENIQVSSNNFVKSSDQVINTVHDVR 268
            S  S + F TIT L             QKV + L+N   +   F    D V  T+ D R
Sbjct: 193 LSGSSDDLFGTITQL-------------QKVTETLKNDDGTVREFTDRLDSVTRTLADQR 239

Query: 269 ETTQTFQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNMRSSISAIREITDQRQKI 328
           E      ++G  +  L       +   E  AF                    I D R  +
Sbjct: 240 E------DLGGALQEL------SLALGEVQAF--------------------IADNRAAL 267

Query: 329 ISTINTIENITSNLNDSSQKFAELM----SKINNIS 360
            S ++ + ++T  L D  +  AE++    + + N+S
Sbjct: 268 KSDVDKLTDVTGTLADEQRALAEILDVAPAAVGNLS 303


>gi|74316996|ref|YP_314736.1| ABC-type transport system periplasmic component [Thiobacillus
           denitrificans ATCC 25259]
 gi|74056491|gb|AAZ96931.1| ABC-type transport system periplasmic component [Thiobacillus
           denitrificans ATCC 25259]
          Length = 308

 Score = 37.4 bits (85), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 62/299 (20%), Positives = 122/299 (40%), Gaps = 52/299 (17%)

Query: 10  VGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRFNGIPVGRIV 69
           VGLF  + LF +   + +L  +  +   + E+ +    S DG++    V F+GI +GR+ 
Sbjct: 8   VGLFAATSLFLAAVFVVYLLHARGFFEDIFELRL-AAASADGVAPGVPVVFSGIEIGRVS 66

Query: 70  GLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKEKKTIFQIAT 129
            L L+ +      A+ L R    L  ++T T+  + L G   I + +   +  T+   +T
Sbjct: 67  TLGLNDDGGIVIRAEFLERNAKWLRETSTFTL-DKPLVGGAKIRVDSPDLDAPTLADGST 125

Query: 130 ERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIE------KPLTTTIANI 183
                             +  + + SK+I      ++ I+ N+E        +  T+AN+
Sbjct: 126 -----------------VLLLSSDVSKEIPALVERVKAILANVEHLTRKDGEVNATLANV 168

Query: 184 ETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAID-------- 235
           E ++  +      ++ ++ + +     +DS    +    LIT LD +    D        
Sbjct: 169 EKLTGRMTGEYGMLEGLLGSAEKARAVTDS---LDKTRALITKLDGIALKTDRWLFAPDG 225

Query: 236 --------LQKVNQILENIQVSSNNFVKSSDQV----INTVHDVRETTQTFQEVGQKID 282
                   L +V  +L + Q S    +K +D V    ++   DV++ TQ    +  +ID
Sbjct: 226 VAEETRASLAQVRLMLNDAQAS----LKKADAVMANAVDISADVKQGTQDIAALRSEID 280


>gi|222100039|ref|YP_002534607.1| Methyl-accepting chemotaxis protein 4 [Thermotoga neapolitana DSM
           4359]
 gi|221572429|gb|ACM23241.1| Methyl-accepting chemotaxis protein 4 [Thermotoga neapolitana DSM
           4359]
          Length = 566

 Score = 37.4 bits (85), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 54/272 (19%), Positives = 121/272 (44%), Gaps = 41/272 (15%)

Query: 131 RNQRAMITATPSGINYFISNAENTSK---KISDSSRHIQKIIENIEKPLTTTIANIETIS 187
           +N  A I    SG     +N++N SK   +IS+++ +I    +N +K L   +  +E +S
Sbjct: 303 QNASASIEEVTSGSEEVAANSQNISKLIQEISENAENISNFAKNGQKVLEEAVRKVEDVS 362

Query: 188 -------------TVLANNISHIDKMMHTTQV------------TPHSSDSKNTFNTITD 222
                        T  A NI  I + + +                  + ++   F  + D
Sbjct: 363 ENSRTTAEVVLKVTESARNIEEIVRTIQSIAEQTNLLALNAAIEAARAGEAGRGFAVVAD 422

Query: 223 LITSLDKMIKAIDLQKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKID 282
            I  L +  +    ++++QILENI+       + S + +    D R+  +   E   +I 
Sbjct: 423 EIRKLAEESQRA-TEEISQILENIREGVERTNEMSKENVEITKDARKLVEESYENFNQIV 481

Query: 283 HLLSDFSSKMKSKETSAFLENIADSTSNMRSSISAIREITDQRQKIISTINTIENITSNL 342
             + D +++++    SA  + ++ ++  M S++ A+ + T       +  + IE +++N+
Sbjct: 482 SRIEDLAARIEGIAASA--QELSAASEEMSSALDAVAKTT------TTVADEIEEVSTNI 533

Query: 343 ND---SSQKFAELMSKINNIS-ALKENNSLFK 370
            +   ++++ A++ +++  +S  LKE+   FK
Sbjct: 534 TEQEKAAKRIADVGTELKKLSDELKEDVEKFK 565


>gi|312111882|ref|YP_003990198.1| methyl-accepting chemotaxis sensory transducer [Geobacillus sp.
           Y4.1MC1]
 gi|311216983|gb|ADP75587.1| methyl-accepting chemotaxis sensory transducer [Geobacillus sp.
           Y4.1MC1]
          Length = 536

 Score = 37.4 bits (85), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 51/244 (20%), Positives = 108/244 (44%), Gaps = 34/244 (13%)

Query: 205 QVTPHSSDSKNTFNTITDLITSLDKMIKAI--DLQK----VNQILENIQVSSNNFVKSSD 258
           Q   H++  +N F+ I   I  +   I+A+  +L K    VNQ+ E  Q+ +    +S D
Sbjct: 201 QTEVHTARKRNEFHQIAYEINKMIFGIRAMITELAKAAKTVNQVSEQQQLETKRLSESFD 260

Query: 259 QVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNMRSSISAI 318
           ++   +   RE T+      ++ +HL+     +++  +     E +    S+ +++++++
Sbjct: 261 EIAAAMETFREGTKQQTASVEQANHLVIQMVERVQKMQ-----EEVERVVSHAKTALTSM 315

Query: 319 ----REITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNISALKENNSLFK---- 370
               R I + +QK+ +    I   T+ ++ +SQ+ A   + I+ I  + +  +L      
Sbjct: 316 DEGNRLIEETKQKMDTMQQEINKTTALIHAASQEAANAQNMISAIRTITKQTNLLALNAS 375

Query: 371 -DAQRA----------MHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETV 419
            +A RA              R  +E  N +   I ++LQ  +    N + N V+ +QE  
Sbjct: 376 IEASRAGEAGKGFAVVAQEVRKLAEDTNDFAAKILSSLQTMT----NVLHNAVQAVQENE 431

Query: 420 NHFD 423
            H +
Sbjct: 432 QHVE 435


>gi|71415623|ref|XP_809872.1| hypothetical protein [Trypanosoma cruzi strain CL Brener]
 gi|70874319|gb|EAN88021.1| hypothetical protein, conserved [Trypanosoma cruzi]
          Length = 939

 Score = 37.4 bits (85), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 30/101 (29%), Positives = 48/101 (47%), Gaps = 13/101 (12%)

Query: 323 DQRQKIISTINTI-ENITSNLNDSSQKFAELMSKINNISALKENNSLFKDAQRAMHTFRD 381
           D+R+++  TI  + ENITS   +  Q        I N+   +E N+   D +RA H   D
Sbjct: 478 DERRRLNKTIEQLNENITSREQEYEQH-------IRNLR--EERNAACHDLERARHELND 528

Query: 382 T---SEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETV 419
           T   +E + R + +     +N+ Q   +  Q L R LQE +
Sbjct: 529 TQQRAESLQRELDTRTCYFENYRQQAEDHQQQLNRSLQEEM 569


>gi|86133693|ref|ZP_01052275.1| ABC transporter, periplasmic binding protein [Polaribacter sp.
           MED152]
 gi|85820556|gb|EAQ41703.1| ABC transporter, periplasmic binding protein [Polaribacter sp.
           MED152]
          Length = 322

 Score = 37.4 bits (85), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 37/142 (26%), Positives = 64/142 (45%), Gaps = 28/142 (19%)

Query: 304 IADSTSNMRSSISAIRE--------ITDQRQKIISTINTIENITSNLNDSSQKFAELMSK 355
           I  S SN+ ++I  +R+        + D +  +  T+   +NIT NLN    K A+ ++ 
Sbjct: 176 INSSVSNLAATIYELRQTIKTVNSLVVDNQDNLKETLENTKNITGNLN----KLADSLTT 231

Query: 356 INNISALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKL 415
           +N        NS+ + A+ A+  F + S+KIN    SIG          +ND   L R +
Sbjct: 232 VNF-------NSIIQKAENAVDNFNELSKKINSTDGSIG--------RLIND-DELYRNV 275

Query: 416 QETVNHFDDCLNNFERNPQDIV 437
           +      +  L + + NP+  V
Sbjct: 276 EAATKELEQLLRDLKINPKRYV 297


>gi|257459531|ref|ZP_05624640.1| putative ABC transport system periplasmic substrate-binding protein
           [Campylobacter gracilis RM3268]
 gi|257442956|gb|EEV18090.1| putative ABC transport system periplasmic substrate-binding protein
           [Campylobacter gracilis RM3268]
          Length = 309

 Score = 37.4 bits (85), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 26/116 (22%), Positives = 56/116 (48%), Gaps = 2/116 (1%)

Query: 1   MESKNYYTSVGLFV-VSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVR 59
           ME++  YT VG FV + +   + F  + L+++++ +   +  I      V G+  +S V+
Sbjct: 1   MENRTSYTIVGAFVMICVAALTAFMWWMLTKTDRGESYRSYYIHTKELPV-GIKENSEVK 59

Query: 60  FNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELS 115
           F G+  G I  +            +  ++   P+   + A + +QG++GI +I ++
Sbjct: 60  FIGVNAGIIKSIDFADIENAIIEIEISVKSKLPISQDSVAKVESQGISGIAFINIT 115


>gi|32266012|ref|NP_860044.1| hypothetical protein HH0513 [Helicobacter hepaticus ATCC 51449]
 gi|32262061|gb|AAP77110.1| conserved hypothetical protein [Helicobacter hepaticus ATCC 51449]
          Length = 532

 Score = 37.4 bits (85), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 55/233 (23%), Positives = 108/233 (46%), Gaps = 43/233 (18%)

Query: 137 ITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTIANIETISTVLAN---- 192
           I  T S ++ F+ N ++T   I++S++  Q I++++E+ LT     I+++ +++A+    
Sbjct: 317 IAQTESILDDFVKNLQDTIGLITNSAQTQQNILQHVEE-LTQHADQIKSVLSIIADIADQ 375

Query: 193 -NISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVNQILENIQVSSN 251
            N+  ++  +   +   H       F  + D               +V ++ E  Q S N
Sbjct: 376 TNLLALNAAIEAARAGEHG----RGFAVVAD---------------EVRKLAEKTQKSLN 416

Query: 252 NFVKSSDQVINTVHDV----RETTQTFQEVGQKIDHLLSDFSSKMK----SKETSAFLEN 303
               S + V  +V DV    R+TT+    + +K   L+ D     +    +K+ S  L++
Sbjct: 417 EIAASVNLVTQSVQDVGQTIRDTTKDMMYITEKTSPLIDDAHHTQQNLVLTKQNSIHLKD 476

Query: 304 IADSTSNMRSSISAIREITDQRQKIISTINTIEN----ITSNLNDSSQKFAEL 352
           I  STS  +S+    +E+    Q I+S+  + ++    I  ++ND SQK  EL
Sbjct: 477 I--STSIAQST----KELAQMMQDIVSSSESTQSVGHTIQKDVNDMSQKAQEL 523


>gi|291531384|emb|CBK96969.1| Methyl-accepting chemotaxis protein [Eubacterium siraeum 70/3]
          Length = 661

 Score = 37.4 bits (85), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 48/247 (19%), Positives = 102/247 (41%), Gaps = 57/247 (23%)

Query: 209 HSSDSKNTF--------NTITDLITSLDKMIKAIDL---------QKVNQILENIQVSSN 251
           HS D+ NT+         ++ D+ T L+  +  I +         Q+V+   +++   + 
Sbjct: 375 HSKDADNTYPGDYKVLIESVRDINTKLNDTLSQISIAGDQVSSGSQQVSAGAQSLAQGAT 434

Query: 252 NFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNM 311
               S +++  T+H++    +   E  Q+   L+S         ET+ +   I  +   M
Sbjct: 435 EQAASVEELAATIHNINAHIEATTEDCQRGKQLVS---------ETAGY---IGAANEKM 482

Query: 312 RSSISAIREITDQRQKIISTINTIENI--------------TSNLNDSSQKFAELMSKIN 357
            S  SA+++I+D   +I   I TIE+I               + + ++ + FA +  ++ 
Sbjct: 483 NSLSSAMQDISDASAEISKIIQTIEDIAFQTNILALNAAVEAARVGEAGKGFAVVADEVR 542

Query: 358 NISALKENNSLFKDAQRAMHTFRDTSEKINRYIPSI--GNNLQNFSQSGLNDIQNLVRKL 415
           N+            A ++     DT+  I R I ++  GNN+ N +   + +++     +
Sbjct: 543 NL------------AGKSADAAHDTTVLIERAIAAVENGNNITNETAQAVAEVETRSGGV 590

Query: 416 QETVNHF 422
            + VN  
Sbjct: 591 SDIVNKI 597


>gi|224020407|ref|NP_042969.2| capsid portal protein [Human herpesvirus 6]
          Length = 646

 Score = 37.4 bits (85), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 39/131 (29%), Positives = 68/131 (51%), Gaps = 19/131 (14%)

Query: 300 FLENIADSTS--NMRSSISA-IREIT----DQRQKII--------STINTIENITSNL-N 343
           FL N++DS S   +R S+   I+EIT    DQ + ++        S I+T E    +L  
Sbjct: 335 FLLNLSDSKSKIGIRDSVEGFIQEITPSIIDQNKLMLNRGQFRKRSAIDTGERDVRDLFK 394

Query: 344 DSSQKFAE--LMSKINNISALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFS 401
               K  E  + ++++ I  LK  N +F+   + +H+  +T+   +RY P++ ++L+N S
Sbjct: 395 KQIIKCMEEQIQTQMDEIETLKTTNQMFERKIKDLHSLLETNNDCDRYNPNLDHDLENLS 454

Query: 402 QS-GLNDIQNL 411
            S  LN +Q L
Sbjct: 455 LSRALNIVQRL 465


>gi|147676537|ref|YP_001210752.1| hypothetical protein PTH_0202 [Pelotomaculum thermopropionicum SI]
 gi|146272634|dbj|BAF58383.1| hypothetical membrane protein [Pelotomaculum thermopropionicum SI]
          Length = 529

 Score = 37.4 bits (85), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 34/157 (21%), Positives = 65/157 (41%), Gaps = 26/157 (16%)

Query: 207 TPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVNQILENIQVSSNN---FVKSSDQVINT 263
           TP    S +   ++   +  + + +KA     +N+I+ N Q+ ++N      S+++V  T
Sbjct: 237 TPIEVKSADELGSLAGSLNGMAEQLKA----HINEIIANAQILASNSEELAASAEEVSAT 292

Query: 264 VHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNMRSSISAIREITD 323
           V +V  TT     + +K                    LEN + +    R+ ++       
Sbjct: 293 VEEVASTTGEVASMAEK-------------------SLENASRTAEESRNVVAVAESGGA 333

Query: 324 QRQKIISTINTIENITSNLNDSSQKFAELMSKINNIS 360
              K I  IN+I    + + +S Q   EL ++I NI+
Sbjct: 334 TVGKTIEKINSIAASAARMGESVQNLGELSARIGNIT 370


>gi|86132287|ref|ZP_01050882.1| ABC transporter, periplasmic binding protein [Dokdonia donghaensis
           MED134]
 gi|85817206|gb|EAQ38389.1| ABC transporter, periplasmic binding protein [Dokdonia donghaensis
           MED134]
          Length = 314

 Score = 37.4 bits (85), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 43/198 (21%), Positives = 90/198 (45%), Gaps = 39/198 (19%)

Query: 276 EVGQKIDHLLSDFSSKMKSK------ETSAFLENI-----ADSTSNMRSSISAIREITDQ 324
           E+G+ I  L+++  + ++++      +T + L N+      D+ +N+R +I+     + +
Sbjct: 127 EMGEGIMELVNERLTPLQNQVEKVIGDTDSLLVNVNSVLDRDTRANLRDAIANFTTASRE 186

Query: 325 RQKIISTINTI--------ENITSNLNDSSQKFAELMSKINNISALKENNSLFKDAQRAM 376
            + I  ++N +        +   +NL+  S  FA L   ++ I    +  ++  D ++ +
Sbjct: 187 LKGISGSVNALLSENQVKLDRTIANLDKMSGNFATLSDSLSQI----QMGTMVADLEKTI 242

Query: 377 HTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFERNPQDI 436
             F++ S K+N    ++G  L        ND Q L   L  T N   D L + + NP+  
Sbjct: 243 ADFQEISNKLNSPEGTVGKLL--------NDEQ-LYLNLDRTANQMGDLLQDMKLNPKRY 293

Query: 437 V----WGREKGSVKIYKP 450
           V    +G++ G+   Y P
Sbjct: 294 VHFSLFGKKPGA---YTP 308


>gi|332168813|gb|AEE18068.1| Mammalian cell entry related domain protein [Krokinobacter
           diaphorus 4H-3-7-5]
          Length = 314

 Score = 37.4 bits (85), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 57/277 (20%), Positives = 111/277 (40%), Gaps = 38/277 (13%)

Query: 12  LFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRFNGIPVGRIVGL 71
           + V++ L    F   +L  +N  D   ++++     +V+GL+  S V  NG+PVGR++ +
Sbjct: 9   ILVIAALLLVIFGYNYLKGNNLLD--KSKILYAKYDNVEGLAPSSQVTINGLPVGRVMSI 66

Query: 72  -FLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKEKKTIFQIATE 130
            F D       + K ++  D     ++ A +   GL G          K    I      
Sbjct: 67  DFADSS--GKLVVKFVVEKDFEFSNNSLARVYGGGLIG---------GKSLAIIPSYEKG 115

Query: 131 RNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTIANIETISTVL 190
           RN +   T  P  +   I   E  +++++     ++K+I + +  L              
Sbjct: 116 RNAKTGDT-LPGEMGEGI--MELVNERLTPLQNQVEKVIGDTDSLLVNV----------- 161

Query: 191 ANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVNQILENIQVSS 250
            N++   D   +      + +D+      I+  +  L     A +  K+++ + N+   S
Sbjct: 162 -NSVLDRDTRANLRDAIANFTDASREMKGISKSVNGL----LASNQDKLDRTITNLDKMS 216

Query: 251 NNFVKSSD-----QVINTVHDVRETTQTFQEVGQKID 282
            NF   SD     Q+   V D+ +T   FQE+  K++
Sbjct: 217 GNFATLSDSLSKIQMGQMVADLEKTIADFQELSNKLN 253


>gi|307610675|emb|CBX00263.1| hypothetical protein LPW_20081 [Legionella pneumophila 130b]
          Length = 416

 Score = 37.4 bits (85), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 42/187 (22%), Positives = 79/187 (42%), Gaps = 15/187 (8%)

Query: 186 ISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVNQILEN 245
           ++ + A     + ++  T     H+S+S N F  I      L+   K +  + ++     
Sbjct: 98  LAPIFAEREQWMKRIAGTDGKNAHASESYNKFKKIF-----LNSHHKFVIEESLSHFEHG 152

Query: 246 IQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAFLENIA 305
                + ++ +  Q+   V  +R   + ++E   KID        + K+     FL+N  
Sbjct: 153 TLKYHHEWLTAKRQIAKEVKSLRALQENWKEKKNKID--------RKKAAALLDFLDNFE 204

Query: 306 DSTSNMRSSISAIREITDQRQKIIST--INTIENITSNLNDSSQKFAELMSKINNISALK 363
              + +RS      + T+  +K +ST  +  IE +  +L D S    EL  ++  I AL 
Sbjct: 205 SIPNRLRSREEEGFKRTEVYKKALSTDKLKAIELLNQHLFDYSSPQEELAERMKLIKALY 264

Query: 364 ENNSLFK 370
           ENN LF+
Sbjct: 265 ENNILFE 271


>gi|225848327|ref|YP_002728490.1| mce related protein [Sulfurihydrogenibium azorense Az-Fu1]
 gi|225644731|gb|ACN99781.1| mce related protein [Sulfurihydrogenibium azorense Az-Fu1]
          Length = 516

 Score = 37.4 bits (85), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 64/305 (20%), Positives = 114/305 (37%), Gaps = 45/305 (14%)

Query: 10  VGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRFNGIPVGRIV 69
           VG+FV+ I     F I   S   ++     E  +       GLS  + V+  G+  G++ 
Sbjct: 7   VGIFVLVISGLLGFLIIKFS-GKEFGQNYKEYFVYFT-DAQGLSQGADVQVQGVKSGKVE 64

Query: 70  GLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKEKKTIFQIAT 129
            +  +Q        K  +R + P+Y      IRT GL G  Y+ +         +     
Sbjct: 65  EIKFEQ---GKVKVKFKVRQEIPIYKDAKVVIRTYGLMGDKYLYVEPGNPSSGELVSGGV 121

Query: 130 ERN------QRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEK--------- 174
             N         MI         F    +N +K + D    ++K+IE+ +K         
Sbjct: 122 IENTTKIASTEEMIDQVRLSAKKFGELMDNLNKALGDE--RLKKLIEDFDKFAYNTNEVV 179

Query: 175 -----PLTTTIANIETISTVLANNISHI----DKMMHTTQ--VTPHSSDSKNTFNTITDL 223
                 +   IANI  I+  L   +  I    DK +  T+     +  D +     + DL
Sbjct: 180 VQNKEDVRQAIANIRAITAELRQKLPSITENLDKTLENTKNITDENREDIRKLIANLKDL 239

Query: 224 -----------ITSLDKMIKAIDLQKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQ 272
                      + S+DK    I+ + V++  +++++S  N  K+SD +   +  V E   
Sbjct: 240 SVALKEKAPKTLDSVDKAATEIE-KAVSENRQDLRLSIENIKKASDNLNQILAKVNEGKG 298

Query: 273 TFQEV 277
           T  ++
Sbjct: 299 TLGKL 303


>gi|298674443|ref|YP_003726193.1| flagella protein [Methanohalobium evestigatum Z-7303]
 gi|298287431|gb|ADI73397.1| flagella protein [Methanohalobium evestigatum Z-7303]
          Length = 1048

 Score = 37.4 bits (85), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 55/269 (20%), Positives = 122/269 (45%), Gaps = 55/269 (20%)

Query: 125 FQIATERNQ-RAMITATPSGINYFISNAENTSKKISDSSRHIQKIIEN-IEKPL------ 176
           F+  TE  Q +   T  P+G+N F       +KK++D  + ++ +++  I+K        
Sbjct: 637 FEPTTENVQMQGHYTGQPAGLN-FEQVDRLVNKKLNDHQKQVKDVVDKKIDKVFNKEYMD 695

Query: 177 -------TTTIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDK 229
                  T    N++ + + +  +++ ++K+    Q              ++D +  LD 
Sbjct: 696 YIASRVATNQTGNLQELQSKVNGSVTRVEKVTDDLQ-------------NLSDTVDELDD 742

Query: 230 MIKAIDLQKVNQILENIQVSSNNFVKSSDQVINTVHDVR----------ETTQTFQEVGQ 279
            IK I  Q+ N+  E+     N++  +SD++ N  + ++          E+      +G 
Sbjct: 743 RIKEI--QRRNEDFES--KIDNSYYSTSDRIDNLEYQLKNLQDSLGISNESDSKLNSIGT 798

Query: 280 KIDHLLSDF-SSKMKSKETSAFLENIADSTSNMRSS----ISAIREITDQRQ-------K 327
           ++D L S   S++  ++E  + L NI  S S+M  S    +S + E+ +  +        
Sbjct: 799 RVDELESALDSTQSDNQEIKSELSNIQQSISDMYDSYKDLLSHLNEVNEDYESKFSDLYD 858

Query: 328 IISTINTIENITSNLNDSSQKFAELMSKI 356
            +S I+T+E+  S ++ ++++  E++SK+
Sbjct: 859 KLSKIDTVESKLSQIDKNTKERDEILSKV 887


>gi|294341147|emb|CAZ89548.1| putative Protein pilJ [Thiomonas sp. 3As]
          Length = 736

 Score = 37.4 bits (85), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 56/242 (23%), Positives = 105/242 (43%), Gaps = 32/242 (13%)

Query: 203 TTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVNQILENIQVSSNNFVKSSDQVIN 262
           T  +T   +DS N   T+ +L T + ++ +  D  +V +     Q +S+  ++S+D+ +N
Sbjct: 435 TEDITGAIADSVNY--TVEELRTLVGQVQQTAD--QVGEGASQAQTTSDRLMRSADEQLN 490

Query: 263 TVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNMRSSISAIREIT 322
               +RET Q+  ++ Q+I+ +     ++  ++  +  L+        +R+SI  +  I 
Sbjct: 491 ---KIRETGQSVLDMAQRINQV--SVQAQQSAEVANQSLQAAEQGQRAVRNSIDGMNSIR 545

Query: 323 DQRQKIISTINTIENITSNLNDSSQKFAELMSKINNIS----ALKENNSL-FKDAQRAMH 377
           DQ Q     I         L +SSQ+  E+   I++I+     L  N ++    A  A  
Sbjct: 546 DQIQDTSKRIK-------RLGESSQEIGEITELISDITEQTNVLALNAAIQAASAGEAGR 598

Query: 378 TFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFERNPQDIV 437
            F   +E++ R        L   S      I  LVR +Q       D +   E++ Q +V
Sbjct: 599 GFSVVAEEVQR--------LAERSAESAKQIAALVRTIQ---TDTQDAVAAMEKSTQGVV 647

Query: 438 WG 439
            G
Sbjct: 648 EG 649


>gi|1717976|sp|P52453|PORTL_HHV6U RecName: Full=Portal protein U76
 gi|662099|gb|AAA68467.1| virion protein [Human herpesvirus 6]
 gi|854055|emb|CAA58368.1| U76 [Human herpesvirus 6]
          Length = 662

 Score = 37.4 bits (85), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 39/131 (29%), Positives = 68/131 (51%), Gaps = 19/131 (14%)

Query: 300 FLENIADSTS--NMRSSISA-IREIT----DQRQKII--------STINTIENITSNL-N 343
           FL N++DS S   +R S+   I+EIT    DQ + ++        S I+T E    +L  
Sbjct: 351 FLLNLSDSKSKIGIRDSVEGFIQEITPSIIDQNKLMLNRGQFRKRSAIDTGERDVRDLFK 410

Query: 344 DSSQKFAE--LMSKINNISALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFS 401
               K  E  + ++++ I  LK  N +F+   + +H+  +T+   +RY P++ ++L+N S
Sbjct: 411 KQIIKCMEEQIQTQMDEIETLKTTNQMFERKIKDLHSLLETNNDCDRYNPNLDHDLENLS 470

Query: 402 QS-GLNDIQNL 411
            S  LN +Q L
Sbjct: 471 LSRALNIVQRL 481


>gi|281356268|ref|ZP_06242761.1| Mammalian cell entry related domain protein [Victivallis vadensis
           ATCC BAA-548]
 gi|281317637|gb|EFB01658.1| Mammalian cell entry related domain protein [Victivallis vadensis
           ATCC BAA-548]
          Length = 339

 Score = 37.0 bits (84), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 47/252 (18%), Positives = 110/252 (43%), Gaps = 59/252 (23%)

Query: 48  SVDGLSTDSSVRFNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTAT------- 100
           SV+GL+  S V++ G+P+G+I  + + +           +     ++P+   T       
Sbjct: 46  SVEGLAVGSPVKYLGMPIGKITRMAMREN-------DGCVAVYFDIFPAAVETEDSDDDT 98

Query: 101 ------------------IRTQGLAGITYIELSTLRKEKKTIFQIATERNQRAM--ITAT 140
                             I   G+ G TY+ELS              E +Q A+  +   
Sbjct: 99  GTVADIANIMHRKNLMCFINAAGIMGGTYLELSI------------NESSQPALPHLEFK 146

Query: 141 PS-GINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTIANIETISTVLANNISHIDK 199
           P  G++Y  S   +    I ++ ++I ++++ +EK       N   ++  L   + +++ 
Sbjct: 147 PQPGVSYIPSRPSH----IGNAIQNISRMLDELEK------VNFIQLADKLNQTLDNMND 196

Query: 200 MMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVNQILENIQVSSNNFVK--SS 257
           +++ +++        N  +T+ + +  L  ++   +++K+N+ ++NI +S  N  +  SS
Sbjct: 197 ILNQSELRSTLKSVNNICSTLENTVQRLQTVLSDANVEKLNRSIDNIDISVQNLKRTVSS 256

Query: 258 DQVINTVHDVRE 269
           D++  TV ++ +
Sbjct: 257 DELSATVKNLNQ 268


>gi|312141003|ref|YP_004008339.1| mce family protein mce4f [Rhodococcus equi 103S]
 gi|311890342|emb|CBH49660.1| putative Mce family protein Mce4F [Rhodococcus equi 103S]
          Length = 417

 Score = 37.0 bits (84), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 43/175 (24%), Positives = 76/175 (43%), Gaps = 15/175 (8%)

Query: 51  GLSTDSSVRFNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYP-STTATIRTQGLAGI 109
           G+ T++ V + G+PVGR+  L L Q+  + +L   +I    P  P S  A +  +   G 
Sbjct: 52  GIFTNAEVTYRGVPVGRVGDLTLTQDGVSVAL---MIDDSAPQIPASAKAVVANRSAIGE 108

Query: 110 TYIELSTLRKEKK--TIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQK 167
            Y++L     E    T   +  E+N     TATP  +   I + +  ++ +   S H   
Sbjct: 109 QYVDLQPDTDEGPFLTDGSVILEKN-----TATPIPVEDLIGSVDRLARSVPTDSLHT-T 162

Query: 168 IIENIEKPLTTTIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITD 222
           ++E + K LT    +++ +   L       D+ +  T      SD +  F+T  D
Sbjct: 163 VVE-LGKALTGKGGDLQVLVDSLGRFTETADEALPETLAL--ISDGRTVFDTQAD 214


>gi|149032962|gb|EDL87803.1| similar to Laminin alpha-4 chain precursor (predicted), isoform
           CRA_d [Rattus norvegicus]
          Length = 1817

 Score = 37.0 bits (84), Expect = 5.9,   Method: Composition-based stats.
 Identities = 23/108 (21%), Positives = 60/108 (55%), Gaps = 9/108 (8%)

Query: 264 VHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNMRSSISAIREITD 323
           + +  +TT   Q+V   + + LS++S  +++ ++SA+        + + S+  A+R +T+
Sbjct: 731 IEEANKTTMAVQQVTTPMANNLSNWSQNLQTFDSSAY-------NTAVNSARDAVRNLTE 783

Query: 324 QRQKIISTINTIENI--TSNLNDSSQKFAELMSKINNISALKENNSLF 369
              +++  + T+E     SN++ S Q+  EL+++  ++++  + + LF
Sbjct: 784 VVPRLLGQLRTVEQKRPASNVSASIQRVRELIAQTRSVASKIQVSMLF 831


>gi|328947061|ref|YP_004364398.1| methyl-accepting chemotaxis sensory transducer [Treponema
           succinifaciens DSM 2489]
 gi|328447385|gb|AEB13101.1| methyl-accepting chemotaxis sensory transducer [Treponema
           succinifaciens DSM 2489]
          Length = 687

 Score = 37.0 bits (84), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 50/211 (23%), Positives = 89/211 (42%), Gaps = 47/211 (22%)

Query: 124 IFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTIANI 183
           I QIA++ N  AM  A  +      ++A    K  S  +  I+K+ EN      +    +
Sbjct: 496 ISQIASQTNLLAMNAAIEA------AHAGEAGKGFSVVADEIRKLAENSAAQSNSIKKEL 549

Query: 184 ETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVNQIL 243
           ETI  V+A       K++ T+++      S   F  IT+ ++S + +++ +D    +Q  
Sbjct: 550 ETIGQVIA-------KVVETSEI------SVKEFEKITEKVSSTESLVQNVDSTMSHQ-- 594

Query: 244 ENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAFLEN 303
                      +SS QV+  + DV +TT T  +                 +KE SA +EN
Sbjct: 595 ----------HESSKQVLANLQDVDDTTSTVLKT----------------AKEISAAIEN 628

Query: 304 IADSTSNMRSSISAIREITDQRQKIISTINT 334
           +A +  N+      +    D+  + +  INT
Sbjct: 629 VATAAGNLDMLAQQVEGSMDEMSEGVKEINT 659


>gi|54294851|ref|YP_127266.1| hypothetical protein lpl1930 [Legionella pneumophila str. Lens]
 gi|53754683|emb|CAH16170.1| hypothetical protein lpl1930 [Legionella pneumophila str. Lens]
          Length = 416

 Score = 37.0 bits (84), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 42/187 (22%), Positives = 79/187 (42%), Gaps = 15/187 (8%)

Query: 186 ISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVNQILEN 245
           ++ + A     + ++  T     H+S+S N F  I      L+   K +  + ++     
Sbjct: 98  LAPIFAEREQWMKRIAGTDGKNAHASESYNKFKKIF-----LNSHHKFVIEESLSHFEHG 152

Query: 246 IQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAFLENIA 305
                + ++ +  Q+   V  +R   + ++E   KID        + K+     FL+N  
Sbjct: 153 TLKYHHEWLTAKRQIAKEVKSLRALQENWKEKKNKID--------RKKAAALLDFLDNFE 204

Query: 306 DSTSNMRSSISAIREITDQRQKIIST--INTIENITSNLNDSSQKFAELMSKINNISALK 363
              + +RS      + T+  +K +ST  +  IE +  +L D S    EL  ++  I AL 
Sbjct: 205 SIPNRLRSREEEGFKRTEVYKKALSTDKLKAIELLNQHLFDYSSPQEELTERMKLIKALY 264

Query: 364 ENNSLFK 370
           ENN LF+
Sbjct: 265 ENNILFE 271


>gi|2769714|gb|AAC40326.1| H76 [Human herpesvirus 6]
 gi|4996064|dbj|BAA78297.1| U76 [Human herpesvirus 6B]
          Length = 662

 Score = 37.0 bits (84), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 39/131 (29%), Positives = 67/131 (51%), Gaps = 19/131 (14%)

Query: 300 FLENIADSTS--NMRSSISA-IREIT----DQRQKII--------STINTIENITSNL-N 343
           FL N++DS S   +R S+   I+EIT    DQ + ++        S I+T E    +L  
Sbjct: 351 FLLNLSDSKSKIGIRDSVEGFIQEITPSIIDQNKLMLNRGQFRKRSAIDTGERDVRDLFK 410

Query: 344 DSSQKFAE--LMSKINNISALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFS 401
               K  E  + ++++ I  LK  N +F+   + +H+  +T+   +RY P + ++L+N S
Sbjct: 411 KQIIKCMEEQIQTQMDEIETLKTTNQMFERKIKDLHSLLETNNDCDRYNPDLDHDLENLS 470

Query: 402 QS-GLNDIQNL 411
            S  LN +Q L
Sbjct: 471 LSRALNIVQRL 481


>gi|319903132|ref|YP_004162860.1| Mammalian cell entry related domain protein [Bacteroides helcogenes
           P 36-108]
 gi|319418163|gb|ADV45274.1| Mammalian cell entry related domain protein [Bacteroides helcogenes
           P 36-108]
          Length = 297

 Score = 37.0 bits (84), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 50/248 (20%), Positives = 105/248 (42%), Gaps = 26/248 (10%)

Query: 10  VGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRFNGIPVGRIV 69
           +G+  ++ L    + I +L   N +  P +   ++   +++GL+  S V  +G  VG + 
Sbjct: 10  IGIAGIAALCILVYGINYLKGINMFK-PSSYFYVKFQ-NINGLTKSSPVFADGFRVGIVR 67

Query: 70  GLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKEKKTIFQIAT 129
            L+ D   P   +A+  + PD  +   +TA +  + L G+            K    +A 
Sbjct: 68  DLYYDYTQPGKVVAEIDVNPDLRIPKGSTAELTAEMLGGV------------KMNLLLAN 115

Query: 130 ERNQRAMITATPSGI--NYFISNAENTSKKISDSSRHIQKIIENIEKPLT-----TTIAN 182
              ++  I  T  GI  N  +    N   ++      +  I+ ++   L+      T+ N
Sbjct: 116 NPREKYQIGDTIPGILNNGMMEKVANMMPQVERMLPKLDSILASLNTVLSDPSIPATLRN 175

Query: 183 IETISTVLANNISHIDKMMH--TTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
           ++ ++  +A +   +  +M     Q+T   +   + F  I+    +L K+  A  +QKV+
Sbjct: 176 VQNMTADMAVSTRQLQTLMKNDIPQLTGKLNAIGDNFVLISG---NLKKINYAAAMQKVD 232

Query: 241 QILENIQV 248
             L NI++
Sbjct: 233 STLANIKI 240


>gi|301161790|emb|CBW21330.1| conserved hypothetical protein [Bacteroides fragilis 638R]
          Length = 616

 Score = 37.0 bits (84), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 36/138 (26%), Positives = 66/138 (47%), Gaps = 12/138 (8%)

Query: 300 FLENIADSTSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNI 359
           F E    +TS+ RS     +E  ++++ II+ +  I+  T++ +++S++  ELM + N I
Sbjct: 438 FFEQKGKATSSQRS---VEQENLEKKKAIIARLTAIDE-TTDADEASKEVRELMKEWNGI 493

Query: 360 S--ALKENNSLFKDAQRAMHTFRD------TSEKINRYIPSIGNNLQNFSQSGLNDIQNL 411
                KE + L+K     +    D      +++K++ +  SIGN     SQS   + + L
Sbjct: 494 GHVPFKEKDRLYKQYHGLIDQLFDRFNISASNKKLSNFKSSIGNIQSGGSQSLYREREKL 553

Query: 412 VRKLQETVNHFDDCLNNF 429
           VR  +   N      NN 
Sbjct: 554 VRTYENMKNELQTYENNL 571


>gi|265765404|ref|ZP_06093679.1| conserved hypothetical protein [Bacteroides sp. 2_1_16]
 gi|263254788|gb|EEZ26222.1| conserved hypothetical protein [Bacteroides sp. 2_1_16]
          Length = 616

 Score = 37.0 bits (84), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 36/138 (26%), Positives = 66/138 (47%), Gaps = 12/138 (8%)

Query: 300 FLENIADSTSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNI 359
           F E    +TS+ RS     +E  ++++ II+ +  I+  T++ +++S++  ELM + N I
Sbjct: 438 FFEQKGKATSSQRS---VEQENLEKKKAIIARLTAIDE-TTDADEASKEVRELMKEWNGI 493

Query: 360 S--ALKENNSLFKDAQRAMHTFRD------TSEKINRYIPSIGNNLQNFSQSGLNDIQNL 411
                KE + L+K     +    D      +++K++ +  SIGN     SQS   + + L
Sbjct: 494 GHVPFKEKDRLYKQYHGLIDQLFDRFNISASNKKLSNFKSSIGNIQSGGSQSLYREREKL 553

Query: 412 VRKLQETVNHFDDCLNNF 429
           VR  +   N      NN 
Sbjct: 554 VRTYENMKNELQTYENNL 571


>gi|9633145|ref|NP_050255.1| putative viron protein [Human herpesvirus 6]
 gi|1717977|sp|P52454|PORTL_HHV6Z RecName: Full=Portal protein U76
 gi|405179|gb|AAB06359.1| U76 [Human herpesvirus 6B]
          Length = 662

 Score = 37.0 bits (84), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 39/131 (29%), Positives = 67/131 (51%), Gaps = 19/131 (14%)

Query: 300 FLENIADSTS--NMRSSISA-IREIT----DQRQKII--------STINTIENITSNL-N 343
           FL N++DS S   +R S+   I+EIT    DQ + ++        S I+T E    +L  
Sbjct: 351 FLLNLSDSKSKIGIRDSVEGFIQEITPSIIDQNKLMLNRGQFRKRSAIDTGERDVRDLFK 410

Query: 344 DSSQKFAE--LMSKINNISALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFS 401
               K  E  + ++++ I  LK  N +F+   + +H+  +T+   +RY P + ++L+N S
Sbjct: 411 KQIIKCMEEQIQTQMDEIETLKTTNQMFERKIKDLHSLLETNNDCDRYNPDLDHDLENLS 470

Query: 402 QS-GLNDIQNL 411
            S  LN +Q L
Sbjct: 471 LSRALNIVQRL 481


>gi|309389577|gb|ADO77457.1| methyl-accepting chemotaxis sensory transducer [Halanaerobium
           praevalens DSM 2228]
          Length = 604

 Score = 37.0 bits (84), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 33/144 (22%), Positives = 70/144 (48%), Gaps = 10/144 (6%)

Query: 264 VHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNMRSSISAIREITD 323
             +VRE  +  Q   + I   L +F+  +++  +S     I++  SN+  S  A+  +T+
Sbjct: 459 AEEVRELAEESQTAVETIRKNLGEFTEHVETLSSS-----ISEQYSNLEQSNEALANVTE 513

Query: 324 QRQKIISTI----NTIENITSNLNDSSQKFAELMSKINNISALKENNSLFKDAQRA-MHT 378
                 S I    N +  I  +LN  ++K  +++   NN++A+ E NS   +   A ++ 
Sbjct: 514 SSNNATSDIEAASNQVVEIVDSLNSETKKIRKVIENFNNLAAIAEENSASSEEMSANVNN 573

Query: 379 FRDTSEKINRYIPSIGNNLQNFSQ 402
           + +  +++  YI  + +  +NFS+
Sbjct: 574 YSEKIKEMTGYIEQMEDLTENFSK 597


>gi|330798605|ref|XP_003287342.1| hypothetical protein DICPUDRAFT_14945 [Dictyostelium purpureum]
 gi|325082674|gb|EGC36149.1| hypothetical protein DICPUDRAFT_14945 [Dictyostelium purpureum]
          Length = 1187

 Score = 37.0 bits (84), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 68/321 (21%), Positives = 139/321 (43%), Gaps = 41/321 (12%)

Query: 136 MITATPSGINYFISNAENTSKKISDSSRHIQKIIENI---EKPLTTTIANIETISTVLAN 192
           +I    + I     N  +   K+ +  + IQ I +NI   +K ++  + +I+++  +L  
Sbjct: 167 LIQEYLARIEELDRNVGDRDSKLHEKDKVIQDIEKNIIEKDKLISEQVESIKSVQQLLLE 226

Query: 193 NISHI-DKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVNQI------LEN 245
             + + +K     ++     +++ T      L+ S D+ IK ++ QK+ Q       LE+
Sbjct: 227 KEAQLLEKDKEIKELDQKLKENQETIKETQQLLESKDQHIKELN-QKIQQFEITIRDLES 285

Query: 246 IQVSSNNFVKSSDQVINTVHD-VRETTQTFQE----------VGQKIDHLLSDFSSKMKS 294
              + +  +K  D +I      ++E  Q  +E          V Q+ D LLS+   + K 
Sbjct: 286 NSSAKDELLKEKDGLIKEKEQLIKERDQLIKEWESKVNEKDQVIQEKDKLLSEKEEQFKL 345

Query: 295 KETSAFLENIADSTSNMRSSISAIREITDQRQKIISTINTIEN-ITSNLNDSSQKFAELM 353
           +  + F  NI    + ++     I+   ++ +++  +I+ I++ +T N N+   K  +LM
Sbjct: 346 R-INEFEHNIDSFETMLKEKQDTIKMQDEKIKELQESISQIKSELTGNENELKNKINDLM 404

Query: 354 SKINNISA--------LKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGL 405
           SK N + +        +KE + L  + ++   T +   EK+        +N  N  +  L
Sbjct: 405 SKFNEMESISNERLETIKEKDQLLLEKEKQYQTLQLELEKL--------SNSTNQEKDQL 456

Query: 406 -NDIQNLVRKLQETVNHFDDC 425
            + +Q L  KL    N  D C
Sbjct: 457 SSQLQQLESKLTAITNDHDQC 477


>gi|325282254|ref|YP_004254796.1| Mammalian cell entry related domain-containing protein [Odoribacter
           splanchnicus DSM 20712]
 gi|324314063|gb|ADY34616.1| Mammalian cell entry related domain protein [Odoribacter
           splanchnicus DSM 20712]
          Length = 393

 Score = 37.0 bits (84), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 56/266 (21%), Positives = 110/266 (41%), Gaps = 35/266 (13%)

Query: 49  VDGLSTDSSVRFNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAG 108
           VDGL   SSV + G  VG++  +    E  +  L +  +     +  +T A IR+  L G
Sbjct: 46  VDGLKVSSSVIYRGYSVGQVSAIQFTGERYDKVLVQFTVGKKLQISSNTIAAIRSADLMG 105

Query: 109 ITYIEL------------STLRKEKKTIFQIATERNQR----------AMITATPSGINY 146
              I L             TLR E +    I  + N++           M++     +  
Sbjct: 106 SKAINLIPGDATTYAQSGDTLRTELE--LGIMEQLNKQLEPLKKKAETVMVSLDTVLVAL 163

Query: 147 FISNAENTSKKISDSSRHIQKIIENIEKPLTTTIANIETISTVLANNISHIDKMM-HTTQ 205
               +E+ +  I  S + + + ++N+E           T++ +LAN  S I K++ +   
Sbjct: 164 QEIFSEDANGNIRGSLKSVSRTLDNVEHASG-------TLNDLLANESSRISKILENINS 216

Query: 206 VTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVNQILENIQVSSNNFVKSSDQVINTVH 265
           +T +  +S        D IT +   +KA++L    + L ++   +++ V   ++   T+ 
Sbjct: 217 ITGNLENSNANITRSLDNITGISDSLKAVNLANTVRYLNSVLAQTDSIVMKINRGKGTLG 276

Query: 266 DV---RETTQTFQEVGQKIDHLLSDF 288
            V   R+       V + ++ LL++F
Sbjct: 277 GVVNDRDLYYNLTAVSENLNKLLTEF 302


>gi|319789820|ref|YP_004151453.1| methyl-accepting chemotaxis sensory transducer [Thermovibrio
           ammonificans HB-1]
 gi|317114322|gb|ADU96812.1| methyl-accepting chemotaxis sensory transducer [Thermovibrio
           ammonificans HB-1]
          Length = 628

 Score = 37.0 bits (84), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 57/301 (18%), Positives = 135/301 (44%), Gaps = 38/301 (12%)

Query: 134 RAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTIANIETISTVLANN 193
           R  I      I Y+++  ++ +     + + I+K +EN  +     + N++     L NN
Sbjct: 177 RHAIANRDGSIRYYMATWKDAT-----AEKQIEKQLENSRRMF---LQNLKATKQSLINN 228

Query: 194 ISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAID--LQKVNQILEN------ 245
           ++ I        ++    + K T N   + I + +++ K ++  ++  N++LEN      
Sbjct: 229 LATI------VAISVAIRELKETLNLSKEQIEATEEIEKTVNKLVEVSNKLLENYKFVLK 282

Query: 246 -IQVSSNNFVKSSDQ---VINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAFL 301
            ++ +    ++S DQ   + N   ++ E  ++ Q   ++ID ++   +S   +++T+   
Sbjct: 283 ELENAERKTIESIDQMKYIRNITKEMEEVVKSLQAQTEQIDRVVEVITSI--TEQTNLLA 340

Query: 302 ENIADSTSNMRSSISAIREITDQRQKIISTINT----IENITSNLNDSSQKFAELMSKIN 357
            N A   +    +      + D+ +K+    N     I  +  N+ +   + AE+ ++  
Sbjct: 341 LNAAIEAARAGEAGRGFAVVADEVRKLAERTNKSAIEIREVVKNMREQMGRTAEITNR-- 398

Query: 358 NISALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQE 417
           ++SA++E  ++FKD Q+   + ++ SE + + I    NNL +        I  +V  + E
Sbjct: 399 SVSAVEEGMNIFKDNQQTYSSLKNASEDVLKVI----NNLSDVVSVQKEKIDEIVENIHE 454

Query: 418 T 418
           +
Sbjct: 455 S 455


>gi|60680263|ref|YP_210407.1| hypothetical protein BF0704 [Bacteroides fragilis NCTC 9343]
 gi|60491697|emb|CAH06450.1| conserved hypothetical protein [Bacteroides fragilis NCTC 9343]
          Length = 616

 Score = 37.0 bits (84), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 36/138 (26%), Positives = 66/138 (47%), Gaps = 12/138 (8%)

Query: 300 FLENIADSTSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNI 359
           F E    +TS+ RS     +E  ++++ II+ +  I+  T++ +++S++  ELM + N I
Sbjct: 438 FFEQKGKATSSQRS---VEQENLEKKKAIIARLTAIDE-TTDADEASKEVRELMKEWNGI 493

Query: 360 S--ALKENNSLFKDAQRAMHTFRD------TSEKINRYIPSIGNNLQNFSQSGLNDIQNL 411
                KE + L+K     +    D      +++K++ +  SIGN     SQS   + + L
Sbjct: 494 GHVPFKEKDRLYKQYHGLIDQLFDRFNISASNKKLSNFKSSIGNIQSGGSQSLYREREKL 553

Query: 412 VRKLQETVNHFDDCLNNF 429
           VR  +   N      NN 
Sbjct: 554 VRTYENMKNELQTYENNL 571


>gi|253563892|ref|ZP_04841349.1| conserved hypothetical protein [Bacteroides sp. 3_2_5]
 gi|251947668|gb|EES87950.1| conserved hypothetical protein [Bacteroides sp. 3_2_5]
          Length = 616

 Score = 37.0 bits (84), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 36/138 (26%), Positives = 66/138 (47%), Gaps = 12/138 (8%)

Query: 300 FLENIADSTSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNI 359
           F E    +TS+ RS     +E  ++++ II+ +  I+  T++ +++S++  ELM + N I
Sbjct: 438 FFEQKGKATSSQRS---VEQENLEKKKAIIARLTAIDE-TTDADEASKEVRELMKEWNGI 493

Query: 360 S--ALKENNSLFKDAQRAMHTFRD------TSEKINRYIPSIGNNLQNFSQSGLNDIQNL 411
                KE + L+K     +    D      +++K++ +  SIGN     SQS   + + L
Sbjct: 494 GHVPFKEKDRLYKQYHGLIDQLFDRFNISASNKKLSNFKSSIGNIQSGGSQSLYREREKL 553

Query: 412 VRKLQETVNHFDDCLNNF 429
           VR  +   N      NN 
Sbjct: 554 VRTYENMKNELQTYENNL 571


>gi|53712069|ref|YP_098061.1| hypothetical protein BF0776 [Bacteroides fragilis YCH46]
 gi|52214934|dbj|BAD47527.1| conserved hypothetical protein [Bacteroides fragilis YCH46]
          Length = 616

 Score = 37.0 bits (84), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 36/138 (26%), Positives = 66/138 (47%), Gaps = 12/138 (8%)

Query: 300 FLENIADSTSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNI 359
           F E    +TS+ RS     +E  ++++ II+ +  I+  T++ +++S++  ELM + N I
Sbjct: 438 FFEQKGKATSSQRS---VEQENLEKKKAIIARLTAIDE-TTDADEASKEVRELMKEWNGI 493

Query: 360 S--ALKENNSLFKDAQRAMHTFRD------TSEKINRYIPSIGNNLQNFSQSGLNDIQNL 411
                KE + L+K     +    D      +++K++ +  SIGN     SQS   + + L
Sbjct: 494 GHVPFKEKDRLYKQYHGLIDQLFDRFNISASNKKLSNFKSSIGNIQSGGSQSLYREREKL 553

Query: 412 VRKLQETVNHFDDCLNNF 429
           VR  +   N      NN 
Sbjct: 554 VRTYENMKNELQTYENNL 571


>gi|215433475|gb|ACJ66703.1| sensor histidine kinase/response regulator [Myxococcus fulvus HW-1]
          Length = 2151

 Score = 37.0 bits (84), Expect = 6.5,   Method: Composition-based stats.
 Identities = 49/286 (17%), Positives = 119/286 (41%), Gaps = 45/286 (15%)

Query: 156 KKISDSSRHIQKIIENIEKPLTTTIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKN 215
           K ++ + + +   + ++   LT+ + NI  ++T +AN    + K + T  V     + KN
Sbjct: 380 KGVAGTWKDLTDNVNSMASNLTSQVRNIAEVTTAVAN--GDLSKKI-TVDVRGEILELKN 436

Query: 216 TFNTITDLITSLDKMIKAIDLQKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQ 275
           T NT+ D + S           +V ++   +        K   Q +     V+    T++
Sbjct: 437 TINTMVDQLNSF--------ASEVTRVAREVGTEG----KLGGQAV-----VKGVGGTWK 479

Query: 276 EVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNMRSSISAIREITDQRQKIISTINTI 335
           ++   ++ + S+ +S+++         NIA+ T+ +     + +   D + +++   NTI
Sbjct: 480 DLTDNVNSMASNLTSQVR---------NIAEVTTAVAKGDLSKKITVDAKGEVLELKNTI 530

Query: 336 ENITSNLNDSSQKFAELMSKINNISALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGN 395
             +   LN  + +   +  ++     L        D +     ++D ++ +N    ++ +
Sbjct: 531 NTMVDQLNSFASEVTRVAREVGTDGKLGGQ----ADVKGVAGVWKDLTDNVNSMASNLTS 586

Query: 396 NLQN------------FSQSGLNDIQNLVRKLQETVNHFDDCLNNF 429
            ++N             S+    D+Q  + +L+ T+N   D L++F
Sbjct: 587 QVRNIAEVTTAVANGDLSKKITVDVQGEILELKNTINTMVDQLSSF 632



 Score = 37.0 bits (84), Expect = 7.4,   Method: Composition-based stats.
 Identities = 51/273 (18%), Positives = 114/273 (41%), Gaps = 45/273 (16%)

Query: 169  IENIEKPLTTTIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLD 228
            + ++   LT+ + NI  ++  +A     + K + T  V     + KNT NT+ D ++S  
Sbjct: 761  VNSMASNLTSQVRNIAEVTMAVAR--GDLSKKI-TVDVRGEILELKNTINTMVDQLSSF- 816

Query: 229  KMIKAIDLQKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDF 288
                     +V ++   +        K   Q I     VR    T++++   ++ + S+ 
Sbjct: 817  -------ASEVTRVAREVGTEG----KLGGQAI-----VRGVGGTWKDLTDNVNSMASNL 860

Query: 289  SSKMKSKETSAFLENIADSTSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQK 348
            +S+++         NIA+ T+ + +   + +   D R +I+   NTI  +   LN  + +
Sbjct: 861  TSQVR---------NIAEVTTAVANGDLSKKITVDVRGEILELKNTINTMVDQLNSFASE 911

Query: 349  FAELMSKINNISALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQN--------- 399
               +  ++     L     +    +    T++D ++ +N    ++ + ++N         
Sbjct: 912  VTRVAREVGTEGKLGGQAVV----KGVAGTWKDLTDNVNSMASNLTSQVRNIAEVTTAVA 967

Query: 400  ---FSQSGLNDIQNLVRKLQETVNHFDDCLNNF 429
                S+    D+Q  + +L+ T+N   D LN+F
Sbjct: 968  KGDLSKKITVDVQGEILELKNTINTMVDQLNSF 1000


>gi|282891608|ref|ZP_06300099.1| hypothetical protein pah_c180o102 [Parachlamydia acanthamoebae str.
           Hall's coccus]
 gi|281498576|gb|EFB40904.1| hypothetical protein pah_c180o102 [Parachlamydia acanthamoebae str.
           Hall's coccus]
          Length = 403

 Score = 37.0 bits (84), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 52/281 (18%), Positives = 113/281 (40%), Gaps = 41/281 (14%)

Query: 10  VGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRFNGIPVGRIV 69
           +G+FV+       F + +L  S   +G    V       +D +S  + V F G PVG + 
Sbjct: 10  IGIFVIVAFAIVIFMLLFLHPSVGDEGKRLRVRF---SDIDKISIGTRVNFGGKPVGEVA 66

Query: 70  GLFLDQEYPNHSLAK----------ALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRK 119
            +   QE     + +           L+     ++ +   ++RT GL G   + ++ L  
Sbjct: 67  DIRELQEAIEERIGRDGHVYIYELELLVDSAVNVFNTDEISLRTSGLLGERSVAITPLPP 126

Query: 120 EKKTIFQIATER----NQRAMITATPSGINYF----------ISNA------ENTSKKIS 159
           ++    +I  ++    N+   +  T   +             IS A      EN  + + 
Sbjct: 127 KEGQKLEIVNDQVIYANESGSVEDTIKDLKGVAIKLDLALDSISRALNAMEEENVWRNLG 186

Query: 160 DSSRHIQKIIENIEKP--LTTTIANIETISTVLANNISHIDKMMH-----TTQVTPHSSD 212
           DS +++  +   + KP  ++ T+ N+  ++     +   +D+++      T+     ++D
Sbjct: 187 DSMQNLSDMTAALNKPDTISETLNNLHDVTEKFGESWEKVDELLDNLVSTTSNTKAMTND 246

Query: 213 SKNTFNTITDLITSLDKMIKAIDLQ-KVNQILENIQVSSNN 252
            K  F +I +   SL  ++   DL  K++ +L   ++  N+
Sbjct: 247 GKEVFASIKEGKGSLGTLLMKDDLNLKISSLLSKGEILMND 287


>gi|14591598|ref|NP_143680.1| methyl-accepting chemotaxis protein [Pyrococcus horikoshii OT3]
 gi|3258290|dbj|BAA30973.1| 507aa long hypothetical methyl-accepting chemotaxis protein
           [Pyrococcus horikoshii OT3]
          Length = 507

 Score = 37.0 bits (84), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 64/298 (21%), Positives = 122/298 (40%), Gaps = 43/298 (14%)

Query: 164 HIQKIIENIEKPLTTTIANIETISTVLANNISHIDKMMHTTQVTPHS-SDSKNTFNTITD 222
            I K++E      T  +  +E I+    + +  I K   T ++T H+  D ++  N++  
Sbjct: 132 EIGKLLEGFRAISTEVLQTLEVIT----DRMEKISKGDVTEELTLHAKGDFESILNSMRK 187

Query: 223 LITSLDKMIKAIDLQKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKID 282
            I  L  ++K      V  +   ++  +++  + S ++   V+ V E  Q      Q+  
Sbjct: 188 TIVQLRNLMKT-----VRDLAVTLETRADDLARISSEITEAVNQVAEAIQQVSTEAQRQQ 242

Query: 283 HLLSDFSSKMK--SKETSAFLENIADSTSNMRSSISAIREITDQRQKIISTINTIENITS 340
             ++     M   +  T   +E + + +S +   IS  RE  ++ +K IS +  I+N   
Sbjct: 243 ENITQIMDGMNLTADVTQRTVEAMEEFSSVVNEVISIAREGKEKGEKAISQVGDIQNAMR 302

Query: 341 NLNDSSQKFAELMSK-----INNISALKENNSLFK-----DAQRAMHTFRDTSEKINRYI 390
            ++ + Q+ AE MSK     IN I+ + E  +L       +A RA               
Sbjct: 303 VISQAVQEVAE-MSKNVGEIINAIADIAEQTNLLALNAAIEAARA--------------- 346

Query: 391 PSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFERNPQDIVWGREKGSVKIY 448
             +G      +Q    +++NL  + +E      + LN  +   +  V   EKG VKI 
Sbjct: 347 GELGRGFAVVAQ----EVRNLAEESKEAAERIREILNQIQDKVEKAVEETEKG-VKIV 399


>gi|157964481|ref|YP_001499305.1| hypothetical protein RMA_0565 [Rickettsia massiliae MTU5]
 gi|157844257|gb|ABV84758.1| hypothetical protein RMA_0565 [Rickettsia massiliae MTU5]
          Length = 326

 Score = 37.0 bits (84), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 35/138 (25%), Positives = 61/138 (44%), Gaps = 23/138 (16%)

Query: 311 MRSSISAIREITDQRQKIISTINTI-------ENITSNLNDSSQKFAELMSKINNISA-L 362
           M S+  +  EI  + +KI+ST+          EN+ SNL+ S++   E   K NNI+   
Sbjct: 63  MTSTTGSHSEIVPRFKKIVSTLKEAKSNPAQYENLVSNLDASTKNALEATMKSNNITVPT 122

Query: 363 KENNSLFKDAQRAMHTFRDTSEKI-----NRYIPSIGNNLQNFSQSGLND---------- 407
           ++ N +  +    M T+ DT   I      +++    NNL+ F ++  N           
Sbjct: 123 QDTNKVMSEILSGMQTWLDTKSHIPMDLKQKFLDLGSNNLELFIKAAYNKFNNTWIVKEF 182

Query: 408 IQNLVRKLQETVNHFDDC 425
           + N V+  +E   +  DC
Sbjct: 183 LDNAVKTGEEGRKYLADC 200


>gi|145548343|ref|XP_001459852.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 gi|124427679|emb|CAK92455.1| unnamed protein product [Paramecium tetraurelia]
          Length = 2175

 Score = 37.0 bits (84), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 51/248 (20%), Positives = 103/248 (41%), Gaps = 42/248 (16%)

Query: 211  SDSKNTFNTITDLITSLDKMIKAIDLQKVNQILENIQVSSNNFVKSSDQVINTVHDVRET 270
             D   T N +  +I S D+ IK +            Q     F K  DQ+IN    + ET
Sbjct: 1017 DDQNQTINNLEAIIQSKDQTIKKL------------QEQQREFTKKGDQLINIQKKLIET 1064

Query: 271  TQTFQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNMRSSISAIREITDQRQKIIS 330
             Q  QE      H+ +D  ++ + K   +  + I+     ++     I+EI  + +K+ S
Sbjct: 1065 EQQLQE------HIENDHLNQERIK---SLEQQISSKDQELKKLKDQIKEIQKENEKLQS 1115

Query: 331  TINTIENITSNLNDSSQKFAELMSKINNI-----SALKENNSLFKDAQRA---------- 375
                +E +   L +   K  +L ++I  +        +EN  L + AQ+           
Sbjct: 1116 KQTEMEQLQQKLTEKQSKIEDLENQIEELLKEIKKKSQENQLLEEKAQQLKKLEEKYKKQ 1175

Query: 376  ---MHTFRDTSEKINRYIPSIGNNLQ--NFSQSGLN-DIQNLVRKLQETVNHFDDCLNNF 429
               +   + +++++   + S+   +Q  +  +S L  +I+ L +KL++    F++ LN  
Sbjct: 1176 SNLVEEHKQSNDQLENKVKSLEEQIQINDDEKSSLEREIEQLRKKLEDEKKQFENKLNQQ 1235

Query: 430  ERNPQDIV 437
             +   +I+
Sbjct: 1236 AKQKDEII 1243


>gi|169631640|ref|YP_001705289.1| putative Mce family protein [Mycobacterium abscessus ATCC 19977]
 gi|169243607|emb|CAM64635.1| Putative Mce family protein [Mycobacterium abscessus]
          Length = 352

 Score = 37.0 bits (84), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 43/212 (20%), Positives = 90/212 (42%), Gaps = 27/212 (12%)

Query: 4   KNYYTSVGLFVVSILFFSFFSIYWLSRS-NQYDGPMAEVIIRIPGSVDGLSTDSSVRFNG 62
           K +  ++ L V+  L  +   +  +    + Y G   +     PG+        +V + G
Sbjct: 24  KAWLGAIALAVIGALVGAMLLVKAIGLGYSHYTGEFLQAASLQPGA--------NVSYAG 75

Query: 63  IPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKEKK 122
           +PVG +  + L  +     +    +R D  L     A+I+   + G  Y+EL        
Sbjct: 76  VPVGNVTSVELAGDRIEVGMR---VRDDITLRKDARASIKITTILGNQYVELRNGGD--- 129

Query: 123 TIFQIATERNQRAMI--TATPSGINYFISNAENT-----SKKISDSSRHIQKIIENIEKP 175
                 T  N+R  +  T  P  +   + +A +T     + KI++S+  + K +E +   
Sbjct: 130 -----GTLPNRRIDLAHTEVPYDLQATLQDATSTFEQVDADKIAESTAILAKQLEGLPAV 184

Query: 176 LTTTIANIETISTVLANNISHIDKMMHTTQVT 207
           L   + NI+T+S+V+++    I  ++ +T++ 
Sbjct: 185 LPQAMENIQTLSSVISHRRDQIGTLLSSTELV 216


>gi|256847400|ref|ZP_05552846.1| phage tape measure protein [Lactobacillus coleohominis 101-4-CHN]
 gi|256716064|gb|EEU31039.1| phage tape measure protein [Lactobacillus coleohominis 101-4-CHN]
          Length = 1631

 Score = 37.0 bits (84), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 60/295 (20%), Positives = 117/295 (39%), Gaps = 60/295 (20%)

Query: 178  TTIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAI--- 234
            T IANI+ ++  +   +++   +    QV  H+  +K           SL+KM K +   
Sbjct: 916  TDIANIKEMNRAV---LTYTQTLKSLKQVVKHNDPTK-----------SLNKMNKGLKNF 961

Query: 235  --DLQKVNQILENIQVSSNNFVKSSDQVINTV------HDVRETTQTFQEVGQKIDH--L 284
              D+ K  + LE +  +   F KS+  + +++      H + E T+   ++ + + H  +
Sbjct: 962  VKDMAKSAKPLEKLAKTFKTFGKSTKTMASSIKSLTGKHGLGEFTKYLDKLNKDMKHTKV 1021

Query: 285  LSDFSSKMKSKETSAFLENI-------ADSTSNMRSSISAIREITDQRQKIISTINTIEN 337
             + F    KS + S   + +            + +     +++ T +      TI  + N
Sbjct: 1022 GTYFEKLAKSIKKSKLADEVKKLDTWFGGMVKDFKQLTKPLKQATKEFTSFEKTIGKLAN 1081

Query: 338  ITSNLN--DS------------------SQKFAELMSKINNISALKENNSLFKDAQRAMH 377
              + L+  DS                   Q+ AE    +     +KE  S+ K  + A+ 
Sbjct: 1082 KKTGLSKVDSDIKTLSKDLKKYNFGKVLGQQMAEADKAVGKHRFIKEFGSMMKVVEEALK 1141

Query: 378  TFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFERN 432
            +F   S+   RY      NL + ++SGLN      R +   ++  DD  ++FER 
Sbjct: 1142 SF---SKDFKRYWGDTWKNLSSQARSGLNKAN---RTISSKLDDIDDTGHDFERG 1190


>gi|111021671|ref|YP_704643.1| MCE family protein [Rhodococcus jostii RHA1]
 gi|110821201|gb|ABG96485.1| MCE family protein [Rhodococcus jostii RHA1]
          Length = 338

 Score = 37.0 bits (84), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 33/106 (31%), Positives = 48/106 (45%), Gaps = 17/106 (16%)

Query: 14  VVSILFFSF---FSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRFNGIPVGRIVG 70
           V+S++F      FS Y  S S+ Y     +V         GL     VR  G+PVG +  
Sbjct: 14  VMSVIFAGLALVFSQYRFSSSDGYHATFTDV--------SGLKPGDKVRIAGVPVGAVEK 65

Query: 71  LFLDQEYPNHSLAKALIRPDT--PLYPSTTATIRTQGLAGITYIEL 114
           + +D    + +LA      DT   L+  T AT+R + L G  Y+EL
Sbjct: 66  VSID----DDNLADVDFTVDTKYSLFDGTKATVRYENLVGDRYMEL 107


>gi|94264496|ref|ZP_01288283.1| Mammalian cell entry related [delta proteobacterium MLMS-1]
 gi|94266596|ref|ZP_01290278.1| Mammalian cell entry related [delta proteobacterium MLMS-1]
 gi|93452767|gb|EAT03305.1| Mammalian cell entry related [delta proteobacterium MLMS-1]
 gi|93455055|gb|EAT05282.1| Mammalian cell entry related [delta proteobacterium MLMS-1]
          Length = 148

 Score = 37.0 bits (84), Expect = 7.2,   Method: Composition-based stats.
 Identities = 31/120 (25%), Positives = 61/120 (50%), Gaps = 12/120 (10%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMA---EVIIRIP-GSVDGLSTDS 56
           M +K     VGLF+++     FFS  +LS +     P++   +  ++   G++ GL   +
Sbjct: 1   MIAKKLDLMVGLFILA----GFFSFVYLSVNLGDFSPLSAQRQYTVQAEFGNISGLRRGA 56

Query: 57  SVRFNGIPVGRIVGLFL-DQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELS 115
            V+  G+ VGR+  + L D++    +++   I  +  L     A+++TQG+ G  YI ++
Sbjct: 57  PVQIAGVVVGRVAAIELGDRQRAQVTMS---IDREVELTDDAIASVKTQGIIGEKYISIT 113


>gi|163815912|ref|ZP_02207282.1| hypothetical protein COPEUT_02092 [Coprococcus eutactus ATCC 27759]
 gi|158448722|gb|EDP25717.1| hypothetical protein COPEUT_02092 [Coprococcus eutactus ATCC 27759]
          Length = 713

 Score = 37.0 bits (84), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 40/202 (19%), Positives = 93/202 (46%), Gaps = 22/202 (10%)

Query: 250 SNNFVKSSDQVINT-VHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAFLENIADST 308
           S + +K +D  I++ + D+ +T  ++ ++   +   +   ++ +KS ETSA L  + D T
Sbjct: 235 STDAIKKADAAIDSSLSDMDQTGSSYYQLRDNLQSQIDSITNDIKSLETSAKLATLKDDT 294

Query: 309 SNMRSSISAIREITDQRQKIISTINTIEN---ITS--NLNDSSQKFAELMSKINNISALK 363
            ++ + +  I+   +   K +  I T      ++S   + +S  +  E+ S+++ +++L 
Sbjct: 295 DDISADLDNIKSDAEALNKKLDAIETFVKSLPVSSIDKVKESIDRLDEMKSQVDTLTSLT 354

Query: 364 ENNSLFKDAQRAMHTFRDTSEKIN---------------RYIPSIGNNLQNFSQSGLNDI 408
           E      D  +      D + K++               + +P + N L N  ++ L + 
Sbjct: 355 EETIDNLDFSKIASIESDLTAKLSSVSNAIDTVDNTFSQKIVPDLDNILLNIKEA-LKNA 413

Query: 409 QNLVRKLQETVNHFDDCLNNFE 430
           QNL++ L ET+       +N++
Sbjct: 414 QNLLKTLNETIVSTSTVFDNYK 435


>gi|89099305|ref|ZP_01172182.1| methyl-accepting chemotaxis protein [Bacillus sp. NRRL B-14911]
 gi|89085914|gb|EAR65038.1| methyl-accepting chemotaxis protein [Bacillus sp. NRRL B-14911]
          Length = 602

 Score = 37.0 bits (84), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 35/151 (23%), Positives = 73/151 (48%), Gaps = 15/151 (9%)

Query: 217 FNTITDLITSLDKMIKAIDLQKVNQILENIQVSSNNFVKS----SDQVINTVHDVRETTQ 272
           F  + D +  L + + +  +  + +I++ IQ  SN+ V S     +QV      +  T Q
Sbjct: 453 FAVVADEVRKLAEQV-SFSVSDITRIVKGIQAESNDVVLSLKHGYEQVEEGTGQIEHTGQ 511

Query: 273 TFQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNMRSSISAIREITDQRQKII--- 329
           TFQ + Q ++ +  + +      E S  LE I+ S++ M  SI  I  ++++    I   
Sbjct: 512 TFQNIYQSVNRMSENIN------EISRSLEQISSSSAVMNDSIENIASVSEESAAGIEQT 565

Query: 330 -STINTIENITSNLNDSSQKFAELMSKINNI 359
            ++I+   +    ++D++Q  +EL  ++N +
Sbjct: 566 SASISQTNHSMEEISDNAQSLSELADQLNEM 596


>gi|163796121|ref|ZP_02190083.1| methyl-accepting chemotaxis sensory transducer [alpha
           proteobacterium BAL199]
 gi|159178580|gb|EDP63120.1| methyl-accepting chemotaxis sensory transducer [alpha
           proteobacterium BAL199]
          Length = 470

 Score = 37.0 bits (84), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 50/236 (21%), Positives = 92/236 (38%), Gaps = 20/236 (8%)

Query: 201 MHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVNQILENIQVSSNNFVKSSDQV 260
           ++ T     + D+   F  +   + SL        L  + + L++++  +   ++   Q 
Sbjct: 146 LNATIEAARAGDAGRGFAVVAGEVKSLANQTAEATLD-IGRTLKDLEAQARELIEQGTQT 204

Query: 261 INTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKS--------KETSA-FLENIADSTSNM 311
                 VR+ TQ        I   + D +++  S         ETSA F   I   T+++
Sbjct: 205 TRLADGVRDGTQAIGTAMGTIGDAVEDIATQATSIASDATSIAETSASFRVTIETITADV 264

Query: 312 RSSISAIREITDQRQKIISTINTIENIT--SNLNDSSQKFAELMSKINNISALKENNSLF 369
             S S ++E  D+  ++I T   +      S  N     F   ++K+  I+  K  +  F
Sbjct: 265 DRSSSTLKEARDRVNRLIDTGERLAGYCAGSGANTVDGPF---ITKVQEIA--KAVSGAF 319

Query: 370 KDA-QRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDD 424
           + A QR   T  +  ++  +Y P  G N +      L      +  +QE V  FDD
Sbjct: 320 EAAVQRGEITIAELFDR--QYTPIAGTNPEQLRAGCLKVTDRALPPIQEPVLAFDD 373


>gi|83590859|ref|YP_430868.1| methyl-accepting chemotaxis sensory transducer [Moorella
           thermoacetica ATCC 39073]
 gi|83573773|gb|ABC20325.1| methyl-accepting chemotaxis sensory transducer [Moorella
           thermoacetica ATCC 39073]
          Length = 552

 Score = 37.0 bits (84), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 24/100 (24%), Positives = 52/100 (52%), Gaps = 8/100 (8%)

Query: 227 LDKMIKAI--DLQKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHL 284
           +DK ++ +  ++Q+  Q+ EN  V S    K+++ + N  H  +      +EVG+    +
Sbjct: 312 VDKNVELVQSNIQRGAQVRENFSVVSEAIKKAAEVMTNISHQAQNQLTRVKEVGEAAGRM 371

Query: 285 LSDFSSKMKSKETSAFLENIADSTSNMRSSISAIREITDQ 324
            +       ++ET+A +E +A +T   +S+++ + E T Q
Sbjct: 372 AA------VAQETAASIEEVAAATEEHKSTMAVVEEHTRQ 405


>gi|224042896|ref|XP_002192480.1| PREDICTED: GRIP and coiled-coil domain containing 2 [Taeniopygia
           guttata]
          Length = 1704

 Score = 36.6 bits (83), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 47/222 (21%), Positives = 107/222 (48%), Gaps = 37/222 (16%)

Query: 228 DKMIKAIDLQKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQ-EVGQKIDHLLS 286
           ++M    ++Q++ + LE +        +  ++ +++ + +RET +T Q E+G+    +  
Sbjct: 470 EQMALVFEMQELREQLEKL-------TQEKEEAVSSYNSLRETMETLQAELGESAGKISQ 522

Query: 287 DFSSKMKSKETSAFLENIADSTSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSS 346
           +F S MK ++ S    +++     +R++        ++R  ++ T+N ++     L+ + 
Sbjct: 523 EFES-MKQQQAS----DVSQLQQKLRAAF-------NERDVLLETVNRLQEEVEKLSSNQ 570

Query: 347 QKFAELMSKINNISALKENNSLFKDA--QRAMHTFRDTSEKI------NRYI----PSIG 394
            +  EL  KI    +L+E+NS    +  Q+ + T R+  EKI      NR I      +G
Sbjct: 571 SEIEELKCKI---VSLQEDNSTMTSSIDQKEI-TVRELEEKIVALTDQNRDILNDVKCLG 626

Query: 395 NNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFERNPQDI 436
              +   Q      QN +++LQ+ V+  + C N+ ++  +++
Sbjct: 627 EERKTL-QEMCKQEQNKIQELQQEVDVANQCNNDLKQKVEEL 667


>gi|46447388|ref|YP_008753.1| hypothetical protein pc1754 [Candidatus Protochlamydia amoebophila
           UWE25]
 gi|46401029|emb|CAF24478.1| hypothetical protein pc1754 [Candidatus Protochlamydia amoebophila
           UWE25]
          Length = 409

 Score = 36.6 bits (83), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 52/212 (24%), Positives = 91/212 (42%), Gaps = 36/212 (16%)

Query: 10  VGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRFNGIPVGRIV 69
           +G+FV+  L    F + +L  S    G  A+ +     ++D ++  S V F G PVG +V
Sbjct: 10  IGIFVLLALAIIVFLLLFLHPS---VGDNAKTLRVRFTNIDKINVGSRVTFAGKPVGEVV 66

Query: 70  GLFLDQEYPNHSLAKALIRPDTPLYPSTTA-------------TIRTQGLAGITYIELST 116
            +   +E P+  + +   + D  +Y  T               +IRT GL G   IE+  
Sbjct: 67  SI---EEIPDARIGRINHQGDVYIYQLTLKVDSSVSVYNSDEISIRTSGLLGEKNIEIDP 123

Query: 117 L-RKEKKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKP 175
              K   T+  +  +     ++ A+PSG      + E T K+    S  ++ ++E+    
Sbjct: 124 QPLKSGGTLIDVENQ-----ILYASPSG------SVEETLKQFDQISTQLKVVLEDFHD- 171

Query: 176 LTTTIANIETISTVLANNISHIDKMMHTTQVT 207
            T TI   E +   +A  I +I ++   TQV 
Sbjct: 172 -TFTILKNEKVIEGIAQTIKNIGEI---TQVV 199


>gi|328772120|gb|EGF82159.1| hypothetical protein BATDEDRAFT_86911 [Batrachochytrium
           dendrobatidis JAM81]
          Length = 138

 Score = 36.6 bits (83), Expect = 7.9,   Method: Composition-based stats.
 Identities = 36/128 (28%), Positives = 55/128 (42%), Gaps = 16/128 (12%)

Query: 298 SAFLENIADSTSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKIN 357
           S F     D    + S +  + E+   R++  S   +I +I     D  Q+F    S+  
Sbjct: 18  SKFGPEFQDVQCLLISEVRVLLEVAKDRKRKESGDGSISDIMQKTIDYCQQF----SRFT 73

Query: 358 NISALKENNSLFKDAQRAMHTFR---------DTSEKINRYIPSIGNNLQNFSQSGLNDI 408
           N   +KE  +LF D Q   H F          +T+E+    IPS+     +  Q+ LND+
Sbjct: 74  NKQTVKEIRNLFPDDQ--FHQFEMAQLANLCCETAEEAKVLIPSLSTKHDDELQNLLNDL 131

Query: 409 QNLVRKLQ 416
           Q L RK Q
Sbjct: 132 QAL-RKFQ 138


>gi|226364208|ref|YP_002781990.1| Mce family protein [Rhodococcus opacus B4]
 gi|226242697|dbj|BAH53045.1| putative Mce family protein [Rhodococcus opacus B4]
          Length = 340

 Score = 36.6 bits (83), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 33/106 (31%), Positives = 48/106 (45%), Gaps = 17/106 (16%)

Query: 14  VVSILFFSF---FSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRFNGIPVGRIVG 70
           V+S++F      FS Y  S S+ Y     +V         GL     VR  G+PVG +  
Sbjct: 16  VMSVIFAGLALVFSQYRFSSSDGYHATFTDV--------SGLKPGDKVRIAGVPVGAVEK 67

Query: 71  LFLDQEYPNHSLAKALIRPDT--PLYPSTTATIRTQGLAGITYIEL 114
           + +D    + +LA      DT   L+  T AT+R + L G  Y+EL
Sbjct: 68  VSID----DDNLADVDFTVDTKYSLFDGTKATVRYENLVGDRYMEL 109


>gi|317125890|ref|YP_004100002.1| virulence factor Mce family protein [Intrasporangium calvum DSM
           43043]
 gi|315589978|gb|ADU49275.1| virulence factor Mce family protein [Intrasporangium calvum DSM
           43043]
          Length = 351

 Score = 36.6 bits (83), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 32/64 (50%), Gaps = 3/64 (4%)

Query: 51  GLSTDSSVRFNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGIT 110
           G+  D  VR  G+ VG++ G+ L+     H     +I  D P  P+T A +R + + G  
Sbjct: 55  GIKPDDDVRIAGVKVGKVTGVDLEA---GHVRVDFVITEDAPFGPTTRAAVRMKTILGEK 111

Query: 111 YIEL 114
           Y+ L
Sbjct: 112 YLAL 115


>gi|309390153|gb|ADO78033.1| methyl-accepting chemotaxis sensory transducer with Cache sensor
           [Halanaerobium praevalens DSM 2228]
          Length = 671

 Score = 36.6 bits (83), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 56/238 (23%), Positives = 102/238 (42%), Gaps = 41/238 (17%)

Query: 223 LITSLDKM---IKAIDLQKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTF----Q 275
           LI SL+KM   + AI +  ++   E +  SS     + +QV ++  +V  + Q      +
Sbjct: 350 LIKSLNKMRDSLMAI-IADISHQAEQVAASSQQLSAAGEQVGDSAENVGRSIQNVASGAE 408

Query: 276 EVGQKIDHL-------------LSDFSSKMKSKETSAFLENIADSTSNMRSSISAIREIT 322
           E   +ID               +S  +S M+ +ET   + NI   T  ++ S+  I E+ 
Sbjct: 409 EQSAQIDETENIFENLEGYLREISQRASNMR-QETKNVMNNIQSGTEQVKQSVQGINEVK 467

Query: 323 DQRQKIISTINTIENITSNLNDSSQKFAELMSKINNIS----ALKENNSLFKDAQRAMHT 378
              +   STIN       +L + SQ+  E++  I  I+     L  N ++  +A RA  +
Sbjct: 468 VDTEAAASTIN-------DLGELSQEIGEIVELIRGIADQTNLLALNAAI--EAARAGES 518

Query: 379 FR------DTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFE 430
            R      D   ++     S  +N+ N      ++++N V K+ +  N   + +NN E
Sbjct: 519 GRGFSVVADEIRQLAEESQSATDNISNLIAKVQSNVENAVTKMNKNQNKVQESVNNIE 576


>gi|77463762|ref|YP_353266.1| ABC transporter substrate-binding protein [Rhodobacter sphaeroides
           2.4.1]
 gi|221639632|ref|YP_002525894.1| hypothetical protein RSKD131_1533 [Rhodobacter sphaeroides KD131]
 gi|77388180|gb|ABA79365.1| possible ABC transporter, substrate-binding protein [Rhodobacter
           sphaeroides 2.4.1]
 gi|221160413|gb|ACM01393.1| Mammalian cell entry related domain protein precursor [Rhodobacter
           sphaeroides KD131]
          Length = 156

 Score = 36.6 bits (83), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 26/69 (37%), Positives = 37/69 (53%), Gaps = 5/69 (7%)

Query: 48  SVDGLSTDSSVRFNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPL-YPSTTAT-IRTQG 105
           SVDG+S  + VR  G+ VG + GL L+   P    A A I     +  P+ +A  I ++G
Sbjct: 46  SVDGISVGTDVRLAGVKVGSVTGLALN---PQTYFADATISVKQGIELPTDSAILISSEG 102

Query: 106 LAGITYIEL 114
           L G  Y+EL
Sbjct: 103 LLGGNYVEL 111


>gi|55377425|ref|YP_135275.1| MCP domain-containing signal transducer [Haloarcula marismortui
           ATCC 43049]
 gi|55230150|gb|AAV45569.1| MCP domain signal transducer [Haloarcula marismortui ATCC 43049]
          Length = 850

 Score = 36.6 bits (83), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 44/221 (19%), Positives = 99/221 (44%), Gaps = 25/221 (11%)

Query: 156 KKISDSSRHIQKIIENIEKPLTTTIANIETISTVLANNI--SHIDKMMHTTQVTPHSSDS 213
           + ISD  R++   IE I       +A+    ++V   +   S    M    Q+T ++  +
Sbjct: 180 QSISDEMRNLSATIEEI-ASAANEVADTSGKASVRGESALESASSAMTTLDQLTDNAEAT 238

Query: 214 KNTFNTITDLITSLDKMIKAI-DLQKVNQILE---NIQV-----SSNNFVKSSDQVINTV 264
            +    + DL++ +++++  I D+     +L    NI+      S + F   +++V +  
Sbjct: 239 VDKVEQLNDLLSDIEEIVDFITDVADQTNMLALNANIEAARAGESGDGFAVVAEEVKSLA 298

Query: 265 HDVRETTQ----TFQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNMRSSISAIRE 320
            + +E T     + QEV ++ D  +S+      S E         D+ S++ S++  +  
Sbjct: 299 TETKEATDEIATSIQEVHEQADATVSEMHDTRDSVE---------DTRSSVASALDELDA 349

Query: 321 ITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNISA 361
           +    +++ S++  I++ T    DS+Q+   ++  +  ISA
Sbjct: 350 VVSMVEEVDSSVQEIDDATDTQADSTQEVVSMVDDVEGISA 390


>gi|269958302|ref|YP_003328089.1| putative ABC transporter [Anaplasma centrale str. Israel]
 gi|269848131|gb|ACZ48775.1| putative ABC transporter [Anaplasma centrale str. Israel]
          Length = 154

 Score = 36.6 bits (83), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 34/66 (51%), Gaps = 2/66 (3%)

Query: 49  VDGLSTDSSVRFNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAG 108
           VDGL   S VR +G+ VG +  L LDQ   N  + K  I+    L   ++AT+    L G
Sbjct: 53  VDGLKVGSEVRISGVNVGSVTALHLDQN--NIPVVKMCIQKGLSLPIDSSATVTYADLLG 110

Query: 109 ITYIEL 114
             Y+++
Sbjct: 111 KKYVDV 116


>gi|253991144|ref|YP_003042500.1| hypothetical protein PAU_03670 [Photorhabdus asymbiotica subsp.
           asymbiotica ATCC 43949]
 gi|253782594|emb|CAQ85758.1| conserved hypothetical Protein [Photorhabdus asymbiotica]
          Length = 172

 Score = 36.6 bits (83), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 37/66 (56%)

Query: 49  VDGLSTDSSVRFNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAG 108
           + GL   S V+  G+ +GR+V + LD++     +A  +++    +  +++ +IRT GL G
Sbjct: 49  IGGLKERSPVKIGGVVIGRVVTISLDEKTYTPQVALDIMKQYNRIPDTSSLSIRTSGLLG 108

Query: 109 ITYIEL 114
             YI L
Sbjct: 109 EQYIAL 114


>gi|327540667|gb|EGF27239.1| protein containing Mammalian cell entry related domain
           [Rhodopirellula baltica WH47]
          Length = 510

 Score = 36.6 bits (83), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 34/156 (21%), Positives = 69/156 (44%), Gaps = 13/156 (8%)

Query: 241 QILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDH--LLSDFSSKMKSKETS 298
           QI  N+  + +      D+V  T+ D RET +TF+EVG + +   ++++ +    + E  
Sbjct: 321 QIQRNVSDTVDRLPGVLDEVKVTLEDARETFETFREVGGQFEQVGIVAEDAVSQTANELQ 380

Query: 299 AFLENI---ADSTSNMRSSISAIREITDQR-----QKIISTINTIENITSNLNDSSQKFA 350
           + L ++   A S      +I A  E   +R     + ++ ++  ++N    L+   +   
Sbjct: 381 STLRSVRSTAKSFEGTAENIEAFTEPLGERGGELIEAVLVSLANVDNALVQLDTFGRT-- 438

Query: 351 ELMSKINNISALKENNSLFKDAQRAMHTFRDTSEKI 386
            L S    +  L E++ LF   QR +      S ++
Sbjct: 439 -LNSSDGTVRRLLEDDELFYQVQRTVQNIEAASARL 473


>gi|94987487|ref|YP_595420.1| paraquat-inducible protein B [Lawsonia intracellularis PHE/MN1-00]
 gi|94731736|emb|CAJ55099.1| Paraquat-inducible protein B [Lawsonia intracellularis PHE/MN1-00]
          Length = 319

 Score = 36.6 bits (83), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 39/192 (20%), Positives = 87/192 (45%), Gaps = 20/192 (10%)

Query: 252 NFVKSSDQVINTVHDV-RETTQTFQEVGQKIDHLLSDFSSKMKSKETSAFLE--NIADST 308
           NF+    Q ++T H V  + T     V  K+D++L + +S    K +   LE  N     
Sbjct: 140 NFITPESQ-MDTTHVVFYKGTPVIPTVPSKLDNILKELTSLPLDKISGNILEITNSLKIL 198

Query: 309 SNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNISALKENNSL 368
            N   + + I ++++   + ++ +        ++  +S+K+  ++  +N      E +  
Sbjct: 199 LNTPETPNIIPQLSNFLHQGLAAVAEFNQSLIDIRKASKKYGTMVEGLNT-----ELSLT 253

Query: 369 FKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNN 428
            K+A ++  T  +T+E++      +GNN        L DI ++++++ +         N 
Sbjct: 254 LKEATKSFQTINNTTERL------LGNN-----SPTLLDIHHMLQEVSKAAKAIRILANM 302

Query: 429 FERNPQDIVWGR 440
            ERNP+ ++ G+
Sbjct: 303 LERNPEVLIRGK 314


>gi|270264504|ref|ZP_06192770.1| hypothetical protein SOD_h01710 [Serratia odorifera 4Rx13]
 gi|270041640|gb|EFA14738.1| hypothetical protein SOD_h01710 [Serratia odorifera 4Rx13]
          Length = 546

 Score = 36.6 bits (83), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 65/299 (21%), Positives = 114/299 (38%), Gaps = 55/299 (18%)

Query: 35  DGPMAEVIIRIPGSVDGLSTDSSVRFNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLY 94
           DGP     +R   S+ GL   ++V F+ I +GR+V + LD     +     +      +Y
Sbjct: 282 DGPPMRFKLRFERSLHGLEVGAAVEFSSIKIGRVVSVDLDYSPQGYRFPSVV---GIEVY 338

Query: 95  PSTTATIRTQGLAGITYIELSTLRKEKKTIFQIAT-------ERNQRAMITATPS----G 143
           P+    +            LS L K+ + + Q          E   RA   ATPS    G
Sbjct: 339 PNRLGNV------------LSKLPKQNRGLEQETAAFTRDLVEHGLRAQ--ATPSNLLTG 384

Query: 144 INY----FISNAENTSKKISDSSRHIQKIIENIEKPLTTTIANIETISTVLANNISHIDK 199
             Y    F+ NA      I     H + ++      L T     + +   +A+ +S +DK
Sbjct: 385 QLYISLDFVPNAARVPFDI-----HARPLV------LPTINGGFDRLQEQIASIVSKVDK 433

Query: 200 MMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVNQILENI----QVSSNNFVK 255
           M       P +S ++N   T+  +  SL K +    L   NQ+L  +    Q + +   +
Sbjct: 434 M-------PLASIAQNLNATLAGVDNSL-KQVNGQTLPAANQLLRQMSQTAQTAQDLLAE 485

Query: 256 SSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNMRSS 314
            S  ++     ++E  +  + V    D L     S ++ +     L N     S+++ S
Sbjct: 486 DSPLMLTFSQSLQEALRALRAVRNLADQLDRHPESLLQGRTEDPPLLNPGSHDSSLQGS 544


>gi|296243002|ref|YP_003650489.1| chromosome segregation ATPase [Thermosphaera aggregans DSM 11486]
 gi|296095586|gb|ADG91537.1| Chromosome segregation ATPase [Thermosphaera aggregans DSM 11486]
          Length = 1057

 Score = 36.6 bits (83), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 46/181 (25%), Positives = 87/181 (48%), Gaps = 23/181 (12%)

Query: 269 ETTQTFQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNMRSSISAIREITDQRQKI 328
           E TQ   E    I+  LS+  S++ S E    +E +    + ++  I    E++ Q Q +
Sbjct: 823 EITQRLSE----IEDRLSELESQLASIENR--IEGLTQEIALLQGMID---ELSQQLQLV 873

Query: 329 ISTINT--------IENITSNLNDSSQKFAELMSKI----NNISALKEN-NSLFKDAQRA 375
            +T+N         I+ +   +++  Q+F  L S+I     N++AL+E  N L +  Q  
Sbjct: 874 NTTLNGEISLLEQRIQELEQLISELRQQFDYLNSQIALLSGNLTALQEMFNDLSQQLQLV 933

Query: 376 MHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFERNPQD 435
             T  DT E++   + +  + +Q  S S +N+++  + +L  TVN     LN+ E++  D
Sbjct: 934 NTTLADTIEELRIRLDNALSAIQELS-SRINELEENLAELNSTVNSISSDLNSLEQDVGD 992

Query: 436 I 436
           +
Sbjct: 993 L 993


>gi|194214565|ref|XP_001494653.2| PREDICTED: laminin, alpha 3 [Equus caballus]
          Length = 3277

 Score = 36.6 bits (83), Expect = 9.0,   Method: Composition-based stats.
 Identities = 37/191 (19%), Positives = 89/191 (46%), Gaps = 18/191 (9%)

Query: 242  ILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAFL 301
            I EN+   +     +S++++N      E   T +++ Q+I   L++    +K       L
Sbjct: 2150 IKENLPRKAKTLSSNSEKLLN------EAKITQKKLQQEISPALNNLQQTLKIMTVQKGL 2203

Query: 302  ENIADSTSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKIN-NIS 360
              I  + + +R  +  I     QR  I   IN+ ++I  N ND + +  + ++ I  ++ 
Sbjct: 2204 --IDTNITTIRDDLRGI-----QRGDIDGMINSAKSIVRNANDITNEVLDGLTPIQTDVE 2256

Query: 361  ALKEN--NSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQS--GLNDIQNLVRKLQ 416
             +K+   ++  +D  +A+    ++ +K+   +P + + +++ +Q    L +I + V +++
Sbjct: 2257 RIKDTYGSTQSEDFNKALGDADNSVKKLTNKLPDLLSKIESINQQLLPLGNISDNVDRIR 2316

Query: 417  ETVNHFDDCLN 427
            E +    D  N
Sbjct: 2317 ELIQQARDAAN 2327


>gi|329114931|ref|ZP_08243687.1| Hypothetical protein APO_1735 [Acetobacter pomorum DM001]
 gi|326695828|gb|EGE47513.1| Hypothetical protein APO_1735 [Acetobacter pomorum DM001]
          Length = 181

 Score = 36.6 bits (83), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 27/76 (35%), Positives = 36/76 (47%), Gaps = 7/76 (9%)

Query: 49  VDGLSTDSSVRFNGIPVGRIVGLFLDQEYPNHSLAKAL---IRPDTPLYPSTTATIRTQG 105
           +DGL   S VR  G+ VG++V   +D     HS    +   +RPD  L   T A I +  
Sbjct: 58  IDGLDIGSDVRLAGVTVGQVVSETVDP----HSFKAHVTFTVRPDIHLSDDTAAIITSDS 113

Query: 106 LAGITYIELSTLRKEK 121
           L G  YI LS    +K
Sbjct: 114 LLGGKYIALSPGGDDK 129


>gi|238927291|ref|ZP_04659051.1| methyl-accepting chemotaxis sensory transducer [Selenomonas
           flueggei ATCC 43531]
 gi|238884878|gb|EEQ48516.1| methyl-accepting chemotaxis sensory transducer [Selenomonas
           flueggei ATCC 43531]
          Length = 700

 Score = 36.6 bits (83), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 48/209 (22%), Positives = 80/209 (38%), Gaps = 25/209 (11%)

Query: 130 ERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTIANI----ET 185
           E N+R +I     GI             +SD   H+ K +E++   +      I    + 
Sbjct: 475 EINRRTIIANLREGIIQEFDGYRRQMAGLSDVMEHVTKSVESVSGLVNQMSDGIGDQGDM 534

Query: 186 ISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVNQILEN 245
              +LA N S   K+ H T+ T       +    I+  I  L  +  AI+  +  ++   
Sbjct: 535 TKELLARNASITPKLEHLTESTKKIEQVMHMITEISAQINLL-ALNAAIEAARAGEMGRG 593

Query: 246 IQVSSNNFVK----------SSDQVI-NTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKS 294
             V +    K          +SD+ I   +HDV E  Q   +  Q+ D  + DF      
Sbjct: 594 FAVVAGEVRKLSENTRERLEASDEAIRELLHDVNEIDQMLAQ-NQEFDTKVEDFE----- 647

Query: 295 KETSAFLENIADSTSNMRSSISAIREITD 323
                F  ++ D  S++ S + AIRE +D
Sbjct: 648 ---QGFDGHVTDMKSSLASGVGAIRESSD 673


>gi|71906476|ref|YP_284063.1| histidine kinase, HAMP region: chemotaxis sensory transducer
           [Dechloromonas aromatica RCB]
 gi|71846097|gb|AAZ45593.1| Histidine kinase, HAMP region:Bacterial chemotaxis sensory
           transducer [Dechloromonas aromatica RCB]
          Length = 680

 Score = 36.6 bits (83), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 29/105 (27%), Positives = 55/105 (52%), Gaps = 11/105 (10%)

Query: 295 KETSAFLENIADSTSNMRSSISAIR------EITDQR-QKIISTINTIENITSNLNDSSQ 347
           +ETS  ++ + D ++NM  S+   R      EI DQR Q+ +  ++ I + T   + +SQ
Sbjct: 575 EETSRAVQRMQDVSTNMGGSVGMARQAGDSLEIIDQRAQQTVEVVHGIADSTREQSSASQ 634

Query: 348 KFAELMSKINNISALKENNSLFKDAQRAMHTFR---DTSEKINRY 389
           + A L+  I   SA   N+   ++++RA +  R   D   +++R+
Sbjct: 635 EIARLVENIAQ-SAEGSNSRAVRNSERAQNLQRLAADLQAQLSRF 678


>gi|126462592|ref|YP_001043706.1| hypothetical protein Rsph17029_1827 [Rhodobacter sphaeroides ATCC
           17029]
 gi|126104256|gb|ABN76934.1| Mammalian cell entry related domain protein [Rhodobacter
           sphaeroides ATCC 17029]
          Length = 156

 Score = 36.6 bits (83), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 26/69 (37%), Positives = 37/69 (53%), Gaps = 5/69 (7%)

Query: 48  SVDGLSTDSSVRFNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPL-YPSTTAT-IRTQG 105
           SVDG+S  + VR  G+ VG + GL L+   P    A A I     +  P+ +A  I ++G
Sbjct: 46  SVDGISVGTDVRLAGVKVGSVTGLALN---PQTYFADATISVKQGIELPTDSAILISSEG 102

Query: 106 LAGITYIEL 114
           L G  Y+EL
Sbjct: 103 LLGGNYVEL 111


>gi|150019632|ref|YP_001311886.1| methyl-accepting chemotaxis sensory transducer [Clostridium
           beijerinckii NCIMB 8052]
 gi|149906097|gb|ABR36930.1| methyl-accepting chemotaxis sensory transducer [Clostridium
           beijerinckii NCIMB 8052]
          Length = 874

 Score = 36.6 bits (83), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 28/119 (23%), Positives = 60/119 (50%), Gaps = 17/119 (14%)

Query: 234 IDLQKVNQILENIQVSSNNFVKSSDQVINTVHD-----------VRETTQTFQEVGQ--K 280
           + +Q++NQ+L +I +S+N    +S QV N   +           V E T +  E+G+  K
Sbjct: 563 LSVQEINQVLTDINISANEVASASVQVSNASQNLSQASAEQASAVEEVTASLSEIGEQTK 622

Query: 281 IDHLLSDFSSKMKSKETSAFLENIADSTSNMRSSISAIREITDQRQKIISTINTIENIT 339
           ++ + ++ ++++ +K T+    N  +  + M + + A+ EI +  + I   I  I+ I 
Sbjct: 623 LNAISANEANELATKATT----NAINGNTEMNTMLKAMNEINEASENISKIIKVIDEIA 677


>gi|215425623|ref|ZP_03423542.1| transmembrane transport protein mmpL1 [Mycobacterium tuberculosis
           T92]
 gi|289748890|ref|ZP_06508268.1| transmembrane transporter mmpL1 [Mycobacterium tuberculosis T92]
 gi|289689477|gb|EFD56906.1| transmembrane transporter mmpL1 [Mycobacterium tuberculosis T92]
          Length = 727

 Score = 36.6 bits (83), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 26/106 (24%), Positives = 49/106 (46%), Gaps = 8/106 (7%)

Query: 275 QEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNMRSSISAIREITDQRQKIISTINT 334
           + +G  IDH    F   M+S  T   L+N+ D  +++ +       +TDQ Q++I     
Sbjct: 474 RPLGAPIDHSSIPFQLGMQSTMTIENLQNLKDRVADLST-------LTDQLQRMIDITQR 526

Query: 335 IENITSNLNDSSQKF-AELMSKINNISALKENNSLFKDAQRAMHTF 379
            + +T  L D++    A      +N + L++  + F D  R + +F
Sbjct: 527 TQELTRQLTDATHDMNAHTRQMRDNANELRDRIADFDDFWRPLRSF 572


>gi|299143830|ref|ZP_07036910.1| exodeoxyribonuclease VII, large subunit [Peptoniphilus sp. oral
           taxon 386 str. F0131]
 gi|298518315|gb|EFI42054.1| exodeoxyribonuclease VII, large subunit [Peptoniphilus sp. oral
           taxon 386 str. F0131]
          Length = 420

 Score = 36.6 bits (83), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 35/130 (26%), Positives = 66/130 (50%), Gaps = 12/130 (9%)

Query: 277 VGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNMRSSISAIREITDQ--RQKIISTINT 334
           VG +ID+++SDF S +++   SA  E ++ S  ++ + +S ++   D+  +QK+    + 
Sbjct: 231 VGHEIDYVISDFVSDLRAPTPSAAAEMVSMSKEDLENRLSLLKNRLDKILQQKVEDNTSR 290

Query: 335 IENITSNLNDSSQKFAELMSKINNISALKENNSLFKDAQRAMH-------TFRDTSEKIN 387
           I+ +   LN   +KF    +K+ ++  L   NS +K   +  +       TF +   K N
Sbjct: 291 IDLLGEILNIKFEKF--YANKLESLKKLDLENSKWKLIYKVKYKKQNLELTFNNLDMKFN 348

Query: 388 RYIPSIGNNL 397
           + I SI  NL
Sbjct: 349 KKI-SINKNL 357


>gi|242055649|ref|XP_002456970.1| hypothetical protein SORBIDRAFT_03g046530 [Sorghum bicolor]
 gi|241928945|gb|EES02090.1| hypothetical protein SORBIDRAFT_03g046530 [Sorghum bicolor]
          Length = 928

 Score = 36.6 bits (83), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 23/92 (25%), Positives = 45/92 (48%), Gaps = 3/92 (3%)

Query: 236 LQKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSK 295
            Q +  + +N  VS N+ +++ D+  N VH+ +++ +  Q   +K DH   D++ K K  
Sbjct: 787 FQAIEMVSKNEMVSKNDVLRAIDKFSNVVHEFKKSQEDEQRQKRKADHASKDYNRKCKDL 846

Query: 296 ETS---AFLENIADSTSNMRSSISAIREITDQ 324
           E     + +EN   S  N    +  +R+  D+
Sbjct: 847 EEELGLSTMENPRYSHDNRVMDLEKLRKRRDE 878


>gi|195450899|ref|XP_002072681.1| GK13557 [Drosophila willistoni]
 gi|194168766|gb|EDW83667.1| GK13557 [Drosophila willistoni]
          Length = 2080

 Score = 36.6 bits (83), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 33/148 (22%), Positives = 66/148 (44%), Gaps = 16/148 (10%)

Query: 63   IPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKEKK 122
            I  G+++  F D E P   +  +L   +   +P+     + + L G++   LST++K + 
Sbjct: 1662 IGTGQLLKFFRDLEMP---IQLSLCNMEFTGFPA-----KQESLQGLSQQMLSTMKKLEA 1713

Query: 123  TIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTIAN 182
             I+++   R        +   +   +      S K+S S    ++I+E ++ P++  I  
Sbjct: 1714 KIYELHGSRFN----LGSSQAVAKVLGLHRKASGKVSTS----RQILEKLDSPISQLIVG 1765

Query: 183  IETISTVLANNISHIDKMMHTTQVTPHS 210
               +STVLA N+  + K     +V   S
Sbjct: 1766 YRKLSTVLAKNVQPLLKCCQDNRVYGQS 1793


>gi|294084612|ref|YP_003551370.1| cell entry-like protein [Candidatus Puniceispirillum marinum
           IMCC1322]
 gi|292664185|gb|ADE39286.1| Mammalian cell entry related protein [Candidatus Puniceispirillum
           marinum IMCC1322]
          Length = 151

 Score = 36.6 bits (83), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 25/68 (36%), Positives = 35/68 (51%), Gaps = 1/68 (1%)

Query: 47  GSVDGLSTDSSVRFNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGL 106
           G+  GLS    VR +GI +GRI    LD +  +  +A A I PD  +   ++A I    L
Sbjct: 44  GATGGLSVGDDVRISGIKIGRITSQTLDPDTYSARIAMA-INPDILIPADSSARITAASL 102

Query: 107 AGITYIEL 114
            G  Y+EL
Sbjct: 103 LGGNYLEL 110


>gi|32474657|ref|NP_867651.1| hypothetical protein RB7131 [Rhodopirellula baltica SH 1]
 gi|32445196|emb|CAD75198.1| hypothetical protein RB7131 [Rhodopirellula baltica SH 1]
          Length = 510

 Score = 36.6 bits (83), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 34/156 (21%), Positives = 69/156 (44%), Gaps = 13/156 (8%)

Query: 241 QILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDH--LLSDFSSKMKSKETS 298
           QI  N+  + +      D+V  T+ D RET +TF+EVG + +   ++++ +    + E  
Sbjct: 321 QIQRNVSDTVDRLPGVLDEVKVTLEDARETFETFREVGGQFEQVGIVAEDAVSQTANELQ 380

Query: 299 AFLENI---ADSTSNMRSSISAIREITDQR-----QKIISTINTIENITSNLNDSSQKFA 350
           + L ++   A S      +I A  E   +R     + ++ ++  ++N    L+   +   
Sbjct: 381 STLRSVRSTAKSFEGTAENIEAFTEPLGERGGELIEAVLVSLANVDNALVQLDTFGRT-- 438

Query: 351 ELMSKINNISALKENNSLFKDAQRAMHTFRDTSEKI 386
            L S    +  L E++ LF   QR +      S ++
Sbjct: 439 -LNSSDGTVRRLLEDDELFYQVQRTVQNIEAASARL 473


>gi|110803318|ref|YP_699840.1| phage infection protein [Clostridium perfringens SM101]
 gi|110683819|gb|ABG87189.1| putative phage infection protein [Clostridium perfringens SM101]
          Length = 718

 Score = 36.6 bits (83), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 51/203 (25%), Positives = 90/203 (44%), Gaps = 28/203 (13%)

Query: 235 DLQKVNQILENIQV---SSNNFVKSSDQVINTVHD-VRETTQTFQEVGQKIDHLLSDFSS 290
           DL KV   + N++    +S + + S+ Q +N V +       T Q   Q++ +LLS    
Sbjct: 231 DLPKVTDQISNLETTVEASKSLINSTQQTVNAVSNSFSSDVVTMQSTNQELQNLLS---- 286

Query: 291 KMKSKETSAFLENIADSTSNMRSSISAIREITDQRQKII-STINTIENITS--------- 340
             K KE    L N  D+T  M  ++  + ++TD   KII + I ++E I S         
Sbjct: 287 --KLKE----LNNAMDTTK-MVETLDKLLKLTDSLNKIIDNNIKSLEKINSLTPNDKIVD 339

Query: 341 ---NLNDSSQKFAELMSKINNISALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNL 397
              NLN++     +   ++ ++     NN   +D  +A+      S +++  + +I NN 
Sbjct: 340 LINNLNNAKDLVNKEKDQLVDLKTALSNNVSKEDIAKAIDVTSKISNELSSTLINISNNF 399

Query: 398 QNFSQSGLNDIQNLVRKLQETVN 420
            N     LN I N ++   +T N
Sbjct: 400 YNNGAPALNTIGNSLKGGLDTAN 422


>gi|71028514|ref|XP_763900.1| small nuclear ribonucleoprotein [Theileria parva strain Muguga]
 gi|68350854|gb|EAN31617.1| small nuclear ribonucleoprotein, putative [Theileria parva]
          Length = 744

 Score = 36.6 bits (83), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 18/86 (20%), Positives = 48/86 (55%), Gaps = 2/86 (2%)

Query: 159 SDSSRHIQKIIENIEKPLTTTIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFN 218
           S  +RH+++ +E +E P+   + N++  + V+A +I+ I   +H  +      D+ N F 
Sbjct: 584 SKKTRHLEETLETLEPPIIIFV-NLKKNTDVIAKHITKIAVSLHGGKTQESREDALNNFK 642

Query: 219 T-ITDLITSLDKMIKAIDLQKVNQIL 243
           + + D++ + D + + +D++ +  ++
Sbjct: 643 SGVYDILVATDVVGRGLDVEGIKCVI 668


>gi|253573447|ref|ZP_04850790.1| chemotaxis sensory transducer [Paenibacillus sp. oral taxon 786
           str. D14]
 gi|251846975|gb|EES74980.1| chemotaxis sensory transducer [Paenibacillus sp. oral taxon 786
           str. D14]
          Length = 419

 Score = 36.2 bits (82), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 39/158 (24%), Positives = 76/158 (48%), Gaps = 40/158 (25%)

Query: 230 MIKAIDLQKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFS 289
           ++++I+ Q V Q  +NI+++     + S+ +       RE  Q FQE+ Q + ++     
Sbjct: 294 LVRSIE-QDVKQAGQNIKINEEVVRQQSEMI-------REAEQIFQEIVQSVQYI----- 340

Query: 290 SKMKSKETSAFL---ENIADSTSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSS 346
               S+E +AF    E + +S  N+ S+I  I  IT++     S   T E +++++N+  
Sbjct: 341 ----SEEIAAFARESEEMLESAQNISSAIQNISAITEE-----SAAGT-EQVSASMNE-- 388

Query: 347 QKFAELMSKINNISALKENNSLFKDA----QRAMHTFR 380
                   +I +I A+ E     K+A    Q+ +H F+
Sbjct: 389 --------QITSIRAMAEEAEAMKNAVFQLQKTIHIFK 418


Searching..................................................done


Results from round 2




>gi|254780140|ref|YP_003064553.1| putative ABC transporter, substrate-binding protein [Candidatus
           Liberibacter asiaticus str. psy62]
 gi|254039817|gb|ACT56613.1| putative ABC transporter, substrate-binding protein [Candidatus
           Liberibacter asiaticus str. psy62]
          Length = 452

 Score =  498 bits (1283), Expect = e-139,   Method: Composition-based stats.
 Identities = 452/452 (100%), Positives = 452/452 (100%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF
Sbjct: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE
Sbjct: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
           KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI
Sbjct: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
           ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN
Sbjct: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240

Query: 241 QILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAF 300
           QILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAF
Sbjct: 241 QILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAF 300

Query: 301 LENIADSTSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNIS 360
           LENIADSTSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNIS
Sbjct: 301 LENIADSTSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNIS 360

Query: 361 ALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVN 420
           ALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVN
Sbjct: 361 ALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVN 420

Query: 421 HFDDCLNNFERNPQDIVWGREKGSVKIYKPKH 452
           HFDDCLNNFERNPQDIVWGREKGSVKIYKPKH
Sbjct: 421 HFDDCLNNFERNPQDIVWGREKGSVKIYKPKH 452


>gi|315122742|ref|YP_004063231.1| putative ABC transporter, substrate-binding protein [Candidatus
           Liberibacter solanacearum CLso-ZC1]
 gi|313496144|gb|ADR52743.1| putative ABC transporter, substrate-binding protein [Candidatus
           Liberibacter solanacearum CLso-ZC1]
          Length = 448

 Score =  416 bits (1070), Expect = e-114,   Method: Composition-based stats.
 Identities = 273/452 (60%), Positives = 352/452 (77%), Gaps = 4/452 (0%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME KNYYT+VG F +SIL  SF+SIYWLSR++QY+GP  E+IIRIPGSV+GL+ +SSVRF
Sbjct: 1   MEVKNYYTAVGFFAISILLLSFYSIYWLSRNDQYNGPTTELIIRIPGSVEGLAVNSSVRF 60

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NGIP+G + GLF+D++ P++S+A+ L+R D PLYPST A I+ QG+ G+TYIELST R E
Sbjct: 61  NGIPIGHVTGLFVDKDNPHYSMAQTLVRVDVPLYPSTKAMIKAQGITGMTYIELSTERTE 120

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
             T+FQ AT+  + AMITA PSGIN+ +S AE+T  KI+ SS  IQKII N + PL   I
Sbjct: 121 NYTLFQTATKEKKIAMITAIPSGINHLLSTAEDTLNKINVSSDQIQKIINNADNPLNRII 180

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
            N ETIST+L +N+S +DKM+H  +    + D   T +  +D ITSL+K IKA+D+QK+N
Sbjct: 181 KNFETISTILVDNVSDLDKMIH--RKNNVAVDFTKTLSNTSDFITSLNKTIKAVDIQKIN 238

Query: 241 QILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAF 300
           QI+ENIQV SNNF+KSSDQV NT++D++ETT TFQ VG+K DHLLSD SS++ SKE   F
Sbjct: 239 QIIENIQVVSNNFIKSSDQVTNTINDLQETTHTFQGVGKKADHLLSDVSSQIHSKEAFDF 298

Query: 301 LENIADSTSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNIS 360
            ENI++S+SN+R+S SAIREITD  QKII TI+TIE +T NLN+SS K  ELM+ IN+ +
Sbjct: 299 WENISESSSNIRNSTSAIREITDHSQKIILTIDTIEKMTENLNNSSIKLKELMTTINSFT 358

Query: 361 ALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVN 420
             +   SL +DAQ+A+ +F++T+EKIN YIP I  NLQNFS SGL D+QNL+R LQETV 
Sbjct: 359 DSEGKKSLIEDAQKAIRSFQNTTEKINEYIPPIAKNLQNFSNSGLYDLQNLIRNLQETVG 418

Query: 421 HFDDCLNNFERNPQDIVWGREKGSVKIYKPKH 452
           HFDD L+NFERNPQ+I+WG+E  +VK YKPKH
Sbjct: 419 HFDDSLSNFERNPQNIIWGKE--TVKQYKPKH 448


>gi|327190642|gb|EGE57730.1| putative ABC transporter, substrate-binding protein [Rhizobium etli
           CNPAF512]
          Length = 456

 Score =  388 bits (996), Expect = e-105,   Method: Composition-based stats.
 Identities = 145/458 (31%), Positives = 256/458 (55%), Gaps = 12/458 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K  YT VG F V ++  +F  +YW++   +  GPM E+I+RIPGS +GLS  S VRF
Sbjct: 1   METKANYTIVGFFTVLVIAAAFGFVYWMAEYGR-GGPMTELIVRIPGSANGLSVGSPVRF 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NGI +G +  L +D + P +SLA   +R D P+YPST A +  QGL G  YIELS  RK 
Sbjct: 60  NGIQIGSVQTLSIDADDPQYSLAFTQVRTDAPIYPSTKAALEIQGLTGAAYIELSGGRKG 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
           +++I Q A +  +RA+I A  S +   ++ A+    + +D+   +Q  I++   PLT T 
Sbjct: 120 EESILQHAIDNGKRAVIVADQSSVTNLLATADKILDRANDAVGELQGFIQDSRAPLTQTF 179

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
            N ET S  LA N  +ID  + +  V   S+  K     +   + +++ ++KA+D QK++
Sbjct: 180 KNAETFSDALAKNSDNIDAFLQS--VGELSNTVKAVSGRVDSTLEAVESLVKAVDAQKID 237

Query: 241 QILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFS---SKMKSKET 297
            I+ N +  + N   +S  +   +    ET  TF + G++    L       +++   + 
Sbjct: 238 HIVSNAERITANVADASGDLKGAIQKFDETATTFNDFGKQAQDTLDRVDTLVAQIDPAKL 297

Query: 298 SAFLENIADSTSNMRSSISAIREITD----QRQKIISTINTIENITSNLNDSSQKFAELM 353
              +++I+ +T + R+++++IR++ +    +++ I  TI  +  + + LN +S +   ++
Sbjct: 298 KGSVDDISQATKDARAAVASIRDVANTVSGRQKDIDQTIQDVSQLANKLNSASTRIDGIL 357

Query: 354 SKINNISALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVR 413
            K++ +       S+F  A+  + +F+  ++ +N  I  I +NLQ FS  GL D+Q LV 
Sbjct: 358 IKVDALLGTDNTQSMFAQARETLESFKKVADNLNSRIGPIADNLQKFSSGGLRDVQTLVN 417

Query: 414 KLQETVNHFDDCLNNFERNPQDIVWGREKGSVKIYKPK 451
            ++ TVN+ +D + NF+RNPQ +++G +  +VK Y  +
Sbjct: 418 DMRGTVNNLNDTITNFDRNPQRLIFGGD--TVKQYDGR 453


>gi|241204913|ref|YP_002976009.1| Mammalian cell entry related domain protein [Rhizobium
           leguminosarum bv. trifolii WSM1325]
 gi|240858803|gb|ACS56470.1| Mammalian cell entry related domain protein [Rhizobium
           leguminosarum bv. trifolii WSM1325]
          Length = 456

 Score =  387 bits (995), Expect = e-105,   Method: Composition-based stats.
 Identities = 146/458 (31%), Positives = 259/458 (56%), Gaps = 12/458 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K  YT VG F V ++  +F  +YW++   +  GPM E+I+RIPGS +GLS  S VRF
Sbjct: 1   METKANYTIVGFFTVLVIAAAFGFVYWMAEYGR-GGPMTELIVRIPGSANGLSVGSPVRF 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NGI +G +  L +D + P +SLA   +R D P+YPST A +  QGL G  YIELS  RK 
Sbjct: 60  NGIQIGSVQTLSIDADDPQYSLAFTQVRTDAPIYPSTKAALEIQGLTGAAYIELSGGRKG 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
           +++I Q A +  +RA+I A  S +   ++ A+    + +D+   +Q  IE+   PLT T 
Sbjct: 120 EESILQHAIDNGKRAVIVADQSSVTNLLATADKILDRANDAVGELQGFIEDSRGPLTETF 179

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
            N ET S  LA N  +ID  + +  V   S+  K   + +   + +++ ++KA+D QK++
Sbjct: 180 KNAETFSDALAKNSGNIDAFLQS--VGELSNTVKAVSSRVDSTLQAVESLVKAVDAQKID 237

Query: 241 QILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFS---SKMKSKET 297
            I+ N +  + N   +S  +   +    +T  TF + G++    L       +++   + 
Sbjct: 238 NIVSNAEKITANVADASGDLKGAIQKFDQTATTFNDFGKQAQATLDRVDTLVAQIDPAKV 297

Query: 298 SAFLENIADSTSNMRSSISAIREITD----QRQKIISTINTIENITSNLNDSSQKFAELM 353
              +++I+ +T + R+++++IRE+ +    +++ I  TI  +  +++ LN +S +   ++
Sbjct: 298 KGSVDDISQATKDARAAVASIREVANTVSARQKDIDQTIQDVSQLSNKLNSASTRIDGIL 357

Query: 354 SKINNISALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVR 413
            K++ +       SLF +A+  + +F+  ++ +N  I  I +NLQ FS  GL D+Q LV 
Sbjct: 358 IKVDALLGTDNTQSLFTEARDTLESFKKVADNLNSRIGPIADNLQKFSSGGLRDVQTLVN 417

Query: 414 KLQETVNHFDDCLNNFERNPQDIVWGREKGSVKIYKPK 451
            ++ TV++ +D + NF+RNPQ +++G +  +VK Y  +
Sbjct: 418 DMRGTVSNLNDTITNFDRNPQRLIFGGD--TVKQYDGR 453


>gi|190892033|ref|YP_001978575.1| putative ABC transporter, substrate-binding protein [Rhizobium etli
           CIAT 652]
 gi|190697312|gb|ACE91397.1| putative ABC transporter, substrate-binding protein [Rhizobium etli
           CIAT 652]
          Length = 456

 Score =  387 bits (995), Expect = e-105,   Method: Composition-based stats.
 Identities = 146/458 (31%), Positives = 256/458 (55%), Gaps = 12/458 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K  YT VG F V ++  +F  +YW++   +  GPM E+I+RIPGS +GLS  S VRF
Sbjct: 1   METKANYTIVGFFTVLVIAAAFGFVYWMAEYGR-GGPMTELIVRIPGSANGLSVGSPVRF 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NGI +G +  L +D + P +SLA   +R D P+YPST A +  QGL G  YIELS  RK 
Sbjct: 60  NGIQIGSVQTLSIDADDPQYSLAFTQVRTDAPIYPSTKAALEIQGLTGAAYIELSGGRKG 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
           +++I Q A +  +RA+I A  S +   ++ A+    + +D+   +Q  I++   PLT T 
Sbjct: 120 EESILQHAIDNGKRAVIVADQSSVTNLLATADKILDRANDAVGELQGFIQDSRAPLTQTF 179

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
            N ET S  LA N  +ID  + +  V   S+  K     +   + +++ ++KA+D QK++
Sbjct: 180 KNAETFSDALAKNSDNIDAFLQS--VGELSNTVKAVSGRVDSTLEAVESLVKAVDAQKID 237

Query: 241 QILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFS---SKMKSKET 297
            I+ N +  + N   +S  +   +    ET  TF + G++    L       +++   + 
Sbjct: 238 HIVSNAERITANVADASGDLKGAIQKFDETATTFNDFGKQAQDTLDRVDTLVAQIDPAKL 297

Query: 298 SAFLENIADSTSNMRSSISAIREITD----QRQKIISTINTIENITSNLNDSSQKFAELM 353
              +++I+ +T + R++I++IR++ +    +++ I  TI  +  + + LN +S +   ++
Sbjct: 298 KGSVDDISQATKDARAAIASIRDVANTVSGRQKDIDQTIQDVSQLANKLNSASTRIDGIL 357

Query: 354 SKINNISALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVR 413
            K++ +       S+F  A+  + +F+  ++ +N  I  I +NLQ FS  GL D+Q LV 
Sbjct: 358 IKVDALLGTDNTQSMFAQARETLESFKKVADNLNSRIGPIADNLQKFSSGGLRDVQTLVN 417

Query: 414 KLQETVNHFDDCLNNFERNPQDIVWGREKGSVKIYKPK 451
            ++ TVN+ +D + NF+RNPQ +++G +  +VK Y  +
Sbjct: 418 DMRGTVNNLNDTITNFDRNPQRLIFGGD--TVKQYDGR 453


>gi|116252405|ref|YP_768243.1| solute-binding component of ABC transporter [Rhizobium
           leguminosarum bv. viciae 3841]
 gi|115257053|emb|CAK08147.1| putative solute-binding component of ABC transporter [Rhizobium
           leguminosarum bv. viciae 3841]
          Length = 456

 Score =  387 bits (994), Expect = e-105,   Method: Composition-based stats.
 Identities = 146/458 (31%), Positives = 258/458 (56%), Gaps = 12/458 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K  YT VG F V ++  +F  +YW++   +  GPM E+I+RIPGS +GLS  S VRF
Sbjct: 1   METKANYTIVGFFTVLVIAAAFGFVYWMAEYGR-GGPMTELIVRIPGSANGLSVGSPVRF 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NGI +G +  L +D + P +SLA   +R D P+YPST A +  QGL G  YIELS  RK 
Sbjct: 60  NGIQIGSVQTLSIDADDPQYSLAFTQVRTDAPIYPSTKAALEIQGLTGAAYIELSGGRKG 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
           +++I Q A +  +RA+I A  S +   ++ A+    + +D+   +Q  IE+   PLT T 
Sbjct: 120 EESILQHAIDNGKRAVIVADQSSVTNLLATADKILDRANDAVGELQGFIEDSRGPLTETF 179

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
            N ET S  LA N  +ID  + +  V   S+  K     +   + +++ ++KA+D QK++
Sbjct: 180 KNAETFSDALAKNSGNIDAFLQS--VGELSNTVKAVSGRVDSTLQAVESLVKAVDAQKID 237

Query: 241 QILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFS---SKMKSKET 297
            I+ N +  + N   +S  +   +    +T  TF + G++    L       +++   + 
Sbjct: 238 NIVSNAEKITANVADASGDLKGAIQKFDQTATTFNDFGKQAQATLDRVDTLVAQIDPAKV 297

Query: 298 SAFLENIADSTSNMRSSISAIREITD----QRQKIISTINTIENITSNLNDSSQKFAELM 353
              +++IA +T + R+++++IR++ +    +++ I  TI  +  +++ LN +S +   ++
Sbjct: 298 KGSVDDIAQATKDARAAVASIRDVANTVSARQKDIDQTIQDVSQLSNKLNSASTRIDGIL 357

Query: 354 SKINNISALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVR 413
            K++ +       SLF +A+  + +F+  ++ +N  I  I +NLQ FS  GL D+Q LV 
Sbjct: 358 IKVDALLGTDNTQSLFTEARNTLESFKKVADNLNSRIGPIADNLQKFSSGGLRDVQTLVN 417

Query: 414 KLQETVNHFDDCLNNFERNPQDIVWGREKGSVKIYKPK 451
            ++ TV++ +D + NF+RNPQ +++G +  +VK Y  +
Sbjct: 418 DMRGTVSNLNDTITNFDRNPQRLIFGGD--TVKQYDGR 453


>gi|86357962|ref|YP_469854.1| putative ABC transporter protein [Rhizobium etli CFN 42]
 gi|86282064|gb|ABC91127.1| putative ABC transporter protein [Rhizobium etli CFN 42]
          Length = 456

 Score =  387 bits (993), Expect = e-105,   Method: Composition-based stats.
 Identities = 145/458 (31%), Positives = 258/458 (56%), Gaps = 12/458 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K  YT VG F V ++  +F  +YW++   +  GPM E+I+RIPGS +GLS  S VRF
Sbjct: 1   METKANYTIVGFFTVLVIAAAFGFVYWMAEYGR-GGPMTELIVRIPGSANGLSVGSPVRF 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NGI VG +  L +D + P +SLA   +R D P+YPST A +  QGL G  YIELS  RK 
Sbjct: 60  NGIQVGSVQTLSIDADDPQYSLAFTQVRTDAPIYPSTKAALEIQGLTGAAYIELSGGRKG 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
           +++I + A E  +RA+I A  S +   ++ A+    + +D+   +Q  IE+   PLT T 
Sbjct: 120 EESILKHAIENGKRAVIVADQSSVTNLLATADKILDRANDAVGELQGFIEDSRAPLTQTF 179

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
            N ET S  LA N  +ID  + +  V   S+  K     +   + +++ +++A+D QK++
Sbjct: 180 KNAETFSDALAKNSDNIDAFLQS--VGELSNTVKAVSGRVDSTLQAVESLVRAVDAQKID 237

Query: 241 QILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFS---SKMKSKET 297
            I+ N +  + N   +S  +   +    ET  TF + G++    L       +++   + 
Sbjct: 238 NIVSNAEKITANVADASGDLKGAIQKFDETATTFNDFGKQAQATLDRVDTLVAQIDPAKI 297

Query: 298 SAFLENIADSTSNMRSSISAIREITD----QRQKIISTINTIENITSNLNDSSQKFAELM 353
              +++I+ +T + R ++++IR++ +    +++ I  TI  +  + + LN +S +   ++
Sbjct: 298 KGSVDDISQATKDARVAVASIRDVANTVSLRQKDIDQTIQDVSQLANKLNSASTRVDGIL 357

Query: 354 SKINNISALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVR 413
            K++ +       SLF +A+  + +F+  ++ +N  I  I +NLQ FS +GL D+Q L+ 
Sbjct: 358 IKVDALLGTDNTQSLFAEARETLESFKKVADNLNSRIGPIADNLQKFSSAGLRDVQTLIN 417

Query: 414 KLQETVNHFDDCLNNFERNPQDIVWGREKGSVKIYKPK 451
            ++ TV++ +D ++NF+RNPQ +++G +  +VK Y  +
Sbjct: 418 DMRGTVSNLNDTISNFDRNPQRLIFGGD--TVKQYDGR 453


>gi|209549576|ref|YP_002281493.1| hypothetical protein Rleg2_1982 [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209535332|gb|ACI55267.1| Mammalian cell entry related domain protein [Rhizobium
           leguminosarum bv. trifolii WSM2304]
          Length = 456

 Score =  387 bits (993), Expect = e-105,   Method: Composition-based stats.
 Identities = 146/458 (31%), Positives = 256/458 (55%), Gaps = 12/458 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K  YT VG F V ++  +F  +YW++   +  GPM E+I+RIPGS +GLS  S VRF
Sbjct: 1   METKANYTIVGFFTVLVIAAAFGFVYWMAEYGR-GGPMTELIVRIPGSANGLSVGSPVRF 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NGI +G +  L +D + P +SLA   +R D P+YPST A +  QGL G  YIELS  RK 
Sbjct: 60  NGIQIGSVQTLSIDADDPQYSLAFTQVRTDAPIYPSTKAALEIQGLTGAAYIELSGGRKG 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
           +++I Q A +  +RA+I A  S +   ++ A+    + +D+   +Q  IE+   PLT T 
Sbjct: 120 EESILQHAIDNGKRAVIVADQSSVTNLLATADKILDRANDAVGELQGFIEDSRAPLTQTF 179

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
            N ET S  LA N  +ID  + +  V   S+  K     +   + +++ ++KA+D +K++
Sbjct: 180 KNAETFSDALAKNSGNIDAFLQS--VGELSNTVKAVSGRVDSTLQAVESLVKAVDAKKID 237

Query: 241 QILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFS---SKMKSKET 297
            I+ N    + N   +S  +   +    +T  TF + G++    L       +++   + 
Sbjct: 238 NIVSNADKITANVADASGDLKGAIQKFDQTATTFNDFGKQAQATLDRVDTLVAQIDPAKV 297

Query: 298 SAFLENIADSTSNMRSSISAIREITD----QRQKIISTINTIENITSNLNDSSQKFAELM 353
              +++IA +T + R+++++IR++ +    +++ I  TI  +  + + LN +S +   ++
Sbjct: 298 KGSVDDIAQATKDARAAVASIRDVANTVSGRQKDIDQTIQDVSQLANKLNSASTRIDGIL 357

Query: 354 SKINNISALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVR 413
            K++ +       SLF +A+  + +F+  ++ +N  I  I +NLQ FS  GL D+Q LV 
Sbjct: 358 IKVDALLGTDNTQSLFTEARDTLESFKKVADNLNARIGPIADNLQKFSSGGLRDVQTLVN 417

Query: 414 KLQETVNHFDDCLNNFERNPQDIVWGREKGSVKIYKPK 451
            ++ TVN+ +D + NF+RNPQ +++G +  +VK Y  +
Sbjct: 418 DMRGTVNNLNDTITNFDRNPQRLIFGGD--TVKQYDGR 453


>gi|163759628|ref|ZP_02166713.1| ABC transporter, substrate binding protein [Hoeflea phototrophica
           DFL-43]
 gi|162283225|gb|EDQ33511.1| ABC transporter, substrate binding protein [Hoeflea phototrophica
           DFL-43]
          Length = 456

 Score =  379 bits (972), Expect = e-103,   Method: Composition-based stats.
 Identities = 122/458 (26%), Positives = 233/458 (50%), Gaps = 12/458 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++  Y  VG F V ++  +F  +YW++R     G   ++++RIPGS +GLS  S V F
Sbjct: 1   METRANYAIVGFFTVLVMVSAFGFVYWMARYGG-TGDTTQLVVRIPGSANGLSVGSPVHF 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NGIP G +  L +D   PN  +A  ++R D P+Y  T A +  QGL G  YIEL      
Sbjct: 60  NGIPYGVVRRLNIDPNSPNFVIADTVVRSDAPIYTDTRAALEIQGLTGSAYIELQGGTPS 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
              I   A   +  A+I A PSG+   ++ A+    +++     ++  +E    PLT T+
Sbjct: 120 NPNILDQAISDSGVAVIEADPSGVTNLLATADEILTRVNRVIGEVEGFVEEARSPLTGTL 179

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
            N E+ S  L++N   ID+ + +      +  S +    +   + S +++I A+D  +V 
Sbjct: 180 RNAESFSAALSDNADGIDEFLKSVSALSGTVQSLSV--KLEGTLGSAERLINAVDPDQVR 237

Query: 241 QILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKS---KET 297
            I+ ++   + +   SS  +I T+  +R T Q+ ++        L    + + S    + 
Sbjct: 238 NIVSSVDKVTGDLAASSGDIIKTLESLRGTAQSLEQFVTDAGASLDKVDAVIASVDPAKV 297

Query: 298 SAFLENIADSTSNMRSSISAIREITD----QRQKIISTINTIENITSNLNDSSQKFAELM 353
              ++NI  ++++ R +++  R + +    +++     I  ++ ++  LN +S++   ++
Sbjct: 298 GEVMDNITVASADARQTLADARGVAETFGARKEDFDLIITDVKEMSGRLNAASERVDGVL 357

Query: 354 SKINNISALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVR 413
           +K++      + +SL  DA+  + +FR+ +  +N  I  I +NLQ FS SGL D++ LV 
Sbjct: 358 AKLDGFLGEGDASSLIADAEETLKSFREVANSLNARIGPIADNLQRFSGSGLRDVEALVN 417

Query: 414 KLQETVNHFDDCLNNFERNPQDIVWGREKGSVKIYKPK 451
             + ++   +  + + ER+PQ +++G E  +VK Y  +
Sbjct: 418 DARRSIQRIEQSITSIERDPQRLLFGGE--TVKQYDGR 453


>gi|222086198|ref|YP_002544730.1| ABC transporter protein [Agrobacterium radiobacter K84]
 gi|221723646|gb|ACM26802.1| ABC transporter protein [Agrobacterium radiobacter K84]
          Length = 456

 Score =  375 bits (962), Expect = e-101,   Method: Composition-based stats.
 Identities = 144/458 (31%), Positives = 260/458 (56%), Gaps = 12/458 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K  YT VG F + ++  +F  +YW++   +  GPM E+++RIPGS +GLS  S VRF
Sbjct: 1   METKANYTIVGFFTLLVIAAAFGFVYWMAEYGR-GGPMVELVVRIPGSANGLSVGSPVRF 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NGI VG + GL +D + PN+SLA   +R D P+Y ST A +  QGL G  YIELS  R  
Sbjct: 60  NGIQVGSVQGLSIDADDPNYSLAFTEVRADAPVYTSTKAILEIQGLTGAAYIELSGGRNG 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
            + I + + +  +RA++ A  S +   ++ A+    + +D+   IQ  + +   PLT T+
Sbjct: 120 DENILKRSVDTGKRAVLLADQSSVTNLLNTADKILNRANDTIGDIQGFVSDSRAPLTDTV 179

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
            N +T S  L++N  +IDK + +  +   S   KN    I   + +++K+++A+D  K+N
Sbjct: 180 RNAQTFSKALSDNSDNIDKFLAS--MGQLSDTFKNVSTRIDSTLEAVEKLVRAVDANKIN 237

Query: 241 QILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFS---SKMKSKET 297
           +++ N    + N   ++  +  TV   ++T  T+   GQK    L       +++   + 
Sbjct: 238 EVVNNANKITANVADATTDLKATVAAFKQTADTYNAFGQKAQQTLDRVDAIVAQIDPAKL 297

Query: 298 SAFLENIADSTSNMRSSISAIREITD----QRQKIISTINTIENITSNLNDSSQKFAELM 353
              +++I   T + R+++++IRE+ +    ++Q I  TI    +I+  LN +S K   ++
Sbjct: 298 KGSVDDITQVTKDARAAVTSIREVANSVAARQQDIDQTIANARSISEKLNSASGKVDGVL 357

Query: 354 SKINNISALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVR 413
           SK++++    +  SLF +A+  + +F+  ++ +N  I  I +NLQ FS SGL+++Q L+ 
Sbjct: 358 SKVDSLLGSGDTQSLFAEAKDTLTSFKKMADNLNARIGPIADNLQKFSSSGLSNVQTLIN 417

Query: 414 KLQETVNHFDDCLNNFERNPQDIVWGREKGSVKIYKPK 451
            ++ TV++ +  + NF+RNPQ +++G +  +VK Y  +
Sbjct: 418 DMRGTVDNLNSTITNFDRNPQRLLFGGD--TVKQYDGR 453


>gi|15965584|ref|NP_385937.1| hypothetical protein SMc00176 [Sinorhizobium meliloti 1021]
 gi|15074765|emb|CAC46410.1| Conserved hypothetical protein [Sinorhizobium meliloti 1021]
          Length = 458

 Score =  373 bits (957), Expect = e-101,   Method: Composition-based stats.
 Identities = 137/458 (29%), Positives = 240/458 (52%), Gaps = 12/458 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K  Y  VG F V ++  +F  +YW+S+  +  G M E+++ IPGS +GLS  S VRF
Sbjct: 3   METKANYAIVGFFTVLVIAAAFGFVYWMSQYGR-TGQMVELVVNIPGSANGLSVGSPVRF 61

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NGI VG +  L +D   P +S+A   +  D P+  STTAT+  QGL G  YIELS  RK 
Sbjct: 62  NGINVGSVRNLAIDANDPRYSIAITEVSADAPVMKSTTATLEVQGLTGAAYIELSGGRKG 121

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
            + I + A E+  +A I A  S +   ++ A+    + + +   IQ  + ++  PLT+TI
Sbjct: 122 DENILKTALEKGTQAHILADQSSVTSLLATADQILDRANSAITDIQSFVTDVRGPLTSTI 181

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
            N E  S  LA+N   ID+ + + +    S         + D + S D++IK++D +K++
Sbjct: 182 GNAERFSKALADNSGAIDQFLKSVE--QLSGSVNAASKKLDDTLASADRLIKSVDPKKID 239

Query: 241 QILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFS---SKMKSKET 297
            I+ N +  SNN   +S  V   +   R T +T+ + G+     L       + + +++ 
Sbjct: 240 NIVSNAEQVSNNLKDASGGVSEAIAGFRRTVETYDQFGKSAQETLKRVDTLVAAVDAQKV 299

Query: 298 SAFLENIADSTSNMRSSISAIRE----ITDQRQKIISTINTIENITSNLNDSSQKFAELM 353
              + +I  ++++ R   + + +    I+ ++  I  TI     +++ LN +S +   ++
Sbjct: 300 GLVVNDITAASADARKVAAQVSDFAEKISARQDDIDQTITDFTQMSNKLNAASNRVDSIL 359

Query: 354 SKINNISALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVR 413
            KI+      +  SL   A+  + +FR  +E +N  +  I  NL+ FS SGL D++ LV 
Sbjct: 360 VKIDGFLGDADAPSLSAQARETLESFRRVAENLNAQLGPIAENLKRFSNSGLRDVEALVG 419

Query: 414 KLQETVNHFDDCLNNFERNPQDIVWGREKGSVKIYKPK 451
             + TV    + +++F++NPQ +++G E  +VK Y  +
Sbjct: 420 DTRRTVQSLQNTISDFDKNPQRLLFGGE--TVKQYDGR 455


>gi|150396762|ref|YP_001327229.1| hypothetical protein Smed_1552 [Sinorhizobium medicae WSM419]
 gi|150028277|gb|ABR60394.1| Mammalian cell entry related domain protein [Sinorhizobium medicae
           WSM419]
          Length = 458

 Score =  372 bits (954), Expect = e-101,   Method: Composition-based stats.
 Identities = 138/458 (30%), Positives = 239/458 (52%), Gaps = 12/458 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K  Y  VG F V ++  +F  +YW+S+  +  G M ++++ IPGS +GLS  S VRF
Sbjct: 3   METKANYAIVGFFTVLVIAAAFGFVYWMSQYGR-TGQMVQLVVNIPGSANGLSVGSPVRF 61

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NGI VG +  L +D   P +S+A   +  D P+  STTAT+  QGL G  YIELS  RK 
Sbjct: 62  NGINVGSVRNLAIDANDPRYSIAITEVSADAPVMKSTTATLEVQGLTGAAYIELSGGRKG 121

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
            + I + A ER  +A I A  S +   ++ A+    + + +   IQ  + ++  PLT+TI
Sbjct: 122 DENILKTALERGTQAHILADQSSVTSLLATADQILDRANSAITDIQSFVTDVRGPLTSTI 181

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
            N E  S  LA+N   ID+ + + +    S         + D +   D++IKA+D +K+ 
Sbjct: 182 GNAERFSKALADNSDAIDQFLESVE--QLSGSVNAASKKLDDTLAGADRLIKAVDPKKIE 239

Query: 241 QILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFS---SKMKSKET 297
            I+ N +  SNN   +S +V  TV   + T +T+ + G+     L       + + S++ 
Sbjct: 240 NIVGNAEQVSNNLKNASGEVTETVASFQRTLETYNQFGKNAQQTLERVDALVAAVDSQKV 299

Query: 298 SAFLENIADSTSNMRSSISAIRE----ITDQRQKIISTINTIENITSNLNDSSQKFAELM 353
              + +I  ++++ R   + + +    I+ ++  I  TI     +++ LN +S +   ++
Sbjct: 300 GLVVNDITAASADARKVAAQVSDFAEKISARQGDIDQTITDFTQMSNKLNAASGRVDSIL 359

Query: 354 SKINNISALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVR 413
            KI+      +  SL   A+  + +FR  +E +N  +  I  NL+ FS SGL D++ L+ 
Sbjct: 360 VKIDGFLGDADAPSLSAQARETLESFRRVAENLNAQLGPIAENLKRFSNSGLRDVEALIG 419

Query: 414 KLQETVNHFDDCLNNFERNPQDIVWGREKGSVKIYKPK 451
             + TV    + ++ F++NPQ +++G E  +VK Y  +
Sbjct: 420 DTRRTVQGLQNTISEFDKNPQRLLFGGE--TVKQYDGR 455


>gi|307302704|ref|ZP_07582460.1| Mammalian cell entry related domain protein [Sinorhizobium meliloti
           BL225C]
 gi|307318552|ref|ZP_07597986.1| Mammalian cell entry related domain protein [Sinorhizobium meliloti
           AK83]
 gi|306895892|gb|EFN26644.1| Mammalian cell entry related domain protein [Sinorhizobium meliloti
           AK83]
 gi|306903068|gb|EFN33659.1| Mammalian cell entry related domain protein [Sinorhizobium meliloti
           BL225C]
          Length = 456

 Score =  371 bits (953), Expect = e-101,   Method: Composition-based stats.
 Identities = 137/458 (29%), Positives = 240/458 (52%), Gaps = 12/458 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K  Y  VG F V ++  +F  +YW+S+  +  G M E+++ IPGS +GLS  S VRF
Sbjct: 1   METKANYAIVGFFTVLVIAAAFGFVYWMSQYGR-TGQMVELVVNIPGSANGLSVGSPVRF 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NGI VG +  L +D   P +S+A   +  D P+  STTAT+  QGL G  YIELS  RK 
Sbjct: 60  NGINVGSVRNLAIDANDPRYSIAITEVSADAPVMKSTTATLEVQGLTGAAYIELSGGRKG 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
            + I + A E+  +A I A  S +   ++ A+    + + +   IQ  + ++  PLT+TI
Sbjct: 120 DENILKTALEKGTQAHILADQSSVTSLLATADQILDRANSAITDIQSFVTDVRGPLTSTI 179

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
            N E  S  LA+N   ID+ + + +    S         + D + S D++IK++D +K++
Sbjct: 180 GNAERFSKALADNSGAIDQFLKSVE--QLSGSVNAASKKLDDTLASADRLIKSVDPKKID 237

Query: 241 QILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFS---SKMKSKET 297
            I+ N +  SNN   +S  V   +   R T +T+ + G+     L       + + +++ 
Sbjct: 238 NIVSNAEQVSNNLKDASGGVSEAIAGFRRTVETYDQFGKSAQETLKRVDTLVAAVDAQKV 297

Query: 298 SAFLENIADSTSNMRSSISAIRE----ITDQRQKIISTINTIENITSNLNDSSQKFAELM 353
              + +I  ++++ R   + + +    I+ ++  I  TI     +++ LN +S +   ++
Sbjct: 298 GLVVNDITAASADARKVAAQVSDFAEKISARQDDIDQTITDFTQMSNKLNAASNRVDSIL 357

Query: 354 SKINNISALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVR 413
            KI+      +  SL   A+  + +FR  +E +N  +  I  NL+ FS SGL D++ LV 
Sbjct: 358 VKIDGFLGDADAPSLSAQARETLESFRRVAENLNAQLGPIAENLKRFSNSGLRDVEALVG 417

Query: 414 KLQETVNHFDDCLNNFERNPQDIVWGREKGSVKIYKPK 451
             + TV    + +++F++NPQ +++G E  +VK Y  +
Sbjct: 418 DTRRTVQSLQNTISDFDKNPQRLLFGGE--TVKQYDGR 453


>gi|227822229|ref|YP_002826200.1| putative solute-binding component of ABC transporter [Sinorhizobium
           fredii NGR234]
 gi|227341229|gb|ACP25447.1| putative solute-binding component of ABC transporter [Sinorhizobium
           fredii NGR234]
          Length = 456

 Score =  371 bits (951), Expect = e-100,   Method: Composition-based stats.
 Identities = 137/458 (29%), Positives = 239/458 (52%), Gaps = 12/458 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K  Y  VG F V ++  +F  +YW+S+  +  G M E+++ IPGS +GLS  S VRF
Sbjct: 1   METKANYAIVGFFTVFVIAAAFGFVYWMSQYGR-SGEMVELVVNIPGSANGLSVGSPVRF 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NGI VG +  L +D   P +S+A   +  D P+  ST AT+  QGL G  YIELS  RK 
Sbjct: 60  NGINVGSVRSLAIDANDPRYSIAITEVSADAPVLKSTKATLEIQGLTGAAYIELSGGRKG 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
            + I + A E   +A I A  S +   ++ A+    + + +   IQ  +  +  PLT TI
Sbjct: 120 DENILKSALENGTQARILADQSSVTSLLATADQILDRANSAIGDIQGFVTEVRGPLTATI 179

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
            N +  S  LA+N   ID+ + + Q    S         + D + S D++IK++D +K++
Sbjct: 180 GNAQRFSKALADNSDAIDQFLKSVQ--ELSGSVSAASKKLDDTLASADRLIKSVDPKKID 237

Query: 241 QILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFS---SKMKSKET 297
            I+ N++  SN+   +S  V   +   R T  T+ + G+     L       + + +++ 
Sbjct: 238 TIVSNVEDVSNDLKAASGGVSEAIAGFRRTVDTYDQFGKNAQETLKRVDALVAAVDTQKV 297

Query: 298 SAFLENIADSTSNMRSSISAIRE----ITDQRQKIISTINTIENITSNLNDSSQKFAELM 353
              + +I+ ++++ R   + + E    I+ +++ I  TI     +++ LN +S +   ++
Sbjct: 298 GLVVNDISAASADARKVAAQVSEFANKISARQEDIDQTITDFTEMSNKLNAASNRVDSIL 357

Query: 354 SKINNISALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVR 413
            K++         SL  +A+  + +FR  ++ +N  I  I +NL+ FS SGL D++ LV 
Sbjct: 358 VKVDGFLGDANAPSLSAEARSTLESFRRMADNLNAQIGPIADNLKRFSNSGLRDVETLVT 417

Query: 414 KLQETVNHFDDCLNNFERNPQDIVWGREKGSVKIYKPK 451
           + + TV      ++NF+RNPQ +++G E  +VK Y  +
Sbjct: 418 ETRRTVQSLQSTISNFDRNPQRLLFGGE--TVKQYDGR 453


>gi|325293032|ref|YP_004278896.1| ABC transporter substrate-binding protein [Agrobacterium sp. H13-3]
 gi|325060885|gb|ADY64576.1| ABC transporter, substrate binding protein [Agrobacterium sp.
           H13-3]
          Length = 456

 Score =  362 bits (928), Expect = 9e-98,   Method: Composition-based stats.
 Identities = 129/458 (28%), Positives = 252/458 (55%), Gaps = 12/458 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K  YT VG+F + ++  +F  +YW++   +  GP A++++RIPGS +GLS  S VRF
Sbjct: 1   METKANYTIVGIFTLIVIAAAFGFVYWMAEFGR-GGPTAQLVVRIPGSANGLSVGSPVRF 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NGIPVG + GL +D++ P +S+A   ++ D P++PST A +  QGL G  YIELS   K+
Sbjct: 60  NGIPVGTVRGLAIDRDDPAYSIAFTEVQADAPVFPSTRAVLEIQGLTGAAYIELSGGNKD 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
            + I Q + E    A +TA  S +   ++ A+   K+   +   +Q  +++   PLT T+
Sbjct: 120 GERILQKSVESGVPAELTADLSSVTNLLATADKILKRADGAIGELQGFVQDARGPLTQTV 179

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
            N E  S  LA N   I   + +  ++  S+  ++    +   +T+++ ++KA+D  K++
Sbjct: 180 RNAEKFSDALAANSDGIKSFIAS--LSSLSTTVQSVSVRLDGTLTAVEDLVKAVDAGKID 237

Query: 241 QILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLL---SDFSSKMKSKET 297
            IL N+   + +   +S  +   +  V+ T + F+    ++  ++    +  + +   + 
Sbjct: 238 SILSNVDKVTKDVASASSDIQGIMETVQSTARNFEAASTEVQTVVKRADELLASVDPAKV 297

Query: 298 SAFLENIADSTSNMRSSISAIREITD----QRQKIISTINTIENITSNLNDSSQKFAELM 353
           S  + +++ +T++ R +++  + I D    +R  I   ++   ++   LN +S +   ++
Sbjct: 298 STVVGDVSAATADARDAVANFKRIADDVGARRADIDQAVSDFTDMGRKLNLASSRVDGIL 357

Query: 354 SKINNISALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVR 413
           +K++ +    + NSLF  A+  + +F+  ++ +N  I  I +NL  FS SGL D Q L+ 
Sbjct: 358 AKVDGMLGTDDANSLFAKARETLTSFKAVADNLNARIGPIADNLTRFSSSGLKDFQALIG 417

Query: 414 KLQETVNHFDDCLNNFERNPQDIVWGREKGSVKIYKPK 451
             ++TV++ ++ + N +R+PQ +++G E  +VK Y  +
Sbjct: 418 STRQTVDNLNNAITNIDRDPQRLIFGGE--TVKQYDGR 453


>gi|15888955|ref|NP_354636.1| ABC transporter, substrate binding protein [Agrobacterium
           tumefaciens str. C58]
 gi|15156734|gb|AAK87421.1| ABC transporter, substrate binding protein [Agrobacterium
           tumefaciens str. C58]
          Length = 456

 Score =  361 bits (927), Expect = 1e-97,   Method: Composition-based stats.
 Identities = 129/458 (28%), Positives = 251/458 (54%), Gaps = 12/458 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K  YT VG+F + ++  +F  +YW++   +  GP A++++RIPGS +GLS  S VRF
Sbjct: 1   METKANYTIVGIFTLIVIAAAFGFVYWMAEFGR-GGPTAQLVVRIPGSANGLSVGSPVRF 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NGIPVG + GL +D++ P +S+A   ++ D P++PST A +  QGL G  YIELS   K+
Sbjct: 60  NGIPVGTVRGLAIDRDDPAYSIAFTEVQADAPVFPSTRAVLEIQGLTGAAYIELSGGNKD 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
            + I Q + E    A +TA  S +   ++ A+   K+   +   +Q  +++   PLT T+
Sbjct: 120 GERILQKSVESGVPAELTADLSSVTNLLATADKILKRADGAIGELQGFVQDARGPLTQTV 179

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
            N E  S  LA N   I   + +  ++  S+  ++    +   +T+++ ++KA+D  K++
Sbjct: 180 RNAEKFSDALAANSDGIKNFIAS--LSSLSTTVQSVSVRLDGTLTAVENLVKAVDAGKID 237

Query: 241 QILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLL---SDFSSKMKSKET 297
            IL N+   + +   +S  +   +  V+ T + F+    ++  ++    +  + +   + 
Sbjct: 238 SILSNVDKVTKDVASASSDIQGIMETVQSTARNFEAASTEVQTVVKRADELLASVDPAKV 297

Query: 298 SAFLENIADSTSNMRSSISAIREITD----QRQKIISTINTIENITSNLNDSSQKFAELM 353
           S  + +++ +T++ R +++  + I D    +R  I   ++    +   LN +S +   ++
Sbjct: 298 STVVGDVSAATADARDAVANFKRIADDVGARRADIDQAVSDFTEMGRKLNLASSRVDGIL 357

Query: 354 SKINNISALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVR 413
           +K++ +    + NSLF  A+  + +F+  ++ +N  I  I +NL  FS SGL D Q L+ 
Sbjct: 358 AKVDGMLGTDDANSLFAKARETLTSFKAVADNLNARIGPIADNLTRFSSSGLKDFQALIG 417

Query: 414 KLQETVNHFDDCLNNFERNPQDIVWGREKGSVKIYKPK 451
             ++TV++ ++ + N +R+PQ +++G E  +VK Y  +
Sbjct: 418 STRQTVDNLNNAITNIDRDPQRLIFGGE--TVKQYDGR 453


>gi|222148409|ref|YP_002549366.1| ABC transporter substrate binding protein [Agrobacterium vitis S4]
 gi|221735397|gb|ACM36360.1| ABC transporter substrate binding protein [Agrobacterium vitis S4]
          Length = 455

 Score =  360 bits (924), Expect = 3e-97,   Method: Composition-based stats.
 Identities = 138/458 (30%), Positives = 255/458 (55%), Gaps = 13/458 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K  YT VGLF + ++  +F  +YW++   +  GPM+ + IRIPGS +GLS  S VRF
Sbjct: 1   METKANYTIVGLFTLLVILAAFGFVYWMAEYGR-GGPMSPLTIRIPGSANGLSVGSPVRF 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NGI +G +V L +D++ P  S+A+  ++ D P+  +T A +  QGL G  Y+E+S     
Sbjct: 60  NGIQIGSVVSLSIDRDDPAFSIAETQVQQDAPIRSNTKAALEVQGLTGAAYVEMSGGVGG 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
              + + A E  + A++ A  S +   ++ A+   K+  D+  ++Q  + +   PLT T+
Sbjct: 120 D-DLLKKAQETGKTAVLVADQSSLTNLLATADKIMKRADDAIANVQGFVADARGPLTNTM 178

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
            N ET S  LA+N   ID  + +  V+  S         +   + + + ++KA+D  KVN
Sbjct: 179 RNAETFSKALADNADGIDTFLKS--VSALSDTITGLSGRLDSTLAAAEDLLKAVDRNKVN 236

Query: 241 QILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSS---KMKSKET 297
           QIL N +  +     +SD+V   V +   T +TF + G K +  L   ++    + +++ 
Sbjct: 237 QILTNAETFTGKIADASDKVGVAVDNFSATAKTFNDFGVKAEGTLGQVNALIAAIDTQKV 296

Query: 298 SAFLENIADSTSNMRSSISAIREIT----DQRQKIISTINTIENITSNLNDSSQKFAELM 353
           S  +++++ + ++ RS+ + ++ +T    D++  I   I+    +++ LN++S +   ++
Sbjct: 297 SRVVDDVSVAVTDARSAAANVQSVTETFKDRKPDIDQAISDFTQLSNRLNNASTRVDGIL 356

Query: 354 SKINNISALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVR 413
           +K++ +    + NSL  +A+R + + R  ++ +N+ I  I +NL  FS SGL DIQ LV 
Sbjct: 357 AKVDALLGSDDTNSLSAEAKRTLQSIRAVADNLNQKIGPIADNLSKFSSSGLKDIQTLVN 416

Query: 414 KLQETVNHFDDCLNNFERNPQDIVWGREKGSVKIYKPK 451
             + TV + DD ++NF+R+PQ +++G +  +VK Y  +
Sbjct: 417 DTRSTVKNLDDTISNFDRDPQRLIFGGD--NVKQYDGR 452


>gi|260463970|ref|ZP_05812166.1| Mammalian cell entry related domain protein [Mesorhizobium
           opportunistum WSM2075]
 gi|259030345|gb|EEW31625.1| Mammalian cell entry related domain protein [Mesorhizobium
           opportunistum WSM2075]
          Length = 457

 Score =  330 bits (847), Expect = 2e-88,   Method: Composition-based stats.
 Identities = 109/458 (23%), Positives = 218/458 (47%), Gaps = 11/458 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++  Y  VG+F +  +  +F  +YW +      G    + +RIPGS  GL   S V F
Sbjct: 1   METRANYVIVGIFTLVAILAAFGFVYWTAAIGD-RGETTLLRVRIPGSASGLGRGSFVLF 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NG+ VG +  +++D + P  ++A   I   TP+  ST A I   GL G   IEL     +
Sbjct: 60  NGVKVGDVKRVYIDVDNPTVAIADTEIDRMTPITKSTQADIGLAGLTGQANIELKGADPK 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
           +  +   A +  + A I A PS +   +  A+N   +       ++   +++  PLT T+
Sbjct: 120 EVKLLDQAEKEGKVAEIVANPSAVTNLLQTAQNIFNRADKVLSELEGFTKDVRGPLTQTV 179

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
            N++T S  LA N   IDK + +  V+  S + K     +   + + + ++ A+D  K+ 
Sbjct: 180 KNVQTFSDALAKNSDGIDKFLSS--VSALSDELKGVSGKLDGTLKAAEGLLNAVDKDKIK 237

Query: 241 QILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSS---KMKSKET 297
            I+ N+   + N  ++S Q+   + +V     +  +  ++    L+        +   + 
Sbjct: 238 SIVANVDTVTANLKQTSQQLDGVIKNVDTAVGSVNDFAKQTQGTLAKVDGVLDGIDPAQV 297

Query: 298 SAFLENIADSTSNMRSSISAIREIT----DQRQKIISTINTIENITSNLNDSSQKFAELM 353
              L NI  ++ N   + + I  +T    ++   I  TI   + +   LND+S +   ++
Sbjct: 298 RTALANIQKASENANKAAADIAVVTNKFANRADDIDQTIKDAKQLARRLNDASVRVDGIL 357

Query: 354 SKINNISALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVR 413
           ++++ +    + + +  DA+  + +F+  ++ +N  +  I +NL  FS  GL +++ LV+
Sbjct: 358 ARVDKLLGSGQADGVMADARATLKSFKQVADTLNARLGVITDNLARFSGQGLTNVEALVQ 417

Query: 414 KLQETVNHFDDCLNNFERNPQDIVWGREKGSVKIYKPK 451
             + ++N  ++ + +  RNPQ I+ G + G V+ +  +
Sbjct: 418 DSRRSINRIEEAVTDLSRNPQRILSGGD-GEVRQFDGR 454


>gi|13470957|ref|NP_102526.1| hypothetical protein mll0798 [Mesorhizobium loti MAFF303099]
 gi|14021700|dbj|BAB48312.1| mll0798 [Mesorhizobium loti MAFF303099]
          Length = 457

 Score =  330 bits (845), Expect = 3e-88,   Method: Composition-based stats.
 Identities = 110/458 (24%), Positives = 218/458 (47%), Gaps = 11/458 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++  Y  VG+F +  +  +F  +YW +      G    + +RIPGS  GL   S V F
Sbjct: 1   METRANYVIVGIFTLVAILAAFGFVYWTAAIGD-RGETTLLRVRIPGSASGLGRGSFVLF 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NG+ VG +  +++D + P  ++A   I   TP+  ST A I   GL G   IEL     +
Sbjct: 60  NGVKVGDVKRVYIDVDNPTVAIADTEIDRLTPITKSTQADIGLAGLTGQANIELKGADPK 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
           +  +   A +  + A I A PS +   +  A+N   +       ++    ++  PLT T+
Sbjct: 120 EVKLLDQAEKEGKVAEIVANPSAVTNLLQTAQNIFSRADKVLSELEGFTRDVRGPLTQTV 179

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
            N++T S  LA N   IDK + +  V+  S + K     +   + + + ++ A+D  K+ 
Sbjct: 180 QNVQTFSDALAKNSDGIDKFLSS--VSALSEELKGVSGKLDGTLKAAEGLLNAVDRDKIK 237

Query: 241 QILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSS---KMKSKET 297
            I+ N+   + N  ++S Q+   + +V     +  +  ++    L+        +   + 
Sbjct: 238 SIVANVDTVTANLKQTSQQLDGVIKNVDTAVGSVNDFAKQTQGTLAKVDGVLDGVDPAQV 297

Query: 298 SAFLENIADSTSNMRSSISAIREIT----DQRQKIISTINTIENITSNLNDSSQKFAELM 353
            A L NI  ++ N   + + I  +T    ++   I  TI   + +   LND+S +   ++
Sbjct: 298 RAALANIQKASENANKAAADIAVVTEKFANRADDIDQTIKDAKQLAQRLNDASVRVDGIL 357

Query: 354 SKINNISALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVR 413
           ++++ +    + + L  DA+  + +F+  ++ +N  +  I +NL  FS  GL++++ LV+
Sbjct: 358 ARVDTLLGSGQADGLMADARDTLKSFKQVADTLNARLGVITDNLARFSGQGLSNVEALVQ 417

Query: 414 KLQETVNHFDDCLNNFERNPQDIVWGREKGSVKIYKPK 451
             + ++   ++ + +  RNPQ I+ G + G V+ +  +
Sbjct: 418 DSRRSITRIEEAVTDLSRNPQRILSGGD-GEVRQFDGR 454


>gi|110633895|ref|YP_674103.1| hypothetical protein Meso_1542 [Mesorhizobium sp. BNC1]
 gi|110284879|gb|ABG62938.1| Mammalian cell entry related protein [Chelativorans sp. BNC1]
          Length = 458

 Score =  320 bits (819), Expect = 4e-85,   Method: Composition-based stats.
 Identities = 113/460 (24%), Positives = 221/460 (48%), Gaps = 14/460 (3%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K  Y  VG+F +  +  +F  +YW +     +   A +  RIPGS  GL T S+V F
Sbjct: 1   METKANYVIVGIFTIVAILAAFGFVYWTAGVGN-NSNTAPIRFRIPGSAAGLVTGSAVLF 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLA-GITYIELSTLRK 119
           NG+ VG +  ++LD   P  ++A A +    P+ PST A +    L  G   I+L+    
Sbjct: 60  NGVRVGTVERVYLDGNNPGIAIADARVDRTAPITPSTKADVGLASLTTGQANIDLTGGNP 119

Query: 120 EKKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTT 179
           ++  +  +A E+   A++TA PS ++  + +A++   +       ++  + +   PLT T
Sbjct: 120 QEPKLITLAEEQGTIAVMTANPSAVSNLLQSAQSLMSRADSVVGELENFVSDARGPLTQT 179

Query: 180 IANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKV 239
           + N+E  S  LA N   ID  +    V   S         +   ++S +++I ++D  ++
Sbjct: 180 VRNVEAFSNALARNSEGIDNFL--ANVGELSESISGVSGQLESTLSSAEELINSVDRNEI 237

Query: 240 NQILENIQVSSNNFVKSSDQ-------VINTVHDVRETTQTFQEVGQKIDHLLSDFSSKM 292
           ++I+EN+   +      S Q       V + +  +   +    E  Q++D L++      
Sbjct: 238 SKIVENLGTFTERLGDVSGQFDTIATGVNDALGSLSSFSTQAGETLQRVDRLVAGIDPDQ 297

Query: 293 KSKETSAFLENIADSTSNMRSSISAIRE-ITDQRQKIISTINTIENITSNLNDSSQKFAE 351
            ++  S F E  + + +   + I+ + E ++D+   I   I     + S LN +S +   
Sbjct: 298 LTETLSNF-EEASQAINKASAEIAEVAETVSDRTDDIDQFITDARELASRLNAASVRVDG 356

Query: 352 LMSKINNISALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNL 411
           +++K++ +    E   LF +A   +  FR T++ +N  +  I + L  FS  GL D++ L
Sbjct: 357 VLAKLDGMLGSGEGQDLFAEASSTLRAFRQTADTLNARLGPITDGLTRFSGQGLRDVEAL 416

Query: 412 VRKLQETVNHFDDCLNNFERNPQDIVWGREKGSVKIYKPK 451
           V   +  ++  +  +++ E+NPQ I+ G + G+++ Y  +
Sbjct: 417 VGDARRAISRIESAVSDLEQNPQRIITGGD-GTIRRYDGR 455


>gi|319783793|ref|YP_004143269.1| hypothetical protein Mesci_4106 [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317169681|gb|ADV13219.1| Mammalian cell entry related domain protein [Mesorhizobium ciceri
           biovar biserrulae WSM1271]
          Length = 457

 Score =  317 bits (812), Expect = 2e-84,   Method: Composition-based stats.
 Identities = 107/458 (23%), Positives = 220/458 (48%), Gaps = 11/458 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++  Y  VG+F ++ +  +F  +YW +      G    + +RIPGS  GL   S V F
Sbjct: 1   METRANYVIVGIFTLAAILAAFAFVYWTAAIGD-KGETTLLRVRIPGSASGLGRGSFVLF 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NG+ VG +  +++D + P  ++A   I   TP+  ST A I   GL G   IEL     +
Sbjct: 60  NGVKVGDVKRVYIDVDNPTVAIADTEIDRMTPITKSTQADIGLAGLTGQANIELKGADPK 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
           +  +   A +  + A I A PS +   +  A+N   +       ++   +++  PLT T+
Sbjct: 120 EVKLLDQAEKEGKVAEIVANPSAVTNLLQTAQNIFTRADKVLTELEGFTKDVRGPLTQTV 179

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
            N++T S  LA N   IDK +     +  + + K     +   + + + ++ A+D  K+ 
Sbjct: 180 QNVQTFSDALAKNSDGIDKFLSAA--STLADELKGVSGKLDGTLKAAEGLLNAVDKDKIK 237

Query: 241 QILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLL---SDFSSKMKSKET 297
            I+ N+   + N  ++S Q+   + +V     +  +  ++    L    +    +   + 
Sbjct: 238 SIVANVDAVTGNLKETSKQLDGVIKNVDTAVGSVNDFAKRTQGTLAKVDNVLDGIDPAQV 297

Query: 298 SAFLENIADSTSNMRSSISAIREIT----DQRQKIISTINTIENITSNLNDSSQKFAELM 353
            + L NI  ++ +   + + I E+T    ++   I  TI   + +   LND+S +   ++
Sbjct: 298 RSALANIQKASESADKAAADIAEVTHKFANRADDIDQTIKDAKQLAQRLNDASVRVDGIL 357

Query: 354 SKINNISALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVR 413
           +K++ +    + + +  DA+  + +F+  ++ +N  +  I +NL  FS  GL++++ LV+
Sbjct: 358 AKVDTLLGSGQADGVMADARATLKSFKQVADTLNARLGVITDNLARFSGQGLSNVEALVQ 417

Query: 414 KLQETVNHFDDCLNNFERNPQDIVWGREKGSVKIYKPK 451
             + +++  ++ + +  RNPQ I+ G + G V+ +  +
Sbjct: 418 DSRRSISRIEEAVTDLSRNPQRILSGGD-GEVRQFDGR 454


>gi|328543114|ref|YP_004303223.1| ABC transporter, substrate binding protein [Polymorphum gilvum
           SL003B-26A1]
 gi|326412860|gb|ADZ69923.1| ABC transporter, substrate binding protein [Polymorphum gilvum
           SL003B-26A1]
          Length = 549

 Score =  273 bits (699), Expect = 3e-71,   Method: Composition-based stats.
 Identities = 102/552 (18%), Positives = 199/552 (36%), Gaps = 109/552 (19%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++  Y  +G FV+ ILF +F  IYWL+ +         V +  PG V GL     V F
Sbjct: 1   METRANYVLIGGFVLGILFAAFVFIYWLAATVDSRQS-VNVKVIFPGPVTGLPIGGQVLF 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NGI +G +  L  DQ  P   +A   + P+ PL     AT+  QGL G+ Y++L     E
Sbjct: 60  NGIKIGDVGSLDFDQTDPQVVIATIRVNPNAPLRRDIRATLGFQGLTGVAYVDLKGGSTE 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
              + Q   E     +I A  S  +  + N  +  KK   +   +  +++     ++  +
Sbjct: 120 TPLLIQPDMESE--PVIYADRSFFDDILENGRDVLKKADTTLDTLNSVLQESRPAISEIV 177

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
            N+ET S  LA N   ++  M +      +  S      +  L+   ++++ A+   KV 
Sbjct: 178 RNVETFSKALAENADGVEGFMASVGKATEAFSS--LSGRMEGLVEQGERILAAVPSDKVE 235

Query: 241 QILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMK------- 293
           +++ N+   + +  + +  +   V +    T   Q+  ++++  +    + +K       
Sbjct: 236 EMVGNVTDFTASLKEIAPDIRQMVAEAESATANLQQFTERLNAGMDGVEAVIKAVRPEDV 295

Query: 294 -----------------SKETSAFLENIADSTSNMRSSISAIREITD------------- 323
                            S E    + +  ++  N+RS  S+IR   +             
Sbjct: 296 EKAVAGAGALGAVLEKRSAELDTLIASTGETMDNIRSVSSSIRAREEDISAFIAGARDVV 355

Query: 324 -----------------QRQKIISTINTIENITSNLNDSSQKFAELMSKINNISALKENN 366
                              QK+ + + ++E +T  L+   +     ++   N +   E  
Sbjct: 356 GKIGTGVERTTEVVQAIDPQKVSNIVASVEEVTGKLSGQGEAIEATIASARNAAGTIEKM 415

Query: 367 S------------LFKDAQRAMHTFRDTSEKINRYIPS---------------------- 392
           S            +  DA++        S +++  +                        
Sbjct: 416 SADLSARTADVDQIITDAKQIATNLNAASARVDEIVSKVGTMVDGDGEGFIVEATRAAEA 475

Query: 393 --------------IGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFERNPQDIVW 438
                         I + L  F+  G  D+   + ++  T       + NF+RNP  +++
Sbjct: 476 IRKVAEAFESRADGIASGLSKFANQGTADLTAALGQVNRTFVSIQRAVENFDRNPNRVIF 535

Query: 439 GREKGSVKIYKP 450
           G E   V  +  
Sbjct: 536 GGED--VPRFGG 545


>gi|218458932|ref|ZP_03499023.1| putative ABC transporter, substrate-binding protein [Rhizobium etli
           Kim 5]
          Length = 296

 Score =  253 bits (647), Expect = 3e-65,   Method: Composition-based stats.
 Identities = 103/298 (34%), Positives = 164/298 (55%), Gaps = 3/298 (1%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K  YT VG F V ++  +F  +YW++   +  GPM E+I+RIPGS +GLS  S VRF
Sbjct: 1   METKANYTIVGFFTVLVIAAAFGFVYWMAEYGR-GGPMTELIVRIPGSANGLSVGSPVRF 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NGI +G +  L +D + P +SLA   +R D P+YPST A +  QGL G  YIELS  RK 
Sbjct: 60  NGIQIGSVQTLSIDADDPQYSLAFTQVRTDAPIYPSTKAALEIQGLTGAAYIELSGGRKG 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
           +++I Q A + N+RA+I A  S +   ++ A+    + +D+   +Q  IE+   PLT T 
Sbjct: 120 EESILQHAIDNNKRAVIVADQSSVTNLLATADKILDRANDAVGELQGFIEDSRAPLTQTF 179

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
            N ET S  LA N  +ID  + +  V   S   K     +   + +++ ++KA+D QK++
Sbjct: 180 KNAETFSDALAKNSDNIDAFLQS--VGELSDTVKAVSGRVDSTLQAVESLVKAVDAQKID 237

Query: 241 QILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETS 298
           +I+ N +  + N   +S  +   +    ET  TF + G++    L    + +   + +
Sbjct: 238 RIVSNAERITANVADASGDLRGAIQKFDETATTFNDFGKQAQATLDRVDTLVAQIDPA 295


>gi|260430756|ref|ZP_05784728.1| mammalian cell entry related domain protein [Silicibacter
           lacuscaerulensis ITI-1157]
 gi|260418197|gb|EEX11455.1| mammalian cell entry related domain protein [Silicibacter
           lacuscaerulensis ITI-1157]
          Length = 438

 Score =  250 bits (639), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 75/458 (16%), Positives = 186/458 (40%), Gaps = 31/458 (6%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++  Y  +G F ++ +  +F    WL++  +     A   +    +V GLS    V +
Sbjct: 1   METRANYILIGAFTLAGILSAFGFFLWLAKF-EVTRQYAYYDVLFD-NVSGLSAAGGVSY 58

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NG+PVG+++ L LD + P+    +  I  D P+   T A +++ G+ G++Y+ELS    +
Sbjct: 59  NGLPVGQVIALDLDDDDPSKVRVRLEIDADIPVTTDTIAQLQSLGVTGVSYVELSGGSPD 118

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKII-ENIEKPLTTT 179
            + +        Q ++I +  S I      A     +      ++  ++ ++  K +   
Sbjct: 119 AERLP-------QFSVIKSKRSAIQSLFEGAPKVLDEAVTLLENLNAVVDDDNRKAVADI 171

Query: 180 IANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAI----- 234
           + N+ + S  L   ++  + +  +  +   + +       +  L  + +  +        
Sbjct: 172 LDNLASASGRLDKTLTDFETL--SGDLGGAAKEIGAFTKRLDTLADTAETTLTTGTETLD 229

Query: 235 DLQKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKS 294
            ++      +     +N  + ++DQV+    D+R       E+  ++  L  + S  M +
Sbjct: 230 SIKTAADSAKTALDGANKTLATADQVLE--QDIRPFIARGSELADRLIGLSDEASVTMAT 287

Query: 295 KETS-----AFLENIADSTSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKF 349
             T+       L+++  +    + ++++     D   +++     +  + +++  ++ + 
Sbjct: 288 VNTTFQNANQTLDSVTSAMEAAKGTLTSAERAFDSANRVMD--EDVATVAADIRTAANQV 345

Query: 350 AELMSKINNISALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQ 409
           AE +S +      +  +++  D   A  +  D    I+  +      + +F + GL    
Sbjct: 346 AETVSNV-----TQRIDAISADILSASQSASDLLGTIDGIVQQNRRQVSDFLRVGLPQFV 400

Query: 410 NLVRKLQETVNHFDDCLNNFERNPQDIVWGREKGSVKI 447
             V + Q  V   D  ++  ER+P   + G +    + 
Sbjct: 401 RFVEESQRLVISLDRLVDKVERDPARFLLGTQASEFRQ 438


>gi|254512617|ref|ZP_05124683.1| mammalian cell entry related domain protein [Rhodobacteraceae
           bacterium KLH11]
 gi|221532616|gb|EEE35611.1| mammalian cell entry related domain protein [Rhodobacteraceae
           bacterium KLH11]
          Length = 438

 Score =  248 bits (632), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 75/460 (16%), Positives = 186/460 (40%), Gaps = 35/460 (7%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++  Y  +G F ++ +  +F    WL++  +     A   +    +V GLS    V +
Sbjct: 1   METRANYILIGAFTLAGILGAFGFFLWLAKF-EVTRQYAYYDVLFD-NVSGLSAAGGVNY 58

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NG+PVG+++ L LD++ P+    +  +  D P+   T A +++ G+ G+ Y+ELS     
Sbjct: 59  NGLPVGQVISLNLDEDDPSKVRVRLEVDADIPVTKQTIAQLQSLGVTGVAYVELSGGSPT 118

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKII-ENIEKPLTTT 179
            + +        Q ++I +  S I   +  A    ++      ++  ++ +N  K ++  
Sbjct: 119 AERLA-------QNSVIPSKRSSIQSLLEGAPEVLEQAVTLLENLNSVVDDNNRKAVSDI 171

Query: 180 IANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAI----- 234
           + N+   S  L   ++    +  ++ +   + D       +  L  + +  +        
Sbjct: 172 LNNLAGASGKLDKTLADFQSL--SSDLGGAAKDIGAFTKRLDTLADTAETTLTTGTDTLK 229

Query: 235 DLQKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKS 294
            +++ ++  +    ++N  ++++++ +    D+R   +   ++   +  L    S  + +
Sbjct: 230 SVKQASEAAKTALETANGTLQTAEETLQ--QDIRPFVERGSKLADHLIVLSEQGSLALGT 287

Query: 295 -----KETSAFLENIADSTSNMRSSISAIREITDQRQKII--STINTIENITSNLNDSSQ 347
                   +  L +I  +    ++++++     D   +++     +  E+I    N  + 
Sbjct: 288 ITETFTNANTTLASIDSAMEAAKATLASAESAFDAANRVMDQDIASVAEDIRKAANQVAA 347

Query: 348 KFAELMSKINNISALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLND 407
             A +  KI+ IS          D   A  +  D    I+  +      + +F + GL+ 
Sbjct: 348 TVANVTEKIDKIS---------DDILSASQSASDLLGTIDGIVQDNRRQVSDFLRVGLSQ 398

Query: 408 IQNLVRKLQETVNHFDDCLNNFERNPQDIVWGREKGSVKI 447
               + + Q  V   D  ++  ER+P   + G +    + 
Sbjct: 399 FVRFIEESQRLVISLDRLVDKVERDPARFLLGTQASEFRQ 438


>gi|170748372|ref|YP_001754632.1| hypothetical protein Mrad2831_1954 [Methylobacterium radiotolerans
           JCM 2831]
 gi|170654894|gb|ACB23949.1| Mammalian cell entry related domain protein [Methylobacterium
           radiotolerans JCM 2831]
          Length = 360

 Score =  243 bits (619), Expect = 6e-62,   Method: Composition-based stats.
 Identities = 95/455 (20%), Positives = 169/455 (37%), Gaps = 98/455 (21%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++  Y  +G F ++++   F ++ WLS  +        V I   GSV GLS  SSV F
Sbjct: 1   METRANYALIGAFTIAVILAGFGTVLWLSGGSSRQVSQ-LVRIVFSGSVGGLSRGSSVNF 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NGI VG +  + L  + P   LA   + P TPL   T A + +  L G++ I LS    +
Sbjct: 60  NGIKVGEVTDIRLAPQDPRRVLATIKVDPATPLRADTRARLDSAMLTGVSVISLSGGNAD 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
              +  +A    +   I A  S +   ++ A   +++  D    + +++   E  +  ++
Sbjct: 120 APVLTPMA--NGEPPTIFADSSDMQDMMALARQVAQRADDMLARLDRLVSANEGAINRSL 177

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
           AN+ET S  LA+   +I                                ++KA+D  K+ 
Sbjct: 178 ANVETFSKTLADAGPNISA------------------------------LVKAVDGAKLG 207

Query: 241 QILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSD---FSSKMKSKET 297
           ++++N    S    K+S  +   +HD R           KID +L+    F      +E 
Sbjct: 208 RVIDNADRFSAALSKASPDIEAGLHDARLLAGKLSASADKIDAVLNGAESFLGSASGQEG 267

Query: 298 SAFLENIADSTSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKIN 357
           S+    I  +  ++R +  A R +++   K  ++I             S  F  L     
Sbjct: 268 SSTFAEIRAAAISVRDAGKAFRTMSENLDKRTASI-------------SANFGRLSG--- 311

Query: 358 NISALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQE 417
             +  +E  +L  D QR + T                                       
Sbjct: 312 --TGRREVEALSGDGQRTLSTLN------------------------------------- 332

Query: 418 TVNHFDDCLNNFERNPQDIVWGREKGSVKIYKPKH 452
                   + + ER+P  +++G +  S+  Y    
Sbjct: 333 ------RTVRSLERDPSQVIFGGKP-SLPEYNGGR 360


>gi|163850326|ref|YP_001638369.1| hypothetical protein Mext_0893 [Methylobacterium extorquens PA1]
 gi|254559577|ref|YP_003066672.1| ABC transporter periplasmic protein [Methylobacterium extorquens
           DM4]
 gi|163661931|gb|ABY29298.1| Mammalian cell entry related domain protein [Methylobacterium
           extorquens PA1]
 gi|254266855|emb|CAX22654.1| putative ABC transporter, periplasmic protein [Methylobacterium
           extorquens DM4]
          Length = 360

 Score =  243 bits (619), Expect = 6e-62,   Method: Composition-based stats.
 Identities = 93/455 (20%), Positives = 176/455 (38%), Gaps = 98/455 (21%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++  Y  +G F + ++  +F  ++WL   ++     A + I   GSV GL+  S+V F
Sbjct: 1   METRANYVLIGAFTIGVVLAAFGFVFWLQGGSRGQATQA-LRIVFSGSVGGLAKGSTVSF 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NGI VG  + + L  + P   +A   + P TPL   T A + +  L G++ I LS    +
Sbjct: 60  NGIKVGEALDVRLLPQDPRRVVAIVQVDPSTPLRADTRARLDSAMLTGVSQIALSGGSAD 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
              +       ++   I A  S I   ++ A+  +++  D  + + K++   E  +T T+
Sbjct: 120 APALT--PGSGDKMPTIFADSSDIQDMMAAAKQIAQRADDVLQRLDKVVAGNEGAITRTL 177

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
           AN+E+ S  LA                              +   S+  ++K++D Q++N
Sbjct: 178 ANVESFSKTLA------------------------------EAGPSIAGLVKSVDGQRLN 207

Query: 241 QILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLL---SDFSSKMKSKET 297
           +++EN +  S     SS  +   +HD R           KID +L     F      ++ 
Sbjct: 208 RVIENAETFSTALANSSGDIQAGLHDARSLAAKLNASADKIDGVLKGAEGFLGSASGQQG 267

Query: 298 SAFLENIADSTSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKIN 357
           +     I ++  ++R +  A R +++   K  + I+T  N    L+ +S++         
Sbjct: 268 AGTFAEIREAAISVRDAGRAFRALSENLDKRTANISTSFN---RLSGTSRR--------- 315

Query: 358 NISALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQE 417
                 E  +L  D QR ++T                                       
Sbjct: 316 ------EVEALSSDGQRTLNTLSR------------------------------------ 333

Query: 418 TVNHFDDCLNNFERNPQDIVWGREKGSVKIYKPKH 452
                     + ER+P  +++G +  S+  Y    
Sbjct: 334 -------AARSLERDPSQVIFGGKP-SLPEYNGGR 360


>gi|188580087|ref|YP_001923532.1| Mammalian cell entry related domain protein [Methylobacterium
           populi BJ001]
 gi|179343585|gb|ACB78997.1| Mammalian cell entry related domain protein [Methylobacterium
           populi BJ001]
          Length = 360

 Score =  242 bits (618), Expect = 7e-62,   Method: Composition-based stats.
 Identities = 92/455 (20%), Positives = 174/455 (38%), Gaps = 98/455 (21%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++  Y  +G F + ++  +F  ++WL   ++     A + I   GSV GL+  S+V F
Sbjct: 1   METRANYVLIGAFTIGVVLAAFGFVFWLQGGSRGQATQA-LRIVFSGSVGGLAKGSTVSF 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NGI VG  + + L  + P   +A   + P TPL   T A + +  L G++ I LS    +
Sbjct: 60  NGIKVGEALDVRLLPQDPRRVVAVVQVDPSTPLRADTRARLDSAMLTGVSQIALSGGSAD 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
              +       ++   I A  S I   ++ A+  +++  D  + + K++   E  +  T+
Sbjct: 120 APALT--PGSGDKMPTIFADSSDIQDMMAAAKQIAQRADDVLQRLDKVVAGNEGAINRTL 177

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
           AN+E  S  LA                              +   S+  ++K++D Q++N
Sbjct: 178 ANVEAFSKTLA------------------------------EAGPSIAGLVKSVDGQRLN 207

Query: 241 QILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLL---SDFSSKMKSKET 297
           +++EN    S     SS  +   +HD RE          +ID +L     F      ++ 
Sbjct: 208 RVIENADTFSTALANSSPDIEAGLHDARELAAKLSASADRIDGVLKGAEGFLGSASGQQG 267

Query: 298 SAFLENIADSTSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKIN 357
           +     I ++  ++R +  A R +++   K  + I+T  N    L+ +S++         
Sbjct: 268 AGTFAEIREAAISVRDAGKAFRTLSENLDKRTANISTSFN---RLSGTSRR--------- 315

Query: 358 NISALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQE 417
                 E  +L  D QR ++T                                       
Sbjct: 316 ------EVEALSSDGQRTLNTLSR------------------------------------ 333

Query: 418 TVNHFDDCLNNFERNPQDIVWGREKGSVKIYKPKH 452
                     + ER+P  +++G +  S+  Y    
Sbjct: 334 -------AARSLERDPSQVIFGGKP-SLPEYNGGR 360


>gi|330806717|ref|YP_004351179.1| hypothetical protein PSEBR_a55 [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
 gi|327374825|gb|AEA66175.1| Conserved hypothetical protein [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
          Length = 312

 Score =  242 bits (618), Expect = 8e-62,   Method: Composition-based stats.
 Identities = 67/305 (21%), Positives = 135/305 (44%), Gaps = 24/305 (7%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++ ++  +GLF V ++  +     WL++SN  D       +    +V GLS  SSV +
Sbjct: 1   METRAHHVLIGLFTVIVVAGALLFGLWLAKSN-VDSEFKYYEVVFNEAVSGLSRGSSVEY 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           +GI VG +V L LD   P   LA+  +  +TP+   T A +   G+ G + I+LS    +
Sbjct: 60  SGIKVGDVVNLRLDPNDPRRVLARVRLSGETPVKQDTQAKLALTGITGTSIIQLSGGTPQ 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKII-ENIEKPLTTT 179
              +        +  +I A PS I   ++N+++    I+    +  ++   +  + L  T
Sbjct: 120 SPVLT---GHDGEPPVIIAAPSPIARLLNNSDDLMTSINLLLHNANEVFSSDNVQSLGKT 176

Query: 180 IANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQ-- 237
           + ++E  + V+A     I + M   Q+      +  T    T L+ + + ++     Q  
Sbjct: 177 LEHLEQTTGVIAEQRGDIRQAMQ--QLASIGKQASATLEQTTALMRNANGLLNDQGKQAF 234

Query: 238 ---------------KVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKID 282
                           ++++L + + S NN ++  + +   V ++RET    + + +++D
Sbjct: 235 GNAGQAMQSLARSTATLDKLLNDNRDSLNNGMQGLNALAPAVRELRETLSALRGISRRLD 294

Query: 283 HLLSD 287
              S 
Sbjct: 295 ANPSG 299



 Score = 59.0 bits (141), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 29/169 (17%), Positives = 68/169 (40%), Gaps = 2/169 (1%)

Query: 274 FQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNMRSSISAIREITDQRQKIISTIN 333
              +    D L++  +  + +       +N+      +         I +QR  I   + 
Sbjct: 140 IARLLNNSDDLMTSINLLLHNANEVFSSDNVQSLGKTLEHLEQTTGVIAEQRGDIRQAMQ 199

Query: 334 TIENITSNLNDSSQKFAELMSKINNISALKENNSLFKDAQRAMHTFRDTSEKINRYIPSI 393
            + +I    + + ++   LM   N +   +   + F +A +AM +   ++  +++ +   
Sbjct: 200 QLASIGKQASATLEQTTALMRNANGLLNDQGKQA-FGNAGQAMQSLARSTATLDKLLNDN 258

Query: 394 GNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFERNPQDIVWGREK 442
            ++L N    GLN +   VR+L+ET++         + NP   + G +K
Sbjct: 259 RDSLNN-GMQGLNALAPAVRELRETLSALRGISRRLDANPSGYLLGNDK 306


>gi|218528883|ref|YP_002419699.1| hypothetical protein Mchl_0853 [Methylobacterium chloromethanicum
           CM4]
 gi|240137397|ref|YP_002961868.1| putative ABC transporter, periplasmic protein [Methylobacterium
           extorquens AM1]
 gi|218521186|gb|ACK81771.1| Mammalian cell entry related domain protein [Methylobacterium
           chloromethanicum CM4]
 gi|240007365|gb|ACS38591.1| putative ABC transporter, periplasmic protein [Methylobacterium
           extorquens AM1]
          Length = 360

 Score =  242 bits (617), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 92/455 (20%), Positives = 175/455 (38%), Gaps = 98/455 (21%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++  Y  +G F + ++  +F  ++WL   ++     A + I   GSV GL+  S+V F
Sbjct: 1   METRANYVLIGAFTIGVVLAAFGFVFWLQGGSRGQATQA-LRIVFSGSVGGLAKGSTVSF 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NGI VG  + + L  + P   +A   + P TPL   T A + +  L G++ I LS    +
Sbjct: 60  NGIKVGEALDVRLLPQDPRRVVAIVQVDPSTPLRADTRARLDSAMLTGVSQIALSGGSAD 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
              +       ++   I A  S I   ++ A+  +++  D  + + K++   E  +  T+
Sbjct: 120 APALT--PGSGDKMPTIFADSSDIQDMMAAAKQIAQRADDVLQRLDKVVAGNEGAINRTL 177

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
           AN+E+ S  LA                              +   S+  ++K++D Q++N
Sbjct: 178 ANVESFSKTLA------------------------------EAGPSIAGLVKSVDGQRLN 207

Query: 241 QILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLL---SDFSSKMKSKET 297
           +++EN +  S     SS  +   +HD R           KID +L     F      ++ 
Sbjct: 208 RVIENAETFSTALANSSGDIQAGLHDARSLAAKLNASADKIDGVLKGAEGFLGSASGQQG 267

Query: 298 SAFLENIADSTSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKIN 357
           +     I ++  ++R +  A R +++   K  + I+T  N    L+ +S++         
Sbjct: 268 AGTFAEIREAAISVRDAGRAFRALSENLDKRTANISTSFN---RLSGTSRR--------- 315

Query: 358 NISALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQE 417
                 E  +L  D QR ++T                                       
Sbjct: 316 ------EVEALSSDGQRTLNTLSR------------------------------------ 333

Query: 418 TVNHFDDCLNNFERNPQDIVWGREKGSVKIYKPKH 452
                     + ER+P  +++G +  S+  Y    
Sbjct: 334 -------AARSLERDPSQVIFGGKP-SLPEYNGGR 360


>gi|146280486|ref|YP_001170639.1| ABC transporter permease [Pseudomonas stutzeri A1501]
 gi|145568691|gb|ABP77797.1| ABC transporter permease [Pseudomonas stutzeri A1501]
          Length = 312

 Score =  242 bits (616), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 67/306 (21%), Positives = 137/306 (44%), Gaps = 24/306 (7%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++ ++  +GLF V  +  +     WL +S+  D       I    +V GLS  S+V +
Sbjct: 1   METRAHHVLIGLFTVLAVGGALLFALWLGKSS-MDREYNYYEISFNRAVSGLSNGSAVEY 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           +GI VG +  L+L+ + P    A+  I   TP+   T A +    + G   I+L +   +
Sbjct: 60  SGIKVGDVEALWLEPDDPRKVRARIRIYSGTPIKQDTRARLALANITGSMIIQLHSGTPQ 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKII-ENIEKPLTTT 179
              +     +R +  +I A PS ++  + N E+    I++  R    ++ E+    +  T
Sbjct: 120 SPPL---EGKRGEPPLIIADPSPLSALLENGEDLMTNINNLLRSANLMLSEDNAGRIGRT 176

Query: 180 IANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQ-- 237
           +AN+E  ++VLA     + + +  TQ++     +      IT L  + + +I     Q  
Sbjct: 177 LANLEQATSVLAEQRGDLSEAL--TQLSQLGQQTNTALAEITRLTQNANGLIDDEGRQLL 234

Query: 238 ---------------KVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKID 282
                          +++++L + Q + NN ++   ++   ++++R T    + V Q+++
Sbjct: 235 SSAGESMAALERATSRLDELLSSNQGALNNGLQGFSELGPAINELRGTLGALRRVTQRLE 294

Query: 283 HLLSDF 288
              S F
Sbjct: 295 DNPSGF 300



 Score = 65.2 bits (157), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 26/169 (15%), Positives = 62/169 (36%), Gaps = 2/169 (1%)

Query: 274 FQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNMRSSISAIREITDQRQKIISTIN 333
              + +  + L+++ ++ ++S       +N       + +   A   + +QR  +   + 
Sbjct: 140 LSALLENGEDLMTNINNLLRSANLMLSEDNAGRIGRTLANLEQATSVLAEQRGDLSEALT 199

Query: 334 TIENITSNLNDSSQKFAELMSKINNISALKENNSLFKDAQRAMHTFRDTSEKINRYIPSI 393
            +  +    N +  +   L    N +    E   L   A  +M      + +++  + S 
Sbjct: 200 QLSQLGQQTNTALAEITRLTQNANGLID-DEGRQLLSSAGESMAALERATSRLDELLSSN 258

Query: 394 GNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFERNPQDIVWGREK 442
              L N    G +++   + +L+ T+          E NP   + GREK
Sbjct: 259 QGALNN-GLQGFSELGPAINELRGTLGALRRVTQRLEDNPSGFLLGREK 306


>gi|218513900|ref|ZP_03510740.1| putative ABC transporter, substrate-binding protein [Rhizobium etli
           8C-3]
          Length = 255

 Score =  242 bits (616), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 95/258 (36%), Positives = 148/258 (57%), Gaps = 3/258 (1%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K  YT VG F V ++  +F  +YW++   +  GPM E+I+RIPGS +GLS  S VRF
Sbjct: 1   METKANYTIVGFFTVLVIAAAFGFVYWMAEYGR-GGPMTELIVRIPGSANGLSVGSPVRF 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NGI +G +  L +D + P +SLA   +R D P+YPST A +  QGL G  YIELS  RK 
Sbjct: 60  NGIQIGSVQTLSIDADDPQYSLAFTQVRTDAPIYPSTKAALEIQGLTGAAYIELSGGRKG 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
           +++I Q A +  +RA+I A  S +   ++ A+    + +D+   +Q  I++   PLT T 
Sbjct: 120 EESILQHAIDNGKRAVIVADQSSVTNLLATADKILDRANDAVGELQGFIQDSRAPLTQTF 179

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
            N ET S  LA N  +ID  + +  V   S+  K     +   + +++ ++KA+D QK++
Sbjct: 180 KNAETFSDALAKNSDNIDAFLQS--VGELSNTVKAVSGRVDSTLQAVESLVKAVDAQKID 237

Query: 241 QILENIQVSSNNFVKSSD 258
            I+ N +  + N   +S 
Sbjct: 238 HIVSNAERITANVADASG 255


>gi|70733610|ref|YP_257250.1| MCE-like family protein [Pseudomonas fluorescens Pf-5]
 gi|68347909|gb|AAY95515.1| mce related protein family [Pseudomonas fluorescens Pf-5]
          Length = 312

 Score =  242 bits (616), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 65/301 (21%), Positives = 140/301 (46%), Gaps = 24/301 (7%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++ ++  +GLF V ++  +     WL++S+  D    +  I    +V GLS  SSV++
Sbjct: 1   METRAHHVLIGLFTVIVVAGALLFGLWLAKSS-VDSAFQDYQIVFNEAVSGLSKGSSVQY 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           +GI VG +V L LD + P   LA+  +  +TP+   T A +   G+ G + I+LS    +
Sbjct: 60  SGIKVGDVVNLRLDPKDPRRVLAQIRLGSETPIKEDTQAKLALTGITGTSIIQLSGGTPQ 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIE-NIEKPLTTT 179
             T+     +  +   I A+PS I   ++N+ +    ++    +  ++   +    +++T
Sbjct: 120 SPTLK---GKDGELPTIIASPSPIARLLNNSNDLMTGVNLLLHNANRMFSPDNVARVSST 176

Query: 180 IANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQ-- 237
           + N++  S  +A     + ++M   Q+   S  +       T L+ + + ++     Q  
Sbjct: 177 LDNLQKTSASIAEQRDDLRQLMQ--QLGSISKQTGAMLEQTTALMRNANGLLNDQGKQMF 234

Query: 238 ---------------KVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKID 282
                           +N++L + Q S NN ++  + +   V ++RET  + + + ++++
Sbjct: 235 GSAEHAMRSLEQSSATLNKLLSDNQDSLNNGMQGLNGLAPAVRELRETLSSLRAITRRLE 294

Query: 283 H 283
            
Sbjct: 295 A 295



 Score = 60.6 bits (145), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 33/169 (19%), Positives = 70/169 (41%), Gaps = 2/169 (1%)

Query: 274 FQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNMRSSISAIREITDQRQKIISTIN 333
              +    + L++  +  + +       +N+A  +S + +       I +QR  +   + 
Sbjct: 140 IARLLNNSNDLMTGVNLLLHNANRMFSPDNVARVSSTLDNLQKTSASIAEQRDDLRQLMQ 199

Query: 334 TIENITSNLNDSSQKFAELMSKINNISALKENNSLFKDAQRAMHTFRDTSEKINRYIPSI 393
            + +I+       ++   LM   N +    +   +F  A+ AM +   +S  +N+ +   
Sbjct: 200 QLGSISKQTGAMLEQTTALMRNANGLLN-DQGKQMFGSAEHAMRSLEQSSATLNKLLSDN 258

Query: 394 GNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFERNPQDIVWGREK 442
            ++L N    GLN +   VR+L+ET++         E NP   + G EK
Sbjct: 259 QDSLNN-GMQGLNGLAPAVRELRETLSSLRAITRRLEANPGGYLLGNEK 306


>gi|327478708|gb|AEA82018.1| ABC transporter permease [Pseudomonas stutzeri DSM 4166]
          Length = 312

 Score =  242 bits (616), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 67/306 (21%), Positives = 135/306 (44%), Gaps = 24/306 (7%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++ ++  +GLF V  +  +     WL +S+  D       I    +V GLS  SSV +
Sbjct: 1   METRAHHVLIGLFTVLAVGGALLFALWLGKSS-MDREYNYYEISFNRAVSGLSNGSSVEY 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           +GI VG +  L+L+ + P    A+  +   TP+   T A +    + G   I+L +   +
Sbjct: 60  SGIKVGDVEALWLEPDDPRKVRARIRVYAGTPIKQDTRARLALANITGSMIIQLHSGTPQ 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKII-ENIEKPLTTT 179
              +     +R +  +I A PS ++  + N E+    I++  R    ++ E+    +  T
Sbjct: 120 SPPL---EGKRGEPPLIIADPSPLSALLENGEDLMTNINNLLRSANLMLSEDNAGRIGRT 176

Query: 180 IANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQ-- 237
           +AN+E  ++VLA     + + +  TQ+      + +    IT L  + + +I     Q  
Sbjct: 177 LANLEQATSVLAEQRGDLSQAL--TQLGQLGQQTNSALAEITRLTQNANGLIDDEGRQLL 234

Qu