BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780140|ref|YP_003064553.1| putative ABC transporter,
substrate-binding protein [Candidatus Liberibacter asiaticus str.
psy62]
         (452 letters)

Database: nr 
           13,984,884 sequences; 4,792,584,752 total letters

Searching..................................................done



>gi|254780140|ref|YP_003064553.1| putative ABC transporter, substrate-binding protein [Candidatus
           Liberibacter asiaticus str. psy62]
 gi|254039817|gb|ACT56613.1| putative ABC transporter, substrate-binding protein [Candidatus
           Liberibacter asiaticus str. psy62]
          Length = 452

 Score =  249 bits (633), Expect = 8e-64,   Method: Composition-based stats.
 Identities = 452/452 (100%), Positives = 452/452 (100%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF
Sbjct: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE
Sbjct: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
           KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI
Sbjct: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
           ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN
Sbjct: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240

Query: 241 QILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAF 300
           QILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAF
Sbjct: 241 QILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAF 300

Query: 301 LENIADSTSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNIS 360
           LENIADSTSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNIS
Sbjct: 301 LENIADSTSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNIS 360

Query: 361 ALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVN 420
           ALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVN
Sbjct: 361 ALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVN 420

Query: 421 HFDDCLNNFERNPQDIVWGREKGSVKIYKPKH 452
           HFDDCLNNFERNPQDIVWGREKGSVKIYKPKH
Sbjct: 421 HFDDCLNNFERNPQDIVWGREKGSVKIYKPKH 452


>gi|86357962|ref|YP_469854.1| putative ABC transporter protein [Rhizobium etli CFN 42]
 gi|86282064|gb|ABC91127.1| putative ABC transporter protein [Rhizobium etli CFN 42]
          Length = 456

 Score =  241 bits (614), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 136/453 (30%), Positives = 234/453 (51%), Gaps = 8/453 (1%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K  YT VG F V ++  +F  +YW++   +  GPM E+I+RIPGS +GLS  S VRF
Sbjct: 1   METKANYTIVGFFTVLVIAAAFGFVYWMAEYGR-GGPMTELIVRIPGSANGLSVGSPVRF 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NGI VG +  L +D + P +SLA   +R D P+YPST A +  QGL G  YIELS  RK 
Sbjct: 60  NGIQVGSVQTLSIDADDPQYSLAFTQVRTDAPIYPSTKAALEIQGLTGAAYIELSGGRKG 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
           +++I + A E  +RA+I A  S +   ++ A+    + +D+   +Q  IE+   PLT T 
Sbjct: 120 EESILKHAIENGKRAVIVADQSSVTNLLATADKILDRANDAVGELQGFIEDSRAPLTQTF 179

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPH-----SSDSKNTFNTITDLITSLDKMIKAID 235
            N ET S  LA N  +ID  + +     +     S    +T   +  L+ ++D       
Sbjct: 180 KNAETFSDALAKNSDNIDAFLQSVGELSNTVKAVSGRVDSTLQAVESLVRAVDAQKIDNI 239

Query: 236 LQKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSK 295
           +    +I  N+  +S +   +  +   T     +  +  Q    ++D L++         
Sbjct: 240 VSNAEKITANVADASGDLKGAIQKFDETATTFNDFGKQAQATLDRVDTLVAQIDPAKIKG 299

Query: 296 ETSAFLENIADSTSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSK 355
                 +   D+   + S       ++ +++ I  TI  +  + + LN +S +   ++ K
Sbjct: 300 SVDDISQATKDARVAVASIRDVANTVSLRQKDIDQTIQDVSQLANKLNSASTRVDGILIK 359

Query: 356 INNISALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKL 415
           ++ +       SLF +A+  + +F+  ++ +N  I  I +NLQ FS +GL D+Q L+  +
Sbjct: 360 VDALLGTDNTQSLFAEARETLESFKKVADNLNSRIGPIADNLQKFSSAGLRDVQTLINDM 419

Query: 416 QETVNHFDDCLNNFERNPQDIVWGREKGSVKIY 448
           + TV++ +D ++NF+RNPQ +++G +  +VK Y
Sbjct: 420 RGTVSNLNDTISNFDRNPQRLIFGGD--TVKQY 450


>gi|209549576|ref|YP_002281493.1| hypothetical protein Rleg2_1982 [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209535332|gb|ACI55267.1| Mammalian cell entry related domain protein [Rhizobium
           leguminosarum bv. trifolii WSM2304]
          Length = 456

 Score =  240 bits (612), Expect = 3e-61,   Method: Composition-based stats.
 Identities = 141/455 (30%), Positives = 241/455 (52%), Gaps = 12/455 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K  YT VG F V ++  +F  +YW++   +  GPM E+I+RIPGS +GLS  S VRF
Sbjct: 1   METKANYTIVGFFTVLVIAAAFGFVYWMAEYGR-GGPMTELIVRIPGSANGLSVGSPVRF 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NGI +G +  L +D + P +SLA   +R D P+YPST A +  QGL G  YIELS  RK 
Sbjct: 60  NGIQIGSVQTLSIDADDPQYSLAFTQVRTDAPIYPSTKAALEIQGLTGAAYIELSGGRKG 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
           +++I Q A +  +RA+I A  S +   ++ A+    + +D+   +Q  IE+   PLT T 
Sbjct: 120 EESILQHAIDNGKRAVIVADQSSVTNLLATADKILDRANDAVGELQGFIEDSRAPLTQTF 179

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
            N ET S  LA N  +ID  + +      S+  K     +   + +++ ++KA+D +K++
Sbjct: 180 KNAETFSDALAKNSGNIDAFLQSVG--ELSNTVKAVSGRVDSTLQAVESLVKAVDAKKID 237

Query: 241 QILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEV-------GQKIDHLLSDFSSKMK 293
            I+ N    + N   +S  +   +    +T  TF +          ++D L++       
Sbjct: 238 NIVSNADKITANVADASGDLKGAIQKFDQTATTFNDFGKQAQATLDRVDTLVAQIDPAKV 297

Query: 294 SKETSAFLENIADSTSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELM 353
                   +   D+ + + S       ++ +++ I  TI  +  + + LN +S +   ++
Sbjct: 298 KGSVDDIAQATKDARAAVASIRDVANTVSGRQKDIDQTIQDVSQLANKLNSASTRIDGIL 357

Query: 354 SKINNISALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVR 413
            K++ +       SLF +A+  + +F+  ++ +N  I  I +NLQ FS  GL D+Q LV 
Sbjct: 358 IKVDALLGTDNTQSLFTEARDTLESFKKVADNLNARIGPIADNLQKFSSGGLRDVQTLVN 417

Query: 414 KLQETVNHFDDCLNNFERNPQDIVWGREKGSVKIY 448
            ++ TVN+ +D + NF+RNPQ +++G +  +VK Y
Sbjct: 418 DMRGTVNNLNDTITNFDRNPQRLIFGGD--TVKQY 450


>gi|190892033|ref|YP_001978575.1| putative ABC transporter, substrate-binding protein [Rhizobium etli
           CIAT 652]
 gi|190697312|gb|ACE91397.1| putative ABC transporter, substrate-binding protein [Rhizobium etli
           CIAT 652]
          Length = 456

 Score =  240 bits (612), Expect = 3e-61,   Method: Composition-based stats.
 Identities = 135/453 (29%), Positives = 233/453 (51%), Gaps = 8/453 (1%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K  YT VG F V ++  +F  +YW++   +  GPM E+I+RIPGS +GLS  S VRF
Sbjct: 1   METKANYTIVGFFTVLVIAAAFGFVYWMAEYGR-GGPMTELIVRIPGSANGLSVGSPVRF 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NGI +G +  L +D + P +SLA   +R D P+YPST A +  QGL G  YIELS  RK 
Sbjct: 60  NGIQIGSVQTLSIDADDPQYSLAFTQVRTDAPIYPSTKAALEIQGLTGAAYIELSGGRKG 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
           +++I Q A +  +RA+I A  S +   ++ A+    + +D+   +Q  I++   PLT T 
Sbjct: 120 EESILQHAIDNGKRAVIVADQSSVTNLLATADKILDRANDAVGELQGFIQDSRAPLTQTF 179

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPH-----SSDSKNTFNTITDLITSLDKMIKAID 235
            N ET S  LA N  +ID  + +     +     S    +T   +  L+ ++D       
Sbjct: 180 KNAETFSDALAKNSDNIDAFLQSVGELSNTVKAVSGRVDSTLEAVESLVKAVDAQKIDHI 239

Query: 236 LQKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSK 295
           +    +I  N+  +S +   +  +   T     +  +  Q+   ++D L++         
Sbjct: 240 VSNAERITANVADASGDLKGAIQKFDETATTFNDFGKQAQDTLDRVDTLVAQIDPAKLKG 299

Query: 296 ETSAFLENIADSTSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSK 355
                 +   D+ + + S       ++ +++ I  TI  +  + + LN +S +   ++ K
Sbjct: 300 SVDDISQATKDARAAIASIRDVANTVSGRQKDIDQTIQDVSQLANKLNSASTRIDGILIK 359

Query: 356 INNISALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKL 415
           ++ +       S+F  A+  + +F+  ++ +N  I  I +NLQ FS  GL D+Q LV  +
Sbjct: 360 VDALLGTDNTQSMFAQARETLESFKKVADNLNSRIGPIADNLQKFSSGGLRDVQTLVNDM 419

Query: 416 QETVNHFDDCLNNFERNPQDIVWGREKGSVKIY 448
           + TVN+ +D + NF+RNPQ +++G +  +VK Y
Sbjct: 420 RGTVNNLNDTITNFDRNPQRLIFGGD--TVKQY 450


>gi|327190642|gb|EGE57730.1| putative ABC transporter, substrate-binding protein [Rhizobium etli
           CNPAF512]
          Length = 456

 Score =  240 bits (611), Expect = 3e-61,   Method: Composition-based stats.
 Identities = 135/453 (29%), Positives = 233/453 (51%), Gaps = 8/453 (1%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K  YT VG F V ++  +F  +YW++   +  GPM E+I+RIPGS +GLS  S VRF
Sbjct: 1   METKANYTIVGFFTVLVIAAAFGFVYWMAEYGR-GGPMTELIVRIPGSANGLSVGSPVRF 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NGI +G +  L +D + P +SLA   +R D P+YPST A +  QGL G  YIELS  RK 
Sbjct: 60  NGIQIGSVQTLSIDADDPQYSLAFTQVRTDAPIYPSTKAALEIQGLTGAAYIELSGGRKG 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
           +++I Q A +  +RA+I A  S +   ++ A+    + +D+   +Q  I++   PLT T 
Sbjct: 120 EESILQHAIDNGKRAVIVADQSSVTNLLATADKILDRANDAVGELQGFIQDSRAPLTQTF 179

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPH-----SSDSKNTFNTITDLITSLDKMIKAID 235
            N ET S  LA N  +ID  + +     +     S    +T   +  L+ ++D       
Sbjct: 180 KNAETFSDALAKNSDNIDAFLQSVGELSNTVKAVSGRVDSTLEAVESLVKAVDAQKIDHI 239

Query: 236 LQKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSK 295
           +    +I  N+  +S +   +  +   T     +  +  Q+   ++D L++         
Sbjct: 240 VSNAERITANVADASGDLKGAIQKFDETATTFNDFGKQAQDTLDRVDTLVAQIDPAKLKG 299

Query: 296 ETSAFLENIADSTSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSK 355
                 +   D+ + + S       ++ +++ I  TI  +  + + LN +S +   ++ K
Sbjct: 300 SVDDISQATKDARAAVASIRDVANTVSGRQKDIDQTIQDVSQLANKLNSASTRIDGILIK 359

Query: 356 INNISALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKL 415
           ++ +       S+F  A+  + +F+  ++ +N  I  I +NLQ FS  GL D+Q LV  +
Sbjct: 360 VDALLGTDNTQSMFAQARETLESFKKVADNLNSRIGPIADNLQKFSSGGLRDVQTLVNDM 419

Query: 416 QETVNHFDDCLNNFERNPQDIVWGREKGSVKIY 448
           + TVN+ +D + NF+RNPQ +++G +  +VK Y
Sbjct: 420 RGTVNNLNDTITNFDRNPQRLIFGGD--TVKQY 450


>gi|241204913|ref|YP_002976009.1| Mammalian cell entry related domain protein [Rhizobium
           leguminosarum bv. trifolii WSM1325]
 gi|240858803|gb|ACS56470.1| Mammalian cell entry related domain protein [Rhizobium
           leguminosarum bv. trifolii WSM1325]
          Length = 456

 Score =  240 bits (610), Expect = 4e-61,   Method: Composition-based stats.
 Identities = 141/455 (30%), Positives = 244/455 (53%), Gaps = 12/455 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K  YT VG F V ++  +F  +YW++   +  GPM E+I+RIPGS +GLS  S VRF
Sbjct: 1   METKANYTIVGFFTVLVIAAAFGFVYWMAEYGR-GGPMTELIVRIPGSANGLSVGSPVRF 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NGI +G +  L +D + P +SLA   +R D P+YPST A +  QGL G  YIELS  RK 
Sbjct: 60  NGIQIGSVQTLSIDADDPQYSLAFTQVRTDAPIYPSTKAALEIQGLTGAAYIELSGGRKG 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
           +++I Q A +  +RA+I A  S +   ++ A+    + +D+   +Q  IE+   PLT T 
Sbjct: 120 EESILQHAIDNGKRAVIVADQSSVTNLLATADKILDRANDAVGELQGFIEDSRGPLTETF 179

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
            N ET S  LA N  +ID  + +      S+  K   + +   + +++ ++KA+D QK++
Sbjct: 180 KNAETFSDALAKNSGNIDAFLQSVG--ELSNTVKAVSSRVDSTLQAVESLVKAVDAQKID 237

Query: 241 QILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEV-------GQKIDHLLSDFSSKMK 293
            I+ N +  + N   +S  +   +    +T  TF +          ++D L++       
Sbjct: 238 NIVSNAEKITANVADASGDLKGAIQKFDQTATTFNDFGKQAQATLDRVDTLVAQIDPAKV 297

Query: 294 SKETSAFLENIADSTSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELM 353
                   +   D+ + + S       ++ +++ I  TI  +  +++ LN +S +   ++
Sbjct: 298 KGSVDDISQATKDARAAVASIREVANTVSARQKDIDQTIQDVSQLSNKLNSASTRIDGIL 357

Query: 354 SKINNISALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVR 413
            K++ +       SLF +A+  + +F+  ++ +N  I  I +NLQ FS  GL D+Q LV 
Sbjct: 358 IKVDALLGTDNTQSLFTEARDTLESFKKVADNLNSRIGPIADNLQKFSSGGLRDVQTLVN 417

Query: 414 KLQETVNHFDDCLNNFERNPQDIVWGREKGSVKIY 448
            ++ TV++ +D + NF+RNPQ +++G +  +VK Y
Sbjct: 418 DMRGTVSNLNDTITNFDRNPQRLIFGGD--TVKQY 450


>gi|222086198|ref|YP_002544730.1| ABC transporter protein [Agrobacterium radiobacter K84]
 gi|221723646|gb|ACM26802.1| ABC transporter protein [Agrobacterium radiobacter K84]
          Length = 456

 Score =  240 bits (610), Expect = 4e-61,   Method: Composition-based stats.
 Identities = 132/453 (29%), Positives = 236/453 (52%), Gaps = 8/453 (1%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K  YT VG F + ++  +F  +YW++   +  GPM E+++RIPGS +GLS  S VRF
Sbjct: 1   METKANYTIVGFFTLLVIAAAFGFVYWMAEYGR-GGPMVELVVRIPGSANGLSVGSPVRF 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NGI VG + GL +D + PN+SLA   +R D P+Y ST A +  QGL G  YIELS  R  
Sbjct: 60  NGIQVGSVQGLSIDADDPNYSLAFTEVRADAPVYTSTKAILEIQGLTGAAYIELSGGRNG 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
            + I + + +  +RA++ A  S +   ++ A+    + +D+   IQ  + +   PLT T+
Sbjct: 120 DENILKRSVDTGKRAVLLADQSSVTNLLNTADKILNRANDTIGDIQGFVSDSRAPLTDTV 179

Query: 181 ANIETISTVLANNISHIDKMMHTT-----QVTPHSSDSKNTFNTITDLITSLDKMIKAID 235
            N +T S  L++N  +IDK + +           S+   +T   +  L+ ++D       
Sbjct: 180 RNAQTFSKALSDNSDNIDKFLASMGQLSDTFKNVSTRIDSTLEAVEKLVRAVDANKINEV 239

Query: 236 LQKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSK 295
           +   N+I  N+  ++ +   +      T        Q  Q+   ++D +++         
Sbjct: 240 VNNANKITANVADATTDLKATVAAFKQTADTYNAFGQKAQQTLDRVDAIVAQIDPAKLKG 299

Query: 296 ETSAFLENIADSTSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSK 355
                 +   D+ + + S       +  ++Q I  TI    +I+  LN +S K   ++SK
Sbjct: 300 SVDDITQVTKDARAAVTSIREVANSVAARQQDIDQTIANARSISEKLNSASGKVDGVLSK 359

Query: 356 INNISALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKL 415
           ++++    +  SLF +A+  + +F+  ++ +N  I  I +NLQ FS SGL+++Q L+  +
Sbjct: 360 VDSLLGSGDTQSLFAEAKDTLTSFKKMADNLNARIGPIADNLQKFSSSGLSNVQTLINDM 419

Query: 416 QETVNHFDDCLNNFERNPQDIVWGREKGSVKIY 448
           + TV++ +  + NF+RNPQ +++G +  +VK Y
Sbjct: 420 RGTVDNLNSTITNFDRNPQRLLFGGD--TVKQY 450


>gi|116252405|ref|YP_768243.1| solute-binding component of ABC transporter [Rhizobium
           leguminosarum bv. viciae 3841]
 gi|115257053|emb|CAK08147.1| putative solute-binding component of ABC transporter [Rhizobium
           leguminosarum bv. viciae 3841]
          Length = 456

 Score =  239 bits (609), Expect = 6e-61,   Method: Composition-based stats.
 Identities = 141/455 (30%), Positives = 243/455 (53%), Gaps = 12/455 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K  YT VG F V ++  +F  +YW++   +  GPM E+I+RIPGS +GLS  S VRF
Sbjct: 1   METKANYTIVGFFTVLVIAAAFGFVYWMAEYGR-GGPMTELIVRIPGSANGLSVGSPVRF 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NGI +G +  L +D + P +SLA   +R D P+YPST A +  QGL G  YIELS  RK 
Sbjct: 60  NGIQIGSVQTLSIDADDPQYSLAFTQVRTDAPIYPSTKAALEIQGLTGAAYIELSGGRKG 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
           +++I Q A +  +RA+I A  S +   ++ A+    + +D+   +Q  IE+   PLT T 
Sbjct: 120 EESILQHAIDNGKRAVIVADQSSVTNLLATADKILDRANDAVGELQGFIEDSRGPLTETF 179

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
            N ET S  LA N  +ID  + +      S+  K     +   + +++ ++KA+D QK++
Sbjct: 180 KNAETFSDALAKNSGNIDAFLQSVG--ELSNTVKAVSGRVDSTLQAVESLVKAVDAQKID 237

Query: 241 QILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEV-------GQKIDHLLSDFSSKMK 293
            I+ N +  + N   +S  +   +    +T  TF +          ++D L++       
Sbjct: 238 NIVSNAEKITANVADASGDLKGAIQKFDQTATTFNDFGKQAQATLDRVDTLVAQIDPAKV 297

Query: 294 SKETSAFLENIADSTSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELM 353
                   +   D+ + + S       ++ +++ I  TI  +  +++ LN +S +   ++
Sbjct: 298 KGSVDDIAQATKDARAAVASIRDVANTVSARQKDIDQTIQDVSQLSNKLNSASTRIDGIL 357

Query: 354 SKINNISALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVR 413
            K++ +       SLF +A+  + +F+  ++ +N  I  I +NLQ FS  GL D+Q LV 
Sbjct: 358 IKVDALLGTDNTQSLFTEARNTLESFKKVADNLNSRIGPIADNLQKFSSGGLRDVQTLVN 417

Query: 414 KLQETVNHFDDCLNNFERNPQDIVWGREKGSVKIY 448
            ++ TV++ +D + NF+RNPQ +++G +  +VK Y
Sbjct: 418 DMRGTVSNLNDTITNFDRNPQRLIFGGD--TVKQY 450


>gi|227822229|ref|YP_002826200.1| putative solute-binding component of ABC transporter [Sinorhizobium
           fredii NGR234]
 gi|227341229|gb|ACP25447.1| putative solute-binding component of ABC transporter [Sinorhizobium
           fredii NGR234]
          Length = 456

 Score =  239 bits (608), Expect = 7e-61,   Method: Composition-based stats.
 Identities = 137/455 (30%), Positives = 231/455 (50%), Gaps = 12/455 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K  Y  VG F V ++  +F  +YW+S+  +  G M E+++ IPGS +GLS  S VRF
Sbjct: 1   METKANYAIVGFFTVFVIAAAFGFVYWMSQYGR-SGEMVELVVNIPGSANGLSVGSPVRF 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NGI VG +  L +D   P +S+A   +  D P+  ST AT+  QGL G  YIELS  RK 
Sbjct: 60  NGINVGSVRSLAIDANDPRYSIAITEVSADAPVLKSTKATLEIQGLTGAAYIELSGGRKG 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
            + I + A E   +A I A  S +   ++ A+    + + +   IQ  +  +  PLT TI
Sbjct: 120 DENILKSALENGTQARILADQSSVTSLLATADQILDRANSAIGDIQGFVTEVRGPLTATI 179

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
            N +  S  LA+N   ID+ + + Q    S         + D + S D++IK++D +K++
Sbjct: 180 GNAQRFSKALADNSDAIDQFLKSVQ--ELSGSVSAASKKLDDTLASADRLIKSVDPKKID 237

Query: 241 QILENIQVSSNNFVKSSDQVINTVHDVRETTQ-------TFQEVGQKIDHLLSDFSSKMK 293
            I+ N++  SN+   +S  V   +   R T           QE  +++D L++   ++  
Sbjct: 238 TIVSNVEDVSNDLKAASGGVSEAIAGFRRTVDTYDQFGKNAQETLKRVDALVAAVDTQKV 297

Query: 294 SKETSAFLENIADSTSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELM 353
               +      AD+            +I+ +++ I  TI     +++ LN +S +   ++
Sbjct: 298 GLVVNDISAASADARKVAAQVSEFANKISARQEDIDQTITDFTEMSNKLNAASNRVDSIL 357

Query: 354 SKINNISALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVR 413
            K++         SL  +A+  + +FR  ++ +N  I  I +NL+ FS SGL D++ LV 
Sbjct: 358 VKVDGFLGDANAPSLSAEARSTLESFRRMADNLNAQIGPIADNLKRFSNSGLRDVETLVT 417

Query: 414 KLQETVNHFDDCLNNFERNPQDIVWGREKGSVKIY 448
           + + TV      ++NF+RNPQ +++G E  +VK Y
Sbjct: 418 ETRRTVQSLQSTISNFDRNPQRLLFGGE--TVKQY 450


>gi|15965584|ref|NP_385937.1| hypothetical protein SMc00176 [Sinorhizobium meliloti 1021]
 gi|15074765|emb|CAC46410.1| Conserved hypothetical protein [Sinorhizobium meliloti 1021]
          Length = 458

 Score =  239 bits (607), Expect = 9e-61,   Method: Composition-based stats.
 Identities = 139/455 (30%), Positives = 237/455 (52%), Gaps = 12/455 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K  Y  VG F V ++  +F  +YW+S+  +  G M E+++ IPGS +GLS  S VRF
Sbjct: 3   METKANYAIVGFFTVLVIAAAFGFVYWMSQYGRT-GQMVELVVNIPGSANGLSVGSPVRF 61

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NGI VG +  L +D   P +S+A   +  D P+  STTAT+  QGL G  YIELS  RK 
Sbjct: 62  NGINVGSVRNLAIDANDPRYSIAITEVSADAPVMKSTTATLEVQGLTGAAYIELSGGRKG 121

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
            + I + A E+  +A I A  S +   ++ A+    + + +   IQ  + ++  PLT+TI
Sbjct: 122 DENILKTALEKGTQAHILADQSSVTSLLATADQILDRANSAITDIQSFVTDVRGPLTSTI 181

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
            N E  S  LA+N   ID+ + + +    S ++      + D + S D++IK++D +K++
Sbjct: 182 GNAERFSKALADNSGAIDQFLKSVEQLSGSVNAA--SKKLDDTLASADRLIKSVDPKKID 239

Query: 241 QILENIQVSSNNFVKSSDQVINTVHDVRETTQTF-------QEVGQKIDHLLSDFSSKMK 293
            I+ N +  SNN   +S  V   +   R T +T+       QE  +++D L++   ++  
Sbjct: 240 NIVSNAEQVSNNLKDASGGVSEAIAGFRRTVETYDQFGKSAQETLKRVDTLVAAVDAQKV 299

Query: 294 SKETSAFLENIADSTSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELM 353
               +      AD+            +I+ ++  I  TI     +++ LN +S +   ++
Sbjct: 300 GLVVNDITAASADARKVAAQVSDFAEKISARQDDIDQTITDFTQMSNKLNAASNRVDSIL 359

Query: 354 SKINNISALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVR 413
            KI+      +  SL   A+  + +FR  +E +N  +  I  NL+ FS SGL D++ LV 
Sbjct: 360 VKIDGFLGDADAPSLSAQARETLESFRRVAENLNAQLGPIAENLKRFSNSGLRDVEALVG 419

Query: 414 KLQETVNHFDDCLNNFERNPQDIVWGREKGSVKIY 448
             + TV    + +++F++NPQ +++G E  +VK Y
Sbjct: 420 DTRRTVQSLQNTISDFDKNPQRLLFGGE--TVKQY 452


>gi|307302704|ref|ZP_07582460.1| Mammalian cell entry related domain protein [Sinorhizobium meliloti
           BL225C]
 gi|307318552|ref|ZP_07597986.1| Mammalian cell entry related domain protein [Sinorhizobium meliloti
           AK83]
 gi|306895892|gb|EFN26644.1| Mammalian cell entry related domain protein [Sinorhizobium meliloti
           AK83]
 gi|306903068|gb|EFN33659.1| Mammalian cell entry related domain protein [Sinorhizobium meliloti
           BL225C]
          Length = 456

 Score =  239 bits (607), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 139/455 (30%), Positives = 237/455 (52%), Gaps = 12/455 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K  Y  VG F V ++  +F  +YW+S+  +  G M E+++ IPGS +GLS  S VRF
Sbjct: 1   METKANYAIVGFFTVLVIAAAFGFVYWMSQYGRT-GQMVELVVNIPGSANGLSVGSPVRF 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NGI VG +  L +D   P +S+A   +  D P+  STTAT+  QGL G  YIELS  RK 
Sbjct: 60  NGINVGSVRNLAIDANDPRYSIAITEVSADAPVMKSTTATLEVQGLTGAAYIELSGGRKG 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
            + I + A E+  +A I A  S +   ++ A+    + + +   IQ  + ++  PLT+TI
Sbjct: 120 DENILKTALEKGTQAHILADQSSVTSLLATADQILDRANSAITDIQSFVTDVRGPLTSTI 179

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
            N E  S  LA+N   ID+ + + +    S ++      + D + S D++IK++D +K++
Sbjct: 180 GNAERFSKALADNSGAIDQFLKSVEQLSGSVNAA--SKKLDDTLASADRLIKSVDPKKID 237

Query: 241 QILENIQVSSNNFVKSSDQVINTVHDVRETTQTF-------QEVGQKIDHLLSDFSSKMK 293
            I+ N +  SNN   +S  V   +   R T +T+       QE  +++D L++   ++  
Sbjct: 238 NIVSNAEQVSNNLKDASGGVSEAIAGFRRTVETYDQFGKSAQETLKRVDTLVAAVDAQKV 297

Query: 294 SKETSAFLENIADSTSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELM 353
               +      AD+            +I+ ++  I  TI     +++ LN +S +   ++
Sbjct: 298 GLVVNDITAASADARKVAAQVSDFAEKISARQDDIDQTITDFTQMSNKLNAASNRVDSIL 357

Query: 354 SKINNISALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVR 413
            KI+      +  SL   A+  + +FR  +E +N  +  I  NL+ FS SGL D++ LV 
Sbjct: 358 VKIDGFLGDADAPSLSAQARETLESFRRVAENLNAQLGPIAENLKRFSNSGLRDVEALVG 417

Query: 414 KLQETVNHFDDCLNNFERNPQDIVWGREKGSVKIY 448
             + TV    + +++F++NPQ +++G E  +VK Y
Sbjct: 418 DTRRTVQSLQNTISDFDKNPQRLLFGGE--TVKQY 450


>gi|163759628|ref|ZP_02166713.1| ABC transporter, substrate binding protein [Hoeflea phototrophica
           DFL-43]
 gi|162283225|gb|EDQ33511.1| ABC transporter, substrate binding protein [Hoeflea phototrophica
           DFL-43]
          Length = 456

 Score =  238 bits (606), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 120/455 (26%), Positives = 224/455 (49%), Gaps = 12/455 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++  Y  VG F V ++  +F  +YW++R     G   ++++RIPGS +GLS  S V F
Sbjct: 1   METRANYAIVGFFTVLVMVSAFGFVYWMARYGGT-GDTTQLVVRIPGSANGLSVGSPVHF 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NGIP G +  L +D   PN  +A  ++R D P+Y  T A +  QGL G  YIEL      
Sbjct: 60  NGIPYGVVRRLNIDPNSPNFVIADTVVRSDAPIYTDTRAALEIQGLTGSAYIELQGGTPS 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
              I   A   +  A+I A PSG+   ++ A+    +++     ++  +E    PLT T+
Sbjct: 120 NPNILDQAISDSGVAVIEADPSGVTNLLATADEILTRVNRVIGEVEGFVEEARSPLTGTL 179

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
            N E+ S  L++N   ID+ + +      S   ++    +   + S +++I A+D  +V 
Sbjct: 180 RNAESFSAALSDNADGIDEFLKSVS--ALSGTVQSLSVKLEGTLGSAERLINAVDPDQVR 237

Query: 241 QILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEV-------GQKIDHLLSDFSSKMK 293
            I+ ++   + +   SS  +I T+  +R T Q+ ++          K+D +++       
Sbjct: 238 NIVSSVDKVTGDLAASSGDIIKTLESLRGTAQSLEQFVTDAGASLDKVDAVIASVDPAKV 297

Query: 294 SKETSAFLENIADSTSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELM 353
            +         AD+   +  +         +++     I  ++ ++  LN +S++   ++
Sbjct: 298 GEVMDNITVASADARQTLADARGVAETFGARKEDFDLIITDVKEMSGRLNAASERVDGVL 357

Query: 354 SKINNISALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVR 413
           +K++      + +SL  DA+  + +FR+ +  +N  I  I +NLQ FS SGL D++ LV 
Sbjct: 358 AKLDGFLGEGDASSLIADAEETLKSFREVANSLNARIGPIADNLQRFSGSGLRDVEALVN 417

Query: 414 KLQETVNHFDDCLNNFERNPQDIVWGREKGSVKIY 448
             + ++   +  + + ER+PQ +++G E  +VK Y
Sbjct: 418 DARRSIQRIEQSITSIERDPQRLLFGGE--TVKQY 450


>gi|150396762|ref|YP_001327229.1| hypothetical protein Smed_1552 [Sinorhizobium medicae WSM419]
 gi|150028277|gb|ABR60394.1| Mammalian cell entry related domain protein [Sinorhizobium medicae
           WSM419]
          Length = 458

 Score =  237 bits (603), Expect = 3e-60,   Method: Composition-based stats.
 Identities = 138/455 (30%), Positives = 234/455 (51%), Gaps = 12/455 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K  Y  VG F V ++  +F  +YW+S+  +  G M ++++ IPGS +GLS  S VRF
Sbjct: 3   METKANYAIVGFFTVLVIAAAFGFVYWMSQYGRT-GQMVQLVVNIPGSANGLSVGSPVRF 61

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NGI VG +  L +D   P +S+A   +  D P+  STTAT+  QGL G  YIELS  RK 
Sbjct: 62  NGINVGSVRNLAIDANDPRYSIAITEVSADAPVMKSTTATLEVQGLTGAAYIELSGGRKG 121

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
            + I + A ER  +A I A  S +   ++ A+    + + +   IQ  + ++  PLT+TI
Sbjct: 122 DENILKTALERGTQAHILADQSSVTSLLATADQILDRANSAITDIQSFVTDVRGPLTSTI 181

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
            N E  S  LA+N   ID+ + + +    S ++      + D +   D++IKA+D +K+ 
Sbjct: 182 GNAERFSKALADNSDAIDQFLESVEQLSGSVNAA--SKKLDDTLAGADRLIKAVDPKKIE 239

Query: 241 QILENIQVSSNNFVKSSDQVINTVHDVRETTQ-------TFQEVGQKIDHLLSDFSSKMK 293
            I+ N +  SNN   +S +V  TV   + T +         Q+  +++D L++   S+  
Sbjct: 240 NIVGNAEQVSNNLKNASGEVTETVASFQRTLETYNQFGKNAQQTLERVDALVAAVDSQKV 299

Query: 294 SKETSAFLENIADSTSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELM 353
               +      AD+            +I+ ++  I  TI     +++ LN +S +   ++
Sbjct: 300 GLVVNDITAASADARKVAAQVSDFAEKISARQGDIDQTITDFTQMSNKLNAASGRVDSIL 359

Query: 354 SKINNISALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVR 413
            KI+      +  SL   A+  + +FR  +E +N  +  I  NL+ FS SGL D++ L+ 
Sbjct: 360 VKIDGFLGDADAPSLSAQARETLESFRRVAENLNAQLGPIAENLKRFSNSGLRDVEALIG 419

Query: 414 KLQETVNHFDDCLNNFERNPQDIVWGREKGSVKIY 448
             + TV    + ++ F++NPQ +++G E  +VK Y
Sbjct: 420 DTRRTVQGLQNTISEFDKNPQRLLFGGE--TVKQY 452


>gi|15888955|ref|NP_354636.1| ABC transporter, substrate binding protein [Agrobacterium
           tumefaciens str. C58]
 gi|15156734|gb|AAK87421.1| ABC transporter, substrate binding protein [Agrobacterium
           tumefaciens str. C58]
          Length = 456

 Score =  236 bits (600), Expect = 7e-60,   Method: Composition-based stats.
 Identities = 129/453 (28%), Positives = 233/453 (51%), Gaps = 8/453 (1%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K  YT VG+F + ++  +F  +YW++   +  GP A++++RIPGS +GLS  S VRF
Sbjct: 1   METKANYTIVGIFTLIVIAAAFGFVYWMAEFGR-GGPTAQLVVRIPGSANGLSVGSPVRF 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NGIPVG + GL +D++ P +S+A   ++ D P++PST A +  QGL G  YIELS   K+
Sbjct: 60  NGIPVGTVRGLAIDRDDPAYSIAFTEVQADAPVFPSTRAVLEIQGLTGAAYIELSGGNKD 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
            + I Q + E    A +TA  S +   ++ A+   K+   +   +Q  +++   PLT T+
Sbjct: 120 GERILQKSVESGVPAELTADLSSVTNLLATADKILKRADGAIGELQGFVQDARGPLTQTV 179

Query: 181 ANIETISTVLANNISHIDKMMHTT-----QVTPHSSDSKNTFNTITDLITSLDKMIKAID 235
            N E  S  LA N   I   + +       V   S     T   + +L+ ++D       
Sbjct: 180 RNAEKFSDALAANSDGIKNFIASLSSLSTTVQSVSVRLDGTLTAVENLVKAVDAGKIDSI 239

Query: 236 LQKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSK 295
           L  V+++ +++  +S++     + V +T  +    +   Q V ++ D LL+       S 
Sbjct: 240 LSNVDKVTKDVASASSDIQGIMETVQSTARNFEAASTEVQTVVKRADELLASVDPAKVST 299

Query: 296 ETSAFLENIADSTSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSK 355
                    AD+   + +      ++  +R  I   ++    +   LN +S +   +++K
Sbjct: 300 VVGDVSAATADARDAVANFKRIADDVGARRADIDQAVSDFTEMGRKLNLASSRVDGILAK 359

Query: 356 INNISALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKL 415
           ++ +    + NSLF  A+  + +F+  ++ +N  I  I +NL  FS SGL D Q L+   
Sbjct: 360 VDGMLGTDDANSLFAKARETLTSFKAVADNLNARIGPIADNLTRFSSSGLKDFQALIGST 419

Query: 416 QETVNHFDDCLNNFERNPQDIVWGREKGSVKIY 448
           ++TV++ ++ + N +R+PQ +++G E  +VK Y
Sbjct: 420 RQTVDNLNNAITNIDRDPQRLIFGGE--TVKQY 450


>gi|325293032|ref|YP_004278896.1| ABC transporter substrate-binding protein [Agrobacterium sp. H13-3]
 gi|325060885|gb|ADY64576.1| ABC transporter, substrate binding protein [Agrobacterium sp.
           H13-3]
          Length = 456

 Score =  235 bits (598), Expect = 1e-59,   Method: Composition-based stats.
 Identities = 130/453 (28%), Positives = 234/453 (51%), Gaps = 8/453 (1%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K  YT VG+F + ++  +F  +YW++   +  GP A++++RIPGS +GLS  S VRF
Sbjct: 1   METKANYTIVGIFTLIVIAAAFGFVYWMAEFGR-GGPTAQLVVRIPGSANGLSVGSPVRF 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NGIPVG + GL +D++ P +S+A   ++ D P++PST A +  QGL G  YIELS   K+
Sbjct: 60  NGIPVGTVRGLAIDRDDPAYSIAFTEVQADAPVFPSTRAVLEIQGLTGAAYIELSGGNKD 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
            + I Q + E    A +TA  S +   ++ A+   K+   +   +Q  +++   PLT T+
Sbjct: 120 GERILQKSVESGVPAELTADLSSVTNLLATADKILKRADGAIGELQGFVQDARGPLTQTV 179

Query: 181 ANIETISTVLANNISHIDKMMHTT-----QVTPHSSDSKNTFNTITDLITSLDKMIKAID 235
            N E  S  LA N   I   + +       V   S     T   + DL+ ++D       
Sbjct: 180 RNAEKFSDALAANSDGIKSFIASLSSLSTTVQSVSVRLDGTLTAVEDLVKAVDAGKIDSI 239

Query: 236 LQKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSK 295
           L  V+++ +++  +S++     + V +T  +    +   Q V ++ D LL+       S 
Sbjct: 240 LSNVDKVTKDVASASSDIQGIMETVQSTARNFEAASTEVQTVVKRADELLASVDPAKVST 299

Query: 296 ETSAFLENIADSTSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSK 355
                    AD+   + +      ++  +R  I   ++   ++   LN +S +   +++K
Sbjct: 300 VVGDVSAATADARDAVANFKRIADDVGARRADIDQAVSDFTDMGRKLNLASSRVDGILAK 359

Query: 356 INNISALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKL 415
           ++ +    + NSLF  A+  + +F+  ++ +N  I  I +NL  FS SGL D Q L+   
Sbjct: 360 VDGMLGTDDANSLFAKARETLTSFKAVADNLNARIGPIADNLTRFSSSGLKDFQALIGST 419

Query: 416 QETVNHFDDCLNNFERNPQDIVWGREKGSVKIY 448
           ++TV++ ++ + N +R+PQ +++G E  +VK Y
Sbjct: 420 RQTVDNLNNAITNIDRDPQRLIFGGE--TVKQY 450


>gi|222148409|ref|YP_002549366.1| ABC transporter substrate binding protein [Agrobacterium vitis S4]
 gi|221735397|gb|ACM36360.1| ABC transporter substrate binding protein [Agrobacterium vitis S4]
          Length = 455

 Score =  234 bits (595), Expect = 2e-59,   Method: Composition-based stats.
 Identities = 135/455 (29%), Positives = 241/455 (52%), Gaps = 13/455 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K  YT VGLF + ++  +F  +YW++   +  GPM+ + IRIPGS +GLS  S VRF
Sbjct: 1   METKANYTIVGLFTLLVILAAFGFVYWMAEYGR-GGPMSPLTIRIPGSANGLSVGSPVRF 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NGI +G +V L +D++ P  S+A+  ++ D P+  +T A +  QGL G  Y+E+S     
Sbjct: 60  NGIQIGSVVSLSIDRDDPAFSIAETQVQQDAPIRSNTKAALEVQGLTGAAYVEMSGGVGG 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
              + + A E  + A++ A  S +   ++ A+   K+  D+  ++Q  + +   PLT T+
Sbjct: 120 DDLLKK-AQETGKTAVLVADQSSLTNLLATADKIMKRADDAIANVQGFVADARGPLTNTM 178

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
            N ET S  LA+N   ID  + +      S         +   + + + ++KA+D  KVN
Sbjct: 179 RNAETFSKALADNADGIDTFLKSVS--ALSDTITGLSGRLDSTLAAAEDLLKAVDRNKVN 236

Query: 241 QILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEV-------GQKIDHLLSDFSSKMK 293
           QIL N +  +     +SD+V   V +   T +TF +          +++ L++   ++  
Sbjct: 237 QILTNAETFTGKIADASDKVGVAVDNFSATAKTFNDFGVKAEGTLGQVNALIAAIDTQKV 296

Query: 294 SKETSAFLENIADSTSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELM 353
           S+        + D+ S   +  S      D++  I   I+    +++ LN++S +   ++
Sbjct: 297 SRVVDDVSVAVTDARSAAANVQSVTETFKDRKPDIDQAISDFTQLSNRLNNASTRVDGIL 356

Query: 354 SKINNISALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVR 413
           +K++ +    + NSL  +A+R + + R  ++ +N+ I  I +NL  FS SGL DIQ LV 
Sbjct: 357 AKVDALLGSDDTNSLSAEAKRTLQSIRAVADNLNQKIGPIADNLSKFSSSGLKDIQTLVN 416

Query: 414 KLQETVNHFDDCLNNFERNPQDIVWGREKGSVKIY 448
             + TV + DD ++NF+R+PQ +++G +  +VK Y
Sbjct: 417 DTRSTVKNLDDTISNFDRDPQRLIFGGD--NVKQY 449


>gi|315122742|ref|YP_004063231.1| putative ABC transporter, substrate-binding protein [Candidatus
           Liberibacter solanacearum CLso-ZC1]
 gi|313496144|gb|ADR52743.1| putative ABC transporter, substrate-binding protein [Candidatus
           Liberibacter solanacearum CLso-ZC1]
          Length = 448

 Score =  225 bits (571), Expect = 1e-56,   Method: Composition-based stats.
 Identities = 273/452 (60%), Positives = 352/452 (77%), Gaps = 4/452 (0%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME KNYYT+VG F +SIL  SF+SIYWLSR++QY+GP  E+IIRIPGSV+GL+ +SSVRF
Sbjct: 1   MEVKNYYTAVGFFAISILLLSFYSIYWLSRNDQYNGPTTELIIRIPGSVEGLAVNSSVRF 60

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NGIP+G + GLF+D++ P++S+A+ L+R D PLYPST A I+ QG+ G+TYIELST R E
Sbjct: 61  NGIPIGHVTGLFVDKDNPHYSMAQTLVRVDVPLYPSTKAMIKAQGITGMTYIELSTERTE 120

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
             T+FQ AT+  + AMITA PSGIN+ +S AE+T  KI+ SS  IQKII N + PL   I
Sbjct: 121 NYTLFQTATKEKKIAMITAIPSGINHLLSTAEDTLNKINVSSDQIQKIINNADNPLNRII 180

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
            N ETIST+L +N+S +DKM+H  +    + D   T +  +D ITSL+K IKA+D+QK+N
Sbjct: 181 KNFETISTILVDNVSDLDKMIH--RKNNVAVDFTKTLSNTSDFITSLNKTIKAVDIQKIN 238

Query: 241 QILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAF 300
           QI+ENIQV SNNF+KSSDQV NT++D++ETT TFQ VG+K DHLLSD SS++ SKE   F
Sbjct: 239 QIIENIQVVSNNFIKSSDQVTNTINDLQETTHTFQGVGKKADHLLSDVSSQIHSKEAFDF 298

Query: 301 LENIADSTSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNIS 360
            ENI++S+SN+R+S SAIREITD  QKII TI+TIE +T NLN+SS K  ELM+ IN+ +
Sbjct: 299 WENISESSSNIRNSTSAIREITDHSQKIILTIDTIEKMTENLNNSSIKLKELMTTINSFT 358

Query: 361 ALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVN 420
             +   SL +DAQ+A+ +F++T+EKIN YIP I  NLQNFS SGL D+QNL+R LQETV 
Sbjct: 359 DSEGKKSLIEDAQKAIRSFQNTTEKINEYIPPIAKNLQNFSNSGLYDLQNLIRNLQETVG 418

Query: 421 HFDDCLNNFERNPQDIVWGREKGSVKIYKPKH 452
           HFDD L+NFERNPQ+I+WG+E  +VK YKPKH
Sbjct: 419 HFDDSLSNFERNPQNIIWGKE--TVKQYKPKH 448


>gi|110633895|ref|YP_674103.1| hypothetical protein Meso_1542 [Mesorhizobium sp. BNC1]
 gi|110284879|gb|ABG62938.1| Mammalian cell entry related protein [Chelativorans sp. BNC1]
          Length = 458

 Score =  220 bits (560), Expect = 3e-55,   Method: Composition-based stats.
 Identities = 110/454 (24%), Positives = 209/454 (46%), Gaps = 8/454 (1%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K  Y  VG+F +  +  +F  +YW +     +   A +  RIPGS  GL T S+V F
Sbjct: 1   METKANYVIVGIFTIVAILAAFGFVYWTAGVGN-NSNTAPIRFRIPGSAAGLVTGSAVLF 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLA-GITYIELSTLRK 119
           NG+ VG +  ++LD   P  ++A A +    P+ PST A +    L  G   I+L+    
Sbjct: 60  NGVRVGTVERVYLDGNNPGIAIADARVDRTAPITPSTKADVGLASLTTGQANIDLTGGNP 119

Query: 120 EKKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTT 179
           ++  +  +A E+   A++TA PS ++  + +A++   +       ++  + +   PLT T
Sbjct: 120 QEPKLITLAEEQGTIAVMTANPSAVSNLLQSAQSLMSRADSVVGELENFVSDARGPLTQT 179

Query: 180 IANIETISTVLANNISHIDKMMHTTQVTPHSS-----DSKNTFNTITDLITSLDKMIKAI 234
           + N+E  S  LA N   ID  +        S        ++T ++  +LI S+D+   + 
Sbjct: 180 VRNVEAFSNALARNSEGIDNFLANVGELSESISGVSGQLESTLSSAEELINSVDRNEISK 239

Query: 235 DLQKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKS 294
            ++ +    E +   S  F   +  V + +  +   +    E  Q++D L++       +
Sbjct: 240 IVENLGTFTERLGDVSGQFDTIATGVNDALGSLSSFSTQAGETLQRVDRLVAGIDPDQLT 299

Query: 295 KETSAFLENIADSTSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMS 354
           +  S F E                  ++D+   I   I     + S LN +S +   +++
Sbjct: 300 ETLSNFEEASQAINKASAEIAEVAETVSDRTDDIDQFITDARELASRLNAASVRVDGVLA 359

Query: 355 KINNISALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRK 414
           K++ +    E   LF +A   +  FR T++ +N  +  I + L  FS  GL D++ LV  
Sbjct: 360 KLDGMLGSGEGQDLFAEASSTLRAFRQTADTLNARLGPITDGLTRFSGQGLRDVEALVGD 419

Query: 415 LQETVNHFDDCLNNFERNPQDIVWGREKGSVKIY 448
            +  ++  +  +++ E+NPQ I+ G + G+++ Y
Sbjct: 420 ARRAISRIESAVSDLEQNPQRIITGGD-GTIRRY 452


>gi|260463970|ref|ZP_05812166.1| Mammalian cell entry related domain protein [Mesorhizobium
           opportunistum WSM2075]
 gi|259030345|gb|EEW31625.1| Mammalian cell entry related domain protein [Mesorhizobium
           opportunistum WSM2075]
          Length = 457

 Score =  218 bits (554), Expect = 1e-54,   Method: Composition-based stats.
 Identities = 105/453 (23%), Positives = 201/453 (44%), Gaps = 7/453 (1%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++  Y  VG+F +  +  +F  +YW +      G    + +RIPGS  GL   S V F
Sbjct: 1   METRANYVIVGIFTLVAILAAFGFVYWTAAIGD-RGETTLLRVRIPGSASGLGRGSFVLF 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NG+ VG +  +++D + P  ++A   I   TP+  ST A I   GL G   IEL     +
Sbjct: 60  NGVKVGDVKRVYIDVDNPTVAIADTEIDRMTPITKSTQADIGLAGLTGQANIELKGADPK 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
           +  +   A +  + A I A PS +   +  A+N   +       ++   +++  PLT T+
Sbjct: 120 EVKLLDQAEKEGKVAEIVANPSAVTNLLQTAQNIFNRADKVLSELEGFTKDVRGPLTQTV 179

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPH-----SSDSKNTFNTITDLITSLDKMIKAID 235
            N++T S  LA N   IDK + +           S     T      L+ ++DK      
Sbjct: 180 KNVQTFSDALAKNSDGIDKFLSSVSALSDELKGVSGKLDGTLKAAEGLLNAVDKDKIKSI 239

Query: 236 LQKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSK 295
           +  V+ +  N++ +S         V   V  V +  +  Q    K+D +L          
Sbjct: 240 VANVDTVTANLKQTSQQLDGVIKNVDTAVGSVNDFAKQTQGTLAKVDGVLDGIDPAQVRT 299

Query: 296 ETSAFLENIADSTSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSK 355
             +   +   ++            +  ++   I  TI   + +   LND+S +   ++++
Sbjct: 300 ALANIQKASENANKAAADIAVVTNKFANRADDIDQTIKDAKQLARRLNDASVRVDGILAR 359

Query: 356 INNISALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKL 415
           ++ +    + + +  DA+  + +F+  ++ +N  +  I +NL  FS  GL +++ LV+  
Sbjct: 360 VDKLLGSGQADGVMADARATLKSFKQVADTLNARLGVITDNLARFSGQGLTNVEALVQDS 419

Query: 416 QETVNHFDDCLNNFERNPQDIVWGREKGSVKIY 448
           + ++N  ++ + +  RNPQ I+ G + G V+ +
Sbjct: 420 RRSINRIEEAVTDLSRNPQRILSGGD-GEVRQF 451


>gi|13470957|ref|NP_102526.1| hypothetical protein mll0798 [Mesorhizobium loti MAFF303099]
 gi|14021700|dbj|BAB48312.1| mll0798 [Mesorhizobium loti MAFF303099]
          Length = 457

 Score =  218 bits (553), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 104/453 (22%), Positives = 200/453 (44%), Gaps = 7/453 (1%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++  Y  VG+F +  +  +F  +YW +      G    + +RIPGS  GL   S V F
Sbjct: 1   METRANYVIVGIFTLVAILAAFGFVYWTAAIGD-RGETTLLRVRIPGSASGLGRGSFVLF 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NG+ VG +  +++D + P  ++A   I   TP+  ST A I   GL G   IEL     +
Sbjct: 60  NGVKVGDVKRVYIDVDNPTVAIADTEIDRLTPITKSTQADIGLAGLTGQANIELKGADPK 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
           +  +   A +  + A I A PS +   +  A+N   +       ++    ++  PLT T+
Sbjct: 120 EVKLLDQAEKEGKVAEIVANPSAVTNLLQTAQNIFSRADKVLSELEGFTRDVRGPLTQTV 179

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPH-----SSDSKNTFNTITDLITSLDKMIKAID 235
            N++T S  LA N   IDK + +           S     T      L+ ++D+      
Sbjct: 180 QNVQTFSDALAKNSDGIDKFLSSVSALSEELKGVSGKLDGTLKAAEGLLNAVDRDKIKSI 239

Query: 236 LQKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSK 295
           +  V+ +  N++ +S         V   V  V +  +  Q    K+D +L          
Sbjct: 240 VANVDTVTANLKQTSQQLDGVIKNVDTAVGSVNDFAKQTQGTLAKVDGVLDGVDPAQVRA 299

Query: 296 ETSAFLENIADSTSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSK 355
             +   +   ++            +  ++   I  TI   + +   LND+S +   ++++
Sbjct: 300 ALANIQKASENANKAAADIAVVTEKFANRADDIDQTIKDAKQLAQRLNDASVRVDGILAR 359

Query: 356 INNISALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKL 415
           ++ +    + + L  DA+  + +F+  ++ +N  +  I +NL  FS  GL++++ LV+  
Sbjct: 360 VDTLLGSGQADGLMADARDTLKSFKQVADTLNARLGVITDNLARFSGQGLSNVEALVQDS 419

Query: 416 QETVNHFDDCLNNFERNPQDIVWGREKGSVKIY 448
           + ++   ++ + +  RNPQ I+ G + G V+ +
Sbjct: 420 RRSITRIEEAVTDLSRNPQRILSGGD-GEVRQF 451


>gi|319783793|ref|YP_004143269.1| hypothetical protein Mesci_4106 [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317169681|gb|ADV13219.1| Mammalian cell entry related domain protein [Mesorhizobium ciceri
           biovar biserrulae WSM1271]
          Length = 457

 Score =  200 bits (507), Expect = 4e-49,   Method: Composition-based stats.
 Identities = 105/453 (23%), Positives = 202/453 (44%), Gaps = 7/453 (1%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++  Y  VG+F ++ +  +F  +YW +      G    + +RIPGS  GL   S V F
Sbjct: 1   METRANYVIVGIFTLAAILAAFAFVYWTAAIGD-KGETTLLRVRIPGSASGLGRGSFVLF 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NG+ VG +  +++D + P  ++A   I   TP+  ST A I   GL G   IEL     +
Sbjct: 60  NGVKVGDVKRVYIDVDNPTVAIADTEIDRMTPITKSTQADIGLAGLTGQANIELKGADPK 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
           +  +   A +  + A I A PS +   +  A+N   +       ++   +++  PLT T+
Sbjct: 120 EVKLLDQAEKEGKVAEIVANPSAVTNLLQTAQNIFTRADKVLTELEGFTKDVRGPLTQTV 179

Query: 181 ANIETISTVLANNISHIDKMMHTTQV-----TPHSSDSKNTFNTITDLITSLDKMIKAID 235
            N++T S  LA N   IDK +             S     T      L+ ++DK      
Sbjct: 180 QNVQTFSDALAKNSDGIDKFLSAASTLADELKGVSGKLDGTLKAAEGLLNAVDKDKIKSI 239

Query: 236 LQKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSK 295
           +  V+ +  N++ +S         V   V  V +  +  Q    K+D++L          
Sbjct: 240 VANVDAVTGNLKETSKQLDGVIKNVDTAVGSVNDFAKRTQGTLAKVDNVLDGIDPAQVRS 299

Query: 296 ETSAFLENIADSTSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSK 355
             +   +    +            +  ++   I  TI   + +   LND+S +   +++K
Sbjct: 300 ALANIQKASESADKAAADIAEVTHKFANRADDIDQTIKDAKQLAQRLNDASVRVDGILAK 359

Query: 356 INNISALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKL 415
           ++ +    + + +  DA+  + +F+  ++ +N  +  I +NL  FS  GL++++ LV+  
Sbjct: 360 VDTLLGSGQADGVMADARATLKSFKQVADTLNARLGVITDNLARFSGQGLSNVEALVQDS 419

Query: 416 QETVNHFDDCLNNFERNPQDIVWGREKGSVKIY 448
           + +++  ++ + +  RNPQ I+ G + G V+ +
Sbjct: 420 RRSISRIEEAVTDLSRNPQRILSGGD-GEVRQF 451


>gi|254512617|ref|ZP_05124683.1| mammalian cell entry related domain protein [Rhodobacteraceae
           bacterium KLH11]
 gi|221532616|gb|EEE35611.1| mammalian cell entry related domain protein [Rhodobacteraceae
           bacterium KLH11]
          Length = 438

 Score =  183 bits (463), Expect = 5e-44,   Method: Composition-based stats.
 Identities = 72/449 (16%), Positives = 156/449 (34%), Gaps = 13/449 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++  Y  +G F ++ +  +F    WL++        A   +    +V GLS    V +
Sbjct: 1   METRANYILIGAFTLAGILGAFGFFLWLAKFE-VTRQYAYYDVLF-DNVSGLSAAGGVNY 58

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NG+PVG+++ L LD++ P+    +  +  D P+   T A +++ G+ G+ Y+ELS     
Sbjct: 59  NGLPVGQVISLNLDEDDPSKVRVRLEVDADIPVTKQTIAQLQSLGVTGVAYVELSGGSPT 118

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQK--IIENIEKPLTT 178
            + + Q +   ++R+ I +   G    +  A    + ++       +  + + +      
Sbjct: 119 AERLAQNSVIPSKRSSIQSLLEGAPEVLEQAVTLLENLNSVVDDNNRKAVSDILNNLAGA 178

Query: 179 TIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQK 238
           +    +T++   + +             T       +T  T     T   K +K      
Sbjct: 179 SGKLDKTLADFQSLSSDLGGAAKDIGAFTKRLDTLADTAETTLTTGTDTLKSVKQASEAA 238

Query: 239 VNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETS 298
              +                 +   V    +       + ++    L   +    +  T+
Sbjct: 239 KTALETANGTLQTAEETLQQDIRPFVERGSKLADHLIVLSEQGSLALGTITETFTNANTT 298

Query: 299 AFLENIADSTSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINN 358
               + A   +    + +        R       +  E+I    N  +   A +  KI+ 
Sbjct: 299 LASIDSAMEAAKATLASAESAFDAANRVMDQDIASVAEDIRKAANQVAATVANVTEKIDK 358

Query: 359 ISALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQET 418
           IS          D   A  +  D    I+  +      + +F + GL+     + + Q  
Sbjct: 359 IS---------DDILSASQSASDLLGTIDGIVQDNRRQVSDFLRVGLSQFVRFIEESQRL 409

Query: 419 VNHFDDCLNNFERNPQDIVWGREKGSVKI 447
           V   D  ++  ER+P   + G +    + 
Sbjct: 410 VISLDRLVDKVERDPARFLLGTQASEFRQ 438


>gi|260430756|ref|ZP_05784728.1| mammalian cell entry related domain protein [Silicibacter
           lacuscaerulensis ITI-1157]
 gi|260418197|gb|EEX11455.1| mammalian cell entry related domain protein [Silicibacter
           lacuscaerulensis ITI-1157]
          Length = 438

 Score =  179 bits (453), Expect = 6e-43,   Method: Composition-based stats.
 Identities = 69/449 (15%), Positives = 160/449 (35%), Gaps = 13/449 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++  Y  +G F ++ +  +F    WL++        A   +    +V GLS    V +
Sbjct: 1   METRANYILIGAFTLAGILSAFGFFLWLAKFE-VTRQYAYYDVLF-DNVSGLSAAGGVSY 58

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NG+PVG+++ L LD + P+    +  I  D P+   T A +++ G+ G++Y+ELS    +
Sbjct: 59  NGLPVGQVIALDLDDDDPSKVRVRLEIDADIPVTTDTIAQLQSLGVTGVSYVELSGGSPD 118

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQK--IIENIEKPLTT 178
            + + Q +  +++R+ I +   G    +  A    + ++       +  + + ++   + 
Sbjct: 119 AERLPQFSVIKSKRSAIQSLFEGAPKVLDEAVTLLENLNAVVDDDNRKAVADILDNLASA 178

Query: 179 TIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQK 238
           +    +T++     +             T       +T  T     T     IK      
Sbjct: 179 SGRLDKTLTDFETLSGDLGGAAKEIGAFTKRLDTLADTAETTLTTGTETLDSIKTAADSA 238

Query: 239 VNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETS 298
              +    +  +         +   +    E       +  +    ++  ++  ++   +
Sbjct: 239 KTALDGANKTLATADQVLEQDIRPFIARGSELADRLIGLSDEASVTMATVNTTFQNANQT 298

Query: 299 AFLENIADSTSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINN 358
                 A   +    + +     +  R           +I +  N  ++  + +  +I+ 
Sbjct: 299 LDSVTSAMEAAKGTLTSAERAFDSANRVMDEDVATVAADIRTAANQVAETVSNVTQRIDA 358

Query: 359 ISALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQET 418
           IS          D   A  +  D    I+  +      + +F + GL      V + Q  
Sbjct: 359 IS---------ADILSASQSASDLLGTIDGIVQQNRRQVSDFLRVGLPQFVRFVEESQRL 409

Query: 419 VNHFDDCLNNFERNPQDIVWGREKGSVKI 447
           V   D  ++  ER+P   + G +    + 
Sbjct: 410 VISLDRLVDKVERDPARFLLGTQASEFRQ 438


>gi|90417913|ref|ZP_01225825.1| conserved hypothetical protein [Aurantimonas manganoxydans
           SI85-9A1]
 gi|90337585|gb|EAS51236.1| conserved hypothetical protein [Aurantimonas manganoxydans
           SI85-9A1]
          Length = 649

 Score =  148 bits (372), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 92/431 (21%), Positives = 171/431 (39%), Gaps = 9/431 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K  Y  VGLF + ++  SF  +YW +           +++RI GSV GL   S V F
Sbjct: 1   METKANYVRVGLFTMLVIALSFGFVYW-AIFATSGSERVRLLVRIEGSVTGLQQGSQVLF 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NG+PVG +  L LD   P   +A   + PD P+  ST A I  QGL G  ++EL   + +
Sbjct: 60  NGLPVGSVKALRLDSNNPEVVIATTEVDPDLPIKASTQANIGFQGLTGAAFVELKGGQAD 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
           +  I   A E+    +I A PS +   ++ A + + + +      + ++  +   + TT+
Sbjct: 120 EADIIGEAAEQGTVPVIKANPSDVTDILATARDIADRANSILGQFESLVGTVGPSVETTV 179

Query: 181 ANIETISTVLANNISHIDKMMHTTQVT-----PHSSDSKNTFNTITDLITSLDKMIKAID 235
            N+   S  +    + + +               SS +      +   I     ++ A+D
Sbjct: 180 ENVAQTSRNIETFTASLAENSDDIDNFLTSLSQLSSSANTVAEELPGAIRQAKNILDAVD 239

Query: 236 LQKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSK 295
              V  +++N+   S+     SD + +    V+    +  EVG  I    +   S + + 
Sbjct: 240 PASVTTVVDNVAAVSDTLRAQSDNLDSIFASVQTAADSVGEVGDVIRRNTTGIDSFVSNL 299

Query: 296 ETSAFLENIADSTSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSK 355
              A          +     +          ++  TI  I +   N++  ++        
Sbjct: 300 GPLAEKATAVADRLDTTLQSANTVVAAIDPAQVSKTIEGISSAAENVSSLAETIGAQKEA 359

Query: 356 INNISALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKL 415
           IN  SA+   ++  ++  R   T  + SE +++ + S+G    N +Q+        V   
Sbjct: 360 IN--SAIAGASNAAQNVNRITTTIVERSEDVDKLLASLGPITDNITQASTG-FNEAVASA 416

Query: 416 QETVNHFDDCL 426
              +   D   
Sbjct: 417 NALIGSVDSAT 427



 Score = 83.4 bits (203), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 44/199 (22%), Positives = 82/199 (41%), Gaps = 3/199 (1%)

Query: 251 NNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSN 310
                  D V  TV  +  T   F E   + D LL+       +           +  + 
Sbjct: 447 EQIQSIIDGVERTVQTLDTTLTGFTETRTQFDTLLASIDPGKVNTAVENVSAATGNVAAA 506

Query: 311 MRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNIS-ALKENNSLF 369
             S      ++  +R+ I + I   +  +  L+ +S +   +++ +N +     +  SL 
Sbjct: 507 ADSIAKVANDVGARREDIDAIITNAKTTSEQLSAASGRIDSVVNSVNRVLAGAGDGTSLG 566

Query: 370 KDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNF 429
            D  RA+ + R  ++ I   +  I  NLQ FS  GL +++ L+  +  TV+  D  + +F
Sbjct: 567 VDLARALRSVRGAADSIQTQVTPISANLQRFSGEGLREVRGLISNVNRTVDRIDSAVEDF 626

Query: 430 ERNPQDIVWGREKGSVKIY 448
             NP  +++G E   VK Y
Sbjct: 627 TTNPSRLIYGGE--DVKQY 643


>gi|304391806|ref|ZP_07373748.1| ABC transporter, substrate binding protein [Ahrensia sp. R2A130]
 gi|303296035|gb|EFL90393.1| ABC transporter, substrate binding protein [Ahrensia sp. R2A130]
          Length = 551

 Score =  146 bits (366), Expect = 8e-33,   Method: Composition-based stats.
 Identities = 83/435 (19%), Positives = 185/435 (42%), Gaps = 13/435 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++     VGLF++S L  SF  +YW       D  M  + +RI G+V GL   S V+F
Sbjct: 1   METRANTIVVGLFMLSALVASFALVYWFGAVGDKDR-MQRLDVRIQGAVSGLVEGSIVQF 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NGI VGR+ GL  D++ P       L+ PD PL   T  ++  +GL+G ++I+L     +
Sbjct: 60  NGITVGRVTGLAYDKDDPRFVTVNTLVEPDVPLREDTRVSVGARGLSGGSFIQLEGGTPD 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
              + Q  T R+    +   PS     I    + + +       ++  +E  ++ ++ T+
Sbjct: 120 ALRLVQPNTPRDGVVELKGNPSAFTDIIDQVGSIAVRAEKVVGVLEGFVERNDQVISDTL 179

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
            N    S  LA+N   +++ + + Q    S   +     I   +T ++ ++ A+D Q V+
Sbjct: 180 INTRKFSKALADNSEGVEQFLASAQSVGVS--LEALSGKIDGTVTRVEAILAAVDPQTVS 237

Query: 241 QILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAF 300
             LEN++  +        ++   +    +     +    ++  ++      +++ E +  
Sbjct: 238 GTLENVESFTKGLADQRAEIETLIQAAGQAVADVRGATARVGPIIGRIEETVQAVEPARV 297

Query: 301 LENIADSTSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNIS 360
              IA+       + + +       + +  TI+ +E  +S++  ++ +  +++S I+   
Sbjct: 298 RTAIANLDQATARARAVLEV--VDEESVQRTISNVERASSSIVTATGRANDIISAIDA-- 353

Query: 361 ALKENNSLFKDAQRAMHTFRDTSEKIN-RYIPSIGNNLQN---FSQSGLNDIQNLVRKLQ 416
             +   +L  D + A          ++   + +  +++      +     D + +V  ++
Sbjct: 354 --ETVKALVADMRVATQNVSTLLAAVDAERVNAAVDDVSKAARAASEAATDARGIVTDVR 411

Query: 417 ETVNHFDDCLNNFER 431
           +      +   + E+
Sbjct: 412 KVTQPLGERAGDVEK 426



 Score = 75.7 bits (183), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 36/190 (18%), Positives = 78/190 (41%)

Query: 258 DQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNMRSSISA 317
           + V   V D+R  TQ    +   +D    + +    SK   A  E   D+   +      
Sbjct: 354 ETVKALVADMRVATQNVSTLLAAVDAERVNAAVDDVSKAARAASEAATDARGIVTDVRKV 413

Query: 318 IREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNISALKENNSLFKDAQRAMH 377
            + + ++   +   +     + + LN+SS+K   L+ +  ++   + +  L  DA+  + 
Sbjct: 414 TQPLGERAGDVEKILTDTTELAARLNESSKKVDALLEQAGDLLGTEGDGGLAADARSTLA 473

Query: 378 TFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFERNPQDIV 437
            FR T+   +  +  I  ++   +  GL D   L+R   ++++  D  + N + NP  ++
Sbjct: 474 EFRRTARNFSGNMAQITGSVTKLADRGLGDTPALIRAATQSLSRLDRVIRNIQDNPSSLI 533

Query: 438 WGREKGSVKI 447
            G     V+ 
Sbjct: 534 SGSGGSRVRE 543


>gi|119385046|ref|YP_916102.1| hypothetical protein Pden_2315 [Paracoccus denitrificans PD1222]
 gi|119374813|gb|ABL70406.1| Mammalian cell entry related domain protein [Paracoccus
           denitrificans PD1222]
          Length = 433

 Score =  145 bits (363), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 63/447 (14%), Positives = 153/447 (34%), Gaps = 14/447 (3%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K  Y  +G F ++        + W ++  Q D   A   I  P  V GL   S V F
Sbjct: 1   METKANYVLIGAFTIAGFLGMLLFLMWFAKL-QLDRQFAYYDIYFPE-VSGLGVSSEVLF 58

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G+ VG++V + L          +  +  DTP+   + A+I  QG+ GI  + +++ R +
Sbjct: 59  AGLSVGKVVDMQLSPSVNGAVRVRVEVAEDTPVRTDSRASIEIQGVTGIANVAITSGRPD 118

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
              +     + +   +I A  S +            +++  +  + K++ +  +     I
Sbjct: 119 SPLLR--DVDPDSIPVIAANRSALQTLSEQGPEMLSRLNTVAEQLTKLLGDENQDRVRNI 176

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
            +    S+   +       +   T  T   + + +  +   + +  L    +        
Sbjct: 177 LDNVERSSANLD-----KALADVTTATDSIASAASDISAFGERLDGLSAAAETTLGNADT 231

Query: 241 QILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAF 300
            + +  + ++                    +   + + Q++D   +   S +      A 
Sbjct: 232 ALAKFNESAAKVDTALDSGTATLDEVRAYVSGDLKTLTQRLDQTAATLQSDLNRLTERAD 291

Query: 301 LENIADSTSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNIS 360
               +   +    S +                + +E + ++L  +  K  E + ++    
Sbjct: 292 QSLDSLDAALEVGSRTLASAERAFDGADRVINSNVEPVVADLRVTLGKANEAIDRV---- 347

Query: 361 ALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVN 420
            + +   +    + A  +       +   + S    +Q F++ GL     +   L+  V 
Sbjct: 348 -VADLPEITDRFRNAADSADAAFASLRGMLDSARAPVQAFTREGLPQFTRMASDLRGLVG 406

Query: 421 HFDDCLNNFERNPQDIVWGREKGSVKI 447
           + ++ ++   RNP  +  G      + 
Sbjct: 407 NVNELVSALRRNPSQVFSGPRVPEFRR 433


>gi|114707111|ref|ZP_01440009.1| putative ABC transporter protein [Fulvimarina pelagi HTCC2506]
 gi|114537307|gb|EAU40433.1| putative ABC transporter protein [Fulvimarina pelagi HTCC2506]
          Length = 938

 Score =  142 bits (357), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 85/435 (19%), Positives = 178/435 (40%), Gaps = 16/435 (3%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K  Y  VG+F +++L  +F  +YW S           +++RI GSV GL   S V+F
Sbjct: 1   METKANYVRVGIFTITVLALAFGFVYW-SVLATQSTTRVPLLVRITGSVTGLQQGSQVQF 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NG+PVG +  L LD   P   +A   + P  P+  ST A +    L G +YIEL   + +
Sbjct: 60  NGLPVGSVQSLELDPNNPRVVIASTTVEPGLPISESTDANLVANPLTGYSYIELRGGQID 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
           ++++ + A E+   A+ITA+PS +   +  A + +++ ++     + ++  +   +  + 
Sbjct: 120 QESLLEQAQEQGTIAVITASPSEVTDILQTARDIAERANNIMTQFENVVGTVGPSVEASA 179

Query: 181 ANIETISTVLANNISHIDKM-----MHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAID 235
            NI  I+  ++     +        +   ++T  +  +      + D I ++  ++ A+D
Sbjct: 180 QNITDITGNVSAFTDSLADNTDDIDLFIARLTDLAESANTVAQRLPDAIGNVQAILDAVD 239

Query: 236 LQKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSK 295
             +++ I++N+  +S +    ++ +      V+       ++G+ I        + + + 
Sbjct: 240 PAQISTIIDNVSATSVSIRDGAENLTAVTEAVQSAAAGVSQIGETIQRNADGIDAFIGNL 299

Query: 296 ETSAFLENIADSTSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSK 355
              +          +   S +         Q++  T++ +    SNL   S+  +     
Sbjct: 300 GPLSQTATSVARQLDTTVSSANEIFAAVDPQQVSDTLSGVSATASNLAAVSETVSNQRES 359

Query: 356 INNISALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKL 415
           I          S    A   M      +  I      I   L          I  L  +L
Sbjct: 360 IE---------SAITSASNTMQNIDTVTGTIANRTEQIDALLSRL-DPISESIGTLSTQL 409

Query: 416 QETVNHFDDCLNNFE 430
            +T +   + +++ E
Sbjct: 410 TDTASRIGEVVSSVE 424



 Score = 77.3 bits (187), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 41/209 (19%), Positives = 86/209 (41%), Gaps = 2/209 (0%)

Query: 241 QILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAF 300
            + E I   S+      D V   V  +      F +  ++ID +L++   ++ +   S  
Sbjct: 725 NLAETIGSKSDTIDSIIDGVDTAVGSLTTALNGFDQTRRQIDSILNEVEPQLVNNAVSNV 784

Query: 301 LENIADSTSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNI- 359
                +      S       I  ++ +I   +      +  +  +S K   +++ +N + 
Sbjct: 785 SSATNNIARAADSIGRVGDIINKRQDEIDEILTNANITSRQVAAASGKLDTVITSVNGLL 844

Query: 360 SALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETV 419
           S       L  +   A+   RDT++ +   +  +  NLQNFS S   ++Q+L R+L +TV
Sbjct: 845 SGSDAGRPLGVEVTEALRAIRDTAQSVQGQVGPLSANLQNFSDSTRREVQSLARQLNQTV 904

Query: 420 NHFDDCLNNFERNPQDIVWGREKGSVKIY 448
                 +++   +P  +++G E   V+ Y
Sbjct: 905 ERIGRAVDDIADDPSQVIFGGESN-VRTY 932


>gi|118588762|ref|ZP_01546170.1| ABC transporter, substrate binding protein [Stappia aggregata IAM
           12614]
 gi|118438748|gb|EAV45381.1| ABC transporter, substrate binding protein [Stappia aggregata IAM
           12614]
          Length = 668

 Score =  142 bits (356), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 80/452 (17%), Positives = 177/452 (39%), Gaps = 19/452 (4%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++  Y  +G F+V++L  +F  +YWL+ +        E+ I  PG V GL     V F
Sbjct: 1   METRANYILIGAFMVAVLIGAFGFVYWLAVTAD-SRQNVELKIVYPGPVTGLPVGGQVLF 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NGI VG +  L      P   +A   I+P TPL   T AT+   GL G+ Y++LS    E
Sbjct: 60  NGIKVGDVKSLDFAPGDPTKVVATIGIKPSTPLREDTKATLNFTGLTGVAYVDLSGGSSE 119

Query: 121 KKTIFQIATERNQRAMI--TATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTT 178
              +     ++++  +    A  S  +  +  A +  K+   + + +  ++++    +T 
Sbjct: 120 SPLLLSSNEDQDEDNIPVIYAERSFFDDIVDGARDVLKRADSTMKTVDDLLKDNGPAITE 179

Query: 179 TIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQK 238
            + N ET S  LA N   +   M    +   S    +    +  L+   ++++ A+   K
Sbjct: 180 IVNNAETFSAALAANSDGVKDFM--ASIGKASEAFSSLSARLETLVQEGERILAAVPSDK 237

Query: 239 VNQILENIQVSSNNFVKSSDQVINTVHDVRETTQ-------TFQEVGQKIDHLLSDFSSK 291
           V  I++++   S +  K+S  +   + D +   +          E   ++  ++   + +
Sbjct: 238 VTTIVDDLSKFSASLGKASSDIDLLMADAQSAAKELQTFTVNLNEGLDRVHKIVGAVNPE 297

Query: 292 MKSKETSAFLENIADSTSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAE 351
              K                      I   ++  Q + + +  I N    + D  Q   E
Sbjct: 298 DVQKVVQGAAALGEVLQKRTGDIDKLISSTSETMQNVNAVVENIRNQEGAIKDIVQGGRE 357

Query: 352 LMSKINNISALKENNSLFKD---AQRAMHTFRDTSEKINRYIPSIGNNLQNFS----QSG 404
           ++ K++ I       +   D    +  +      ++ +N  +  +   + +         
Sbjct: 358 VVVKVDAIMTRGVEIAAAIDPLKVEEVVANVSTFTDNLNASLGKVDELVASVDPEKVSKA 417

Query: 405 LNDIQNLVRKLQETVNHFDDCLNNFERNPQDI 436
           ++++ +++       +  ++ + + +   Q+ 
Sbjct: 418 VDNVSSIIDNFNNQQSQINEIIASTKSTVQNF 449



 Score = 70.0 bits (168), Expect = 8e-10,   Method: Composition-based stats.
 Identities = 32/230 (13%), Positives = 80/230 (34%), Gaps = 15/230 (6%)

Query: 226 SLDKMIKAIDLQKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLL 285
           +  +      +      ++N +  S       D++   + DV+   + F    Q  + L+
Sbjct: 429 NNQQSQINEIIASTKSTVQNFEAVSATVRGQDDRIAALITDVQAAAERFATTLQTANDLM 488

Query: 286 SDFSSKMKSKETSAFLEN--------------IADSTSNMRSSISAIREITDQRQKIIST 331
                +  +    +                  +  +     +      +++ +   +   
Sbjct: 489 KAVDPEKVANIVGSVETATSGLANPEDGIPAILESARKAADNVQRMTDDLSKRTPDVDQI 548

Query: 332 INTIENITSNLNDSSQKFAELMSKINNISALKENNSLFKDAQRAMHTFRDTSEKINRYIP 391
           I+  + +T+ LN +S +   L+ K++ +    +   L K+A  A    R  +        
Sbjct: 549 ISDAKQMTATLNSTSVRVESLVEKVSTMV-DGDGEGLIKEATLAAQAIRKVAVAFESRAD 607

Query: 392 SIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFERNPQDIVWGRE 441
           +I   L  F+  G  D    + ++  T+        +FER+P  +++G E
Sbjct: 608 AIAGGLSKFATQGSADFAAALAQVNRTLISIQRAAESFERSPNRVIFGGE 657


>gi|254503068|ref|ZP_05115219.1| mce related protein [Labrenzia alexandrii DFL-11]
 gi|222439139|gb|EEE45818.1| mce related protein [Labrenzia alexandrii DFL-11]
          Length = 667

 Score =  141 bits (354), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 95/456 (20%), Positives = 193/456 (42%), Gaps = 13/456 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++  Y  +G F+++ LF +F  IYWL+ + +      EV I  PG+V GL     V F
Sbjct: 1   METRANYILIGAFMIATLFSAFGFIYWLAVTAE-SRQNVEVKILFPGAVTGLPVGGQVLF 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NGI VG +  L      P   LA   IRP TPL   T AT+   GL G+ Y++L      
Sbjct: 60  NGIKVGDVSSLDFAPGDPTKVLATVRIRPSTPLREDTKATLNFTGLTGVAYVDLIGGTSS 119

Query: 121 KKTI--FQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTT 178
              +     +   N   +I A  S  +  +  A +  K+   + + + +++++    ++ 
Sbjct: 120 SPLLLNPDGSQTPNNIPLINAERSFFDDIVDGARDVLKRADSTMKTVDQLLQDNGPVISK 179

Query: 179 TIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQK 238
           TI N+ET S  LA N   +   M    +   S    +    +  L+   ++++ A+   K
Sbjct: 180 TIQNVETFSDALAANSDGVKDFM--ASIGKASDAFSSLSTRLEGLVDEGERLLAAVPSDK 237

Query: 239 VNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETS 298
           V  I++++Q  S +  K+S  +   + D +   +   E  ++++  L +  S +++ +  
Sbjct: 238 VTAIVDDLQAFSGSLGKASTDIDTLMADAQNAAKELTEFTERLNDGLGNVQSIVQAVKPE 297

Query: 299 AFLENIADSTSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINN 358
              + +  + +          +I +      +T+  + NI   L        ++++   +
Sbjct: 298 DIEKVMKGAAALGEVLEKRSGDIDELVVATSNTMQGVNNIVEMLRAREGTINDVITGTRD 357

Query: 359 ISALKENNSLFK-DAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVR--KL 415
           I    +       +    +   R   ++I   + ++   L N S   +++I   V    +
Sbjct: 358 IVGKVDAIVTRGVEIAAVIDPLR--VDEIVASVATLTEGL-NISLVRVDEIIASVDPATI 414

Query: 416 QETVNHFDDCLNNFERNPQDI--VWGREKGSVKIYK 449
            ETV+     ++NF      I  +    K +++ ++
Sbjct: 415 GETVDSVASIVDNFNNQQSQINEIIASTKSTIQNFE 450



 Score = 70.3 bits (169), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 36/237 (15%), Positives = 83/237 (35%), Gaps = 16/237 (6%)

Query: 226 SLDKMIKAIDLQKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLL 285
           +  +      +      ++N +  S       D++   V DV+   + F    Q  D LL
Sbjct: 429 NNQQSQINEIIASTKSTIQNFEAVSATVRGQDDRIAALVEDVQVAAERFASTLQSADELL 488

Query: 286 SDFSSKMKSKETSAFLEN-------------IADSTSNMRSSISAIREITDQRQKIISTI 332
                +  +    +                 +  +     +      +++ +   +   I
Sbjct: 489 RAVDPEKIANIVGSVETAASGLAGEDGIPAILQSARQAADNVQQMTADLSKRTPDVDQII 548

Query: 333 NTIENITSNLNDSSQKFAELMSKINNISALKENNSLFKDAQRAMHTFRDTSEKINRYIPS 392
              + +T+ LN +S +   L+ K++ +    +   L K+A  A    R  +        +
Sbjct: 549 TDAQQMTATLNSTSVRVESLVEKVSEMV-DGDGEGLIKEATLAAQAIRKVAVAFESRADA 607

Query: 393 IGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFERNPQDIVWGREKGSVKIYK 449
           I   L  F+  G  D+ + + +   T+        +FE++P  +++G E   V  Y+
Sbjct: 608 IAGGLSKFATQGSADLTSALAQFNRTLVSIQRAAQSFEQSPNRVIFGGE--DVPTYQ 662


>gi|328543114|ref|YP_004303223.1| ABC transporter, substrate binding protein [Polymorphum gilvum
           SL003B-26A1]
 gi|326412860|gb|ADZ69923.1| ABC transporter, substrate binding protein [Polymorphum gilvum
           SL003B-26A1]
          Length = 549

 Score =  140 bits (352), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 77/432 (17%), Positives = 162/432 (37%), Gaps = 16/432 (3%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++  Y  +G FV+ ILF +F  IYWL+ +         V +  PG V GL     V F
Sbjct: 1   METRANYVLIGGFVLGILFAAFVFIYWLAATVD-SRQSVNVKVIFPGPVTGLPIGGQVLF 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NGI +G +  L  DQ  P   +A   + P+ PL     AT+  QGL G+ Y++L     E
Sbjct: 60  NGIKIGDVGSLDFDQTDPQVVIATIRVNPNAPLRRDIRATLGFQGLTGVAYVDLKGGSTE 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
              + Q   E           S  +  + N  +  KK   +   +  +++     ++  +
Sbjct: 120 TPLLIQPDMESEPVIYADR--SFFDDILENGRDVLKKADTTLDTLNSVLQESRPAISEIV 177

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
            N+ET S  LA N   ++  M +      +    +    +  L+   ++++ A+   KV 
Sbjct: 178 RNVETFSKALAENADGVEGFMASVGKATEAF--SSLSGRMEGLVEQGERILAAVPSDKVE 235

Query: 241 QILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAF 300
           +++ N+   + +  + +  +   V +    T   Q+  ++++  +    + +K+      
Sbjct: 236 EMVGNVTDFTASLKEIAPDIRQMVAEAESATANLQQFTERLNAGMDGVEAVIKAVR---- 291

Query: 301 LENIADSTSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINN-I 359
                D    +  + +    +  +  ++ + I +      N+   S         I+  I
Sbjct: 292 ---PEDVEKAVAGAGALGAVLEKRSAELDTLIASTGETMDNIRSVSSSIRAREEDISAFI 348

Query: 360 SALKENNSLFKDAQRAMHTFRDTSE--KINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQE 417
           +  ++                   +  K++  + S+       S  G   I+  +   + 
Sbjct: 349 AGARDVVGKIGTGVERTTEVVQAIDPQKVSNIVASVEEVTGKLSGQG-EAIEATIASARN 407

Query: 418 TVNHFDDCLNNF 429
                +    + 
Sbjct: 408 AAGTIEKMSADL 419



 Score = 74.6 bits (180), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 29/138 (21%), Positives = 59/138 (42%), Gaps = 1/138 (0%)

Query: 304 IADSTSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNISALK 363
           IA + +   +      +++ +   +   I   + I +NLN +S +  E++SK+  +    
Sbjct: 402 IASARNAAGTIEKMSADLSARTADVDQIITDAKQIATNLNAASARVDEIVSKVGTMV-DG 460

Query: 364 ENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFD 423
           +      +A RA    R  +E        I + L  F+  G  D+   + ++  T     
Sbjct: 461 DGEGFIVEATRAAEAIRKVAEAFESRADGIASGLSKFANQGTADLTAALGQVNRTFVSIQ 520

Query: 424 DCLNNFERNPQDIVWGRE 441
             + NF+RNP  +++G E
Sbjct: 521 RAVENFDRNPNRVIFGGE 538


>gi|159044592|ref|YP_001533386.1| hypothetical protein Dshi_2048 [Dinoroseobacter shibae DFL 12]
 gi|157912352|gb|ABV93785.1| hypothetical protein Dshi_2048 [Dinoroseobacter shibae DFL 12]
          Length = 579

 Score =  140 bits (350), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 76/460 (16%), Positives = 160/460 (34%), Gaps = 43/460 (9%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++  Y  +GLF +  +          +R    D   A   IR   SV GLS  S VRF
Sbjct: 1   METRANYILIGLFTLLGILGMMAFFLLFARVE-LDRQFAYYDIRFS-SVSGLSEASDVRF 58

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           +G+PVG++V + L  E     + +  +  DTP+   + ATI  QG+ G++++ +S     
Sbjct: 59  SGLPVGQVVDVRLAPEQDGSIVVRVEVNADTPVRTDSVATIEAQGVTGVSFVGISGGTP- 117

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
              +   AT+     +               E  ++ +         + ++    L   +
Sbjct: 118 DAPLLVAATDAQVPEIEAGRSVLQTLSEDAPELITEALQIVQEVSALLTDDNRNLLRNIL 177

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
            N E  S   A+ + +   +  T           N          +         L  + 
Sbjct: 178 VNTEAASEEFASALENFSGVADTVNAFADQISRFNATLDTLTGEINDVLSTADTTLASIG 237

Query: 241 QILENIQVSSNNFVKSSDQVINTVHDVRETTQ-TFQEVGQKIDHLLSDFSSKMKSKETSA 299
            + E  +    +  +    + +++   +   +       ++   L++D  ++  +  T  
Sbjct: 238 ALSEETRRMVLDGEEVLSTLDDSLGAAQTYIEGDLAGATEEARALMADLRAQADTLGT-- 295

Query: 300 FLENIADSTSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNI 359
                 ++ + +    +     T +  +   T+  ++ + ++L  +S +    + +I+ +
Sbjct: 296 ------EAAALIEGFGATGDVATARLTEFAGTLAAVDRLVASLEATSGEVQVAVRRIDGL 349

Query: 360 SALK------ENNSLFKDAQRAMH---------------TFRDTSEKINRYIPSIGNNLQ 398
            A +      E  +L   AQ AM                  R  ++   R +  +G NL 
Sbjct: 350 VAEEGAPLLSETRALVATAQAAMEAVNAVATVDMPAIVADIRAATDTTTRVVAEVGENLS 409

Query: 399 NFSQ----------SGLNDIQNLVRKLQETVNHFDDCLNN 428
             S           S L D+    R   ET+   +  +  
Sbjct: 410 GASGRVEALIVSAHSTLADVTTTFRNANETLTAVNTAMET 449



 Score = 46.1 bits (106), Expect = 0.010,   Method: Composition-based stats.
 Identities = 29/201 (14%), Positives = 68/201 (33%), Gaps = 9/201 (4%)

Query: 256 SSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNMRSSI 315
           ++  +   V D+R  T T   V  ++   LS  S ++++   SA       +T+   ++ 
Sbjct: 379 ATVDMPAIVADIRAATDTTTRVVAEVGENLSGASGRVEALIVSAHSTLADVTTTFRNANE 438

Query: 316 SAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNISAL---------KENN 366
           +     T       +        TS     S+    +++ + +             ++  
Sbjct: 439 TLTAVNTAMETGDSALRAAESAFTSADRVMSEDLDGVIAALESTLGSLTGAVDSVAEDLP 498

Query: 367 SLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCL 426
            +  D + A         ++     + G  L+ F+ +GL     L ++ +  V + D   
Sbjct: 499 LISSDLRSASDAAARAFAEVEALAEAAGPRLETFATTGLPLYSRLAQEARVLVENLDRLT 558

Query: 427 NNFERNPQDIVWGREKGSVKI 447
           N   R+P   +        + 
Sbjct: 559 NQISRDPARFILNPNTPEFRR 579


>gi|218458932|ref|ZP_03499023.1| putative ABC transporter, substrate-binding protein [Rhizobium etli
           Kim 5]
          Length = 296

 Score =  139 bits (349), Expect = 7e-31,   Method: Composition-based stats.
 Identities = 102/295 (34%), Positives = 161/295 (54%), Gaps = 3/295 (1%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K  YT VG F V ++  +F  +YW++   +  GPM E+I+RIPGS +GLS  S VRF
Sbjct: 1   METKANYTIVGFFTVLVIAAAFGFVYWMAEYGR-GGPMTELIVRIPGSANGLSVGSPVRF 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NGI +G +  L +D + P +SLA   +R D P+YPST A +  QGL G  YIELS  RK 
Sbjct: 60  NGIQIGSVQTLSIDADDPQYSLAFTQVRTDAPIYPSTKAALEIQGLTGAAYIELSGGRKG 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
           +++I Q A + N+RA+I A  S +   ++ A+    + +D+   +Q  IE+   PLT T 
Sbjct: 120 EESILQHAIDNNKRAVIVADQSSVTNLLATADKILDRANDAVGELQGFIEDSRAPLTQTF 179

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
            N ET S  LA N  +ID  + +      S   K     +   + +++ ++KA+D QK++
Sbjct: 180 KNAETFSDALAKNSDNIDAFLQSVG--ELSDTVKAVSGRVDSTLQAVESLVKAVDAQKID 237

Query: 241 QILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSK 295
           +I+ N +  + N   +S  +   +    ET  TF + G++    L    + +   
Sbjct: 238 RIVSNAERITANVADASGDLRGAIQKFDETATTFNDFGKQAQATLDRVDTLVAQI 292


>gi|114764123|ref|ZP_01443362.1| Putative ABC transporter, periplasmic substrate-binding protein
           [Pelagibaca bermudensis HTCC2601]
 gi|114543481|gb|EAU46496.1| Putative ABC transporter, periplasmic substrate-binding protein
           [Roseovarius sp. HTCC2601]
          Length = 579

 Score =  138 bits (346), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 63/434 (14%), Positives = 154/434 (35%), Gaps = 19/434 (4%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++  Y  +G F ++       +  W +   Q D   A   I  P  V GLS  S VRF
Sbjct: 1   METRANYVLIGAFTLAGFLAMLAAFMWFANI-QLDRQFAYYDIDFPT-VSGLSDASDVRF 58

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           +G+PVG++V + L  E       +  I  DTP+   + ATI  QG+ G++Y+ +S    E
Sbjct: 59  SGLPVGQVVDVRLSPERDGTVRVRIEIGADTPVRADSVATIEAQGVTGVSYVGISAGTPE 118

Query: 121 KKTIFQIATERNQRAMITAT--PSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTT 178
              + +++ +         +   S           T + + D  +      +   + +  
Sbjct: 119 APLLSEVSDDDVPNIEAGQSVLQSLTEDAPLLVSETLRAVQDVRQLFGDENQAKVQSILD 178

Query: 179 TIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQK 238
            I +         ++ S +   + T        ++     +     T  D     + ++ 
Sbjct: 179 NIEDSSVAFAQALDDFSAVGGSVATFADQIDRFNNTLDSVSRDASATLADVREAVVSVRD 238

Query: 239 VNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETS 298
           +++    +       ++ +D  I +    R  T       +++   ++D  ++  +    
Sbjct: 239 LSEEARGVLEQGGGTLERADSAIGSAE--RYVTDQLGPATEQLQRSVADIETRFAAL--- 293

Query: 299 AFLENIADSTSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINN 358
                   +   + +        T +  +   T+     + +++  + +        ++ 
Sbjct: 294 -----SDSAGGLVETFTETGETATQRLTEARETLTATNEMIASIGATMESVDGAAQSVDT 348

Query: 359 ISALKENNSLFKDAQRAMHTFRDTSEKINRY----IPSIGNNLQNFSQSGLNDIQNLVRK 414
           +  + +  +L  + + A        E++       +P+I  ++++ + +    +  +   
Sbjct: 349 LI-VGDGTALVAELREATAQATRVIEEVGAVAETDLPAIIADIRSATDTASGVVSRVGED 407

Query: 415 LQETVNHFDDCLNN 428
           L       DD   N
Sbjct: 408 LSSASGQLDDLARN 421



 Score = 49.9 bits (116), Expect = 8e-04,   Method: Composition-based stats.
 Identities = 42/374 (11%), Positives = 98/374 (26%), Gaps = 3/374 (0%)

Query: 66  GRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKEKKTIF 125
           G +       +  N++L          L     A +  + L+      L       +   
Sbjct: 199 GSVATFADQIDRFNNTLDSVSRDASATLADVREAVVSVRDLSEEARGVLEQGGGTLERAD 258

Query: 126 QIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTIANIET 185
                  +       P+      S A+  ++  + S      +    E   T T    E 
Sbjct: 259 SAIGSAERYVTDQLGPATEQLQRSVADIETRFAALSDSAGGLVETFTETGETATQRLTEA 318

Query: 186 ISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVNQI-LE 244
             T+ A N            V   +             + +  +   A   + + ++   
Sbjct: 319 RETLTATNEMIASIGATMESVDGAAQSVDTLIVGDGTALVAELREATAQATRVIEEVGAV 378

Query: 245 NIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAFLENI 304
                                 V    +       ++D L  +    + S   +    N 
Sbjct: 379 AETDLPAIIADIRSATDTASGVVSRVGEDLSSASGQLDDLARNAGETLDSVRVTFTNAND 438

Query: 305 ADSTSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNISALKE 364
             S  N    I        ++    +     E +           A+L + +  ++   E
Sbjct: 439 TLSAINAALEIGDRALRAAEQAFQGADRVMNEEVAGIAESLRATLAQLETAVAEVAG--E 496

Query: 365 NNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDD 424
              + ++ + A  + +    +I   +      +  F+   L     L  + +  +N+ DD
Sbjct: 497 VPGVTEELRAASRSAQAAFAEIETAVGQSAPAVSAFATDALPQFGRLAVETRTLINNLDD 556

Query: 425 CLNNFERNPQDIVW 438
            +    R+P   + 
Sbjct: 557 LVERLGRDPGRFLL 570


>gi|307945711|ref|ZP_07661047.1| ABC transporter, periplasmic substrate-binding protein [Roseibium
           sp. TrichSKD4]
 gi|307771584|gb|EFO30809.1| ABC transporter, periplasmic substrate-binding protein [Roseibium
           sp. TrichSKD4]
          Length = 667

 Score =  137 bits (344), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 87/452 (19%), Positives = 174/452 (38%), Gaps = 19/452 (4%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++  Y  +G F+V  L  +F  IYWL+ + +         I  P  V GL     V F
Sbjct: 1   METRANYVVIGAFMVGTLALAFGFIYWLALTAETREN-VFFDIVFPAPVTGLPVGGQVLF 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NGI VG +  L  D+  P   +A   ++PDTPL   T AT+   GL G+ Y++L+    +
Sbjct: 60  NGIKVGDVSQLNFDRTDPTKVVATVRVKPDTPLRKDTKATLNFTGLTGVAYVDLNGGSLD 119

Query: 121 KKTIFQIATERNQ--RAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTT 178
              +F       +  R +I A  S  +     A +   KI  +   ++ ++ +    +T 
Sbjct: 120 SPLLFTGYENLGEGPRPVIYAEKSLFDDITGGARDVLHKIETTLDEVEGLLVDNRPAITK 179

Query: 179 TIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQK 238
            + N+ET ST LA+N   +   M +      +         +  L+   ++++ AI   K
Sbjct: 180 IVTNVETFSTALASNSDGVSDFMASLSSATEAF--VKLSGRMETLVVEGERILAAIPSDK 237

Query: 239 VNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEV-------GQKIDHLLSDFSSK 291
           V  I++N+ V +++  K    +   + D +   Q  ++           +  +++  + +
Sbjct: 238 VTDIVDNVDVFTDSLGKVGKDIEVVLADAQSAAQELEKFSVGLNAQLDSVGKIVAAVNPE 297

Query: 292 MKSKETSAFLENIADSTSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAE 351
              +  S                 + I   +     + S   TI     NL  + +    
Sbjct: 298 DVQQVVSGAASLGKVLKDRTSEINTLISASSTTMDNLASVSTTIREQDQNLVAAIESGKG 357

Query: 352 LMSKINNISALKENNSLF---KDAQRAMHTFRDTSEKINRYIPSIGNNLQNFS----QSG 404
           ++ K + + A              Q+ + +    +  +N  +  +   +        QS 
Sbjct: 358 VLEKADVMMARGIEIVDAVDPASVQQTVASVESFTTNLNASLGRVDAIVAAVDPVSVQSV 417

Query: 405 LNDIQNLVRKLQETVNHFDDCLNNFERNPQDI 436
           ++D   +V   +      ++ +     + Q+I
Sbjct: 418 VDDTAEIVSNFRAQEAQINEIITATRSSIQNI 449



 Score = 75.7 bits (183), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 26/139 (18%), Positives = 61/139 (43%), Gaps = 1/139 (0%)

Query: 304 IADSTSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNISALK 363
           I  + +  ++       +  +   +   I   + +T+NLN +S +   ++  +  +    
Sbjct: 521 ILSARATAQNVEKMSENLASRTPDVDQIITDAKQLTANLNATSVRIQGIVDNVGTMV-DA 579

Query: 364 ENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFD 423
           +   L K+A  A  + R  +E       +I + L  F+  G +D    + ++  T+    
Sbjct: 580 DGEGLIKEATAAAASIRKIAEAFESRAGTIADGLAKFANQGSSDFAAAMEQVNRTLISIQ 639

Query: 424 DCLNNFERNPQDIVWGREK 442
             + +F+RNPQ +++G E+
Sbjct: 640 RAVESFDRNPQRVIFGGEQ 658


>gi|170748372|ref|YP_001754632.1| hypothetical protein Mrad2831_1954 [Methylobacterium radiotolerans
           JCM 2831]
 gi|170654894|gb|ACB23949.1| Mammalian cell entry related domain protein [Methylobacterium
           radiotolerans JCM 2831]
          Length = 360

 Score =  137 bits (344), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 89/448 (19%), Positives = 165/448 (36%), Gaps = 92/448 (20%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++  Y  +G F ++++   F ++ WLS           V I   GSV GLS  SSV F
Sbjct: 1   METRANYALIGAFTIAVILAGFGTVLWLSG-GSSRQVSQLVRIVFSGSVGGLSRGSSVNF 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NGI VG +  + L  + P   LA   + P TPL   T A + +  L G++ I LS    +
Sbjct: 60  NGIKVGEVTDIRLAPQDPRRVLATIKVDPATPLRADTRARLDSAMLTGVSVISLSGGNAD 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
              +  +A    +   I A  S +   ++ A   +++  D    + +++   E  +  ++
Sbjct: 120 APVLTPMA--NGEPPTIFADSSDMQDMMALARQVAQRADDMLARLDRLVSANEGAINRSL 177

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
           AN+ET S  LA+   +I  ++                              KA+D  K+ 
Sbjct: 178 ANVETFSKTLADAGPNISALV------------------------------KAVDGAKLG 207

Query: 241 QILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAF 300
           ++++N    S    K+S  +   +HD R           KID +L+   S + S      
Sbjct: 208 RVIDNADRFSAALSKASPDIEAGLHDARLLAGKLSASADKIDAVLNGAESFLGS------ 261

Query: 301 LENIADSTSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNIS 360
                          ++ +E +    +I +   ++ +        S+   +  + I    
Sbjct: 262 ---------------ASGQEGSSTFAEIRAAAISVRDAGKAFRTMSENLDKRTASI---- 302

Query: 361 ALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVN 420
                                 S    R   +    ++  S  G             T++
Sbjct: 303 ----------------------SANFGRLSGTGRREVEALSGDGQ-----------RTLS 329

Query: 421 HFDDCLNNFERNPQDIVWGREKGSVKIY 448
             +  + + ER+P  +++G  K S+  Y
Sbjct: 330 TLNRTVRSLERDPSQVIFGG-KPSLPEY 356


>gi|218679529|ref|ZP_03527426.1| putative ABC transporter, substrate-binding protein [Rhizobium etli
           CIAT 894]
          Length = 177

 Score =  135 bits (339), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 73/178 (41%), Positives = 108/178 (60%), Gaps = 1/178 (0%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K  YT VG F V ++  +F  +YW++   +  GPM E+I+RIPGS +GLS  S VRF
Sbjct: 1   METKANYTIVGFFTVLVIAAAFGFVYWMAEYGR-GGPMTELIVRIPGSANGLSVGSPVRF 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NGI +G +  L +D + P +SLA   +R D P+YPST A +  QGL G  YIELS  RK 
Sbjct: 60  NGIQIGSVQTLSIDADDPQYSLAFTQVRTDAPIYPSTKAALEIQGLTGAAYIELSGGRKG 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTT 178
           +++I Q A +  +RA+I A  S +   ++ A+    + +D+   +Q  I++   PLT 
Sbjct: 120 EESILQHAIDNGKRAVIVADQSSVTNLLATADKILDRANDAVGELQGFIQDSRAPLTQ 177


>gi|218513900|ref|ZP_03510740.1| putative ABC transporter, substrate-binding protein [Rhizobium etli
           8C-3]
          Length = 255

 Score =  134 bits (336), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 83/204 (40%), Positives = 121/204 (59%), Gaps = 1/204 (0%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K  YT VG F V ++  +F  +YW++   +  GPM E+I+RIPGS +GLS  S VRF
Sbjct: 1   METKANYTIVGFFTVLVIAAAFGFVYWMAEYGR-GGPMTELIVRIPGSANGLSVGSPVRF 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NGI +G +  L +D + P +SLA   +R D P+YPST A +  QGL G  YIELS  RK 
Sbjct: 60  NGIQIGSVQTLSIDADDPQYSLAFTQVRTDAPIYPSTKAALEIQGLTGAAYIELSGGRKG 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
           +++I Q A +  +RA+I A  S +   ++ A+    + +D+   +Q  I++   PLT T 
Sbjct: 120 EESILQHAIDNGKRAVIVADQSSVTNLLATADKILDRANDAVGELQGFIQDSRAPLTQTF 179

Query: 181 ANIETISTVLANNISHIDKMMHTT 204
            N ET S  LA N  +ID  + + 
Sbjct: 180 KNAETFSDALAKNSDNIDAFLQSV 203


>gi|188580087|ref|YP_001923532.1| Mammalian cell entry related domain protein [Methylobacterium
           populi BJ001]
 gi|179343585|gb|ACB78997.1| Mammalian cell entry related domain protein [Methylobacterium
           populi BJ001]
          Length = 360

 Score =  133 bits (334), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 82/448 (18%), Positives = 155/448 (34%), Gaps = 92/448 (20%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++  Y  +G F + ++  +F  ++WL   ++       + I   GSV GL+  S+V F
Sbjct: 1   METRANYVLIGAFTIGVVLAAFGFVFWLQGGSR-GQATQALRIVFSGSVGGLAKGSTVSF 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NGI VG  + + L  + P   +A   + P TPL   T A + +  L G++ I LS    +
Sbjct: 60  NGIKVGEALDVRLLPQDPRRVVAVVQVDPSTPLRADTRARLDSAMLTGVSQIALSGGSAD 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
              +   + ++       +  S I   ++ A+  +++  D  + + K++   E  +  T+
Sbjct: 120 APALTPGSGDKMPTIFADS--SDIQDMMAAAKQIAQRADDVLQRLDKVVAGNEGAINRTL 177

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
           AN+E  S  LA     I  ++                              K++D Q++N
Sbjct: 178 ANVEAFSKTLAEAGPSIAGLV------------------------------KSVDGQRLN 207

Query: 241 QILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAF 300
           +++EN    S     SS  +   +HD RE          +ID +L      + S      
Sbjct: 208 RVIENADTFSTALANSSPDIEAGLHDARELAAKLSASADRIDGVLKGAEGFLGSASGQQG 267

Query: 301 LENIADSTSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNIS 360
               A+      S   A +                                         
Sbjct: 268 AGTFAEIREAAISVRDAGKAFR-------------------------------------- 289

Query: 361 ALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVN 420
                 +L ++  +       +  +++         L                  Q T+N
Sbjct: 290 ------TLSENLDKRTANISTSFNRLSGTSRREVEALS--------------SDGQRTLN 329

Query: 421 HFDDCLNNFERNPQDIVWGREKGSVKIY 448
                  + ER+P  +++G  K S+  Y
Sbjct: 330 TLSRAARSLERDPSQVIFGG-KPSLPEY 356


>gi|163850326|ref|YP_001638369.1| hypothetical protein Mext_0893 [Methylobacterium extorquens PA1]
 gi|254559577|ref|YP_003066672.1| ABC transporter periplasmic protein [Methylobacterium extorquens
           DM4]
 gi|163661931|gb|ABY29298.1| Mammalian cell entry related domain protein [Methylobacterium
           extorquens PA1]
 gi|254266855|emb|CAX22654.1| putative ABC transporter, periplasmic protein [Methylobacterium
           extorquens DM4]
          Length = 360

 Score =  132 bits (330), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 89/448 (19%), Positives = 160/448 (35%), Gaps = 92/448 (20%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++  Y  +G F + ++  +F  ++WL   ++       + I   GSV GL+  S+V F
Sbjct: 1   METRANYVLIGAFTIGVVLAAFGFVFWLQGGSR-GQATQALRIVFSGSVGGLAKGSTVSF 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NGI VG  + + L  + P   +A   + P TPL   T A + +  L G++ I LS    +
Sbjct: 60  NGIKVGEALDVRLLPQDPRRVVAIVQVDPSTPLRADTRARLDSAMLTGVSQIALSGGSAD 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
              +   + ++       +  S I   ++ A+  +++  D  + + K++   E  +T T+
Sbjct: 120 APALTPGSGDKMPTIFADS--SDIQDMMAAAKQIAQRADDVLQRLDKVVAGNEGAITRTL 177

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
           AN+E+ S  LA     I  ++                              K++D Q++N
Sbjct: 178 ANVESFSKTLAEAGPSIAGLV------------------------------KSVDGQRLN 207

Query: 241 QILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAF 300
           +++EN +  S     SS  +   +HD R           KID +L      + S      
Sbjct: 208 RVIENAETFSTALANSSGDIQAGLHDARSLAAKLNASADKIDGVLKGAEGFLGSASGQQG 267

Query: 301 LENIADSTSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNIS 360
               A+      S   A R                          S+   +  + I    
Sbjct: 268 AGTFAEIREAAISVRDAGR---------------------AFRALSENLDKRTANI---- 302

Query: 361 ALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVN 420
                                 S   NR   +    ++  S  G           Q T+N
Sbjct: 303 ----------------------STSFNRLSGTSRREVEALSSDG-----------QRTLN 329

Query: 421 HFDDCLNNFERNPQDIVWGREKGSVKIY 448
                  + ER+P  +++G  K S+  Y
Sbjct: 330 TLSRAARSLERDPSQVIFGG-KPSLPEY 356


>gi|218528883|ref|YP_002419699.1| hypothetical protein Mchl_0853 [Methylobacterium chloromethanicum
           CM4]
 gi|240137397|ref|YP_002961868.1| putative ABC transporter, periplasmic protein [Methylobacterium
           extorquens AM1]
 gi|218521186|gb|ACK81771.1| Mammalian cell entry related domain protein [Methylobacterium
           chloromethanicum CM4]
 gi|240007365|gb|ACS38591.1| putative ABC transporter, periplasmic protein [Methylobacterium
           extorquens AM1]
          Length = 360

 Score =  131 bits (329), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 88/448 (19%), Positives = 159/448 (35%), Gaps = 92/448 (20%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++  Y  +G F + ++  +F  ++WL   ++       + I   GSV GL+  S+V F
Sbjct: 1   METRANYVLIGAFTIGVVLAAFGFVFWLQGGSR-GQATQALRIVFSGSVGGLAKGSTVSF 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NGI VG  + + L  + P   +A   + P TPL   T A + +  L G++ I LS    +
Sbjct: 60  NGIKVGEALDVRLLPQDPRRVVAIVQVDPSTPLRADTRARLDSAMLTGVSQIALSGGSAD 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
              +   + ++       +  S I   ++ A+  +++  D  + + K++   E  +  T+
Sbjct: 120 APALTPGSGDKMPTIFADS--SDIQDMMAAAKQIAQRADDVLQRLDKVVAGNEGAINRTL 177

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
           AN+E+ S  LA     I  ++                              K++D Q++N
Sbjct: 178 ANVESFSKTLAEAGPSIAGLV------------------------------KSVDGQRLN 207

Query: 241 QILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAF 300
           +++EN +  S     SS  +   +HD R           KID +L      + S      
Sbjct: 208 RVIENAETFSTALANSSGDIQAGLHDARSLAAKLNASADKIDGVLKGAEGFLGSASGQQG 267

Query: 301 LENIADSTSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNIS 360
               A+      S   A R                          S+   +  + I    
Sbjct: 268 AGTFAEIREAAISVRDAGR---------------------AFRALSENLDKRTANI---- 302

Query: 361 ALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVN 420
                                 S   NR   +    ++  S  G           Q T+N
Sbjct: 303 ----------------------STSFNRLSGTSRREVEALSSDG-----------QRTLN 329

Query: 421 HFDDCLNNFERNPQDIVWGREKGSVKIY 448
                  + ER+P  +++G  K S+  Y
Sbjct: 330 TLSRAARSLERDPSQVIFGG-KPSLPEY 356


>gi|254470341|ref|ZP_05083745.1| putative periplasmic binding protein for ABC transporter
           [Pseudovibrio sp. JE062]
 gi|211960652|gb|EEA95848.1| putative periplasmic binding protein for ABC transporter
           [Pseudovibrio sp. JE062]
          Length = 645

 Score =  131 bits (328), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 81/429 (18%), Positives = 168/429 (39%), Gaps = 10/429 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++    ++G FV++++  +F   +WL  +        ++ I  PG+V GL     V F
Sbjct: 1   METRANNIAIGAFVLTVVGIAFLFTFWLLSAGDRSSRR-DIKIIFPGAVTGLPIGGQVLF 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NGI +G +  L  D E P   +A   +  + PL   T A++   GL G+ Y++LS    E
Sbjct: 60  NGIKIGDVSALTYDAENPKLVVATVRVDANAPLRRDTVASLGFTGLTGVAYVDLSGGSSE 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
              +F  AT  +   ++ A  S     +  A++  +K   +  HI +++ N +  +  TI
Sbjct: 120 SPPLFSKAT--DTVPVMYARRSQFEDLLEGAKDIMRKADSTLTHIDELVMNAQPDVQKTI 177

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
            N+E  +  LANN   +D  +        S         I +L+   D ++  +   K+ 
Sbjct: 178 QNVEVFTQALANNAKGVDDFLSGVT--ETSKALTGLSGKIGNLVDRGDDLLANVPPDKLG 235

Query: 241 QILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAF 300
           QI+ N++  +N    S+D V   + + +  +        +++  L      + + +    
Sbjct: 236 QIVTNVESMTNKLSASTDGVGEIIANGKLASDQLVNFTTELNDELEQLEKVIAAVKPEEV 295

Query: 301 LENIADSTSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNIS 360
              +  ++           +I                +T  L  + +    ++   N  +
Sbjct: 296 GRILKGASDLGGVLTERRGDINTMLSSASVVAENARELTVELTKNKEAIDRIVK--NAET 353

Query: 361 ALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVN 420
           A  E     ++A R +   +  S++++  + S+    +  S      I   +        
Sbjct: 354 ASNEIVLTTQNANRILSMVK--SDQVSSIVTSVEKVTKTLSDKDQV-IAKAIDDAGAATA 410

Query: 421 HFDDCLNNF 429
           +  +  N  
Sbjct: 411 NIREVSNTI 419



 Score = 82.7 bits (201), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 35/206 (16%), Positives = 84/206 (40%), Gaps = 1/206 (0%)

Query: 240 NQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSA 299
            ++  N+  +S+   ++ D     + +     +             +D  +   +++T  
Sbjct: 434 REVGTNLSAASDQLSETMDNANTLISNTNGIVEAIDPAKVSNIVASADKVATTLAEKTPE 493

Query: 300 FLENIADSTSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNI 359
             + I +  +  +S      E+  +   +   I+  ++I +NLN +S +   ++ K++ +
Sbjct: 494 LSKAIDEIGNAAKSVNDMTTELKKKVPDVDKVIDQAKSIATNLNAASVRVNTILEKVDGM 553

Query: 360 SALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETV 419
               +     K+A  A  + R  ++   +    I   L   SQ G  D    +++L +T+
Sbjct: 554 V-SADGQGFIKEATDAAASIRKVADAFAKRAEPISLALLKLSQQGGQDFTAAMQQLNQTL 612

Query: 420 NHFDDCLNNFERNPQDIVWGREKGSV 445
                 +NNF+RNP  +++G     V
Sbjct: 613 IEIRRAVNNFDRNPNRVIFGGSDTPV 638


>gi|254449438|ref|ZP_05062875.1| mammalian cell entry related domain protein [Octadecabacter
           antarcticus 238]
 gi|198263844|gb|EDY88114.1| mammalian cell entry related domain protein [Octadecabacter
           antarcticus 238]
          Length = 579

 Score =  131 bits (328), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 67/454 (14%), Positives = 152/454 (33%), Gaps = 25/454 (5%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++  +  +GLF ++ +  S   + W +R    D   A   +R   SV GLS  S VRF
Sbjct: 1   METRANHILIGLFTLAGIVGSIALLLWFARVE-LDQQFAYYDVRFS-SVSGLSEASDVRF 58

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G+PVG++V + L  +     L +  +   TP+   + ATI +QG+ G++++ +S  R +
Sbjct: 59  AGLPVGQVVDVRLSPDRDGTVLVRLEVDASTPVRSDSIATIESQGVTGVSFVGISAGRPD 118

Query: 121 KKTIFQIA------TERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEK 174
              +   +          Q  +   +                     +   Q  +ENI K
Sbjct: 119 TGLLVPTSDTPVPQITAGQSVLQALSEDAPQLINEALTVIEGVSDLFAEDNQARVENILK 178

Query: 175 PLTTTIANIETISTVLANNISHIDKMMHTTQ-VTPHSSDSKNTFNTITDLITSLDKMIKA 233
                  ++       A     +++     +      +        +     +    +  
Sbjct: 179 NAEEASESLAATLEAFAEVPETVERFTVQVEAFNAILAGIAPEVEALLTTADTTVASLGT 238

Query: 234 IDLQKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMK 293
           +  +    ++      +      ++       D+ +TT   Q   + +   ++  S+  +
Sbjct: 239 LSSEAETMVITANDTLAVAQGTFNEAQRYINEDLTDTTYALQTTVEDLRAEIATISTDAR 298

Query: 294 SKETSAFLENIADSTSNMRSSIS-----------AIREITDQRQKIISTINTIENITSNL 342
           +   +     +A +   + +  +           +   +T     +          T  L
Sbjct: 299 TMLATFNGAGVAATDRIVEAGATLVMINDTLAQISKTTLTVGDAALQFDTLLQTQATPLL 358

Query: 343 NDSSQKFAELMSKIN--NISALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNF 400
            ++    A     IN    +A  +   +  D + A  T  DT  ++ + + +    +   
Sbjct: 359 AETRATVAAATDAINVIGTAAQTDLPVIVADIRAATQTATDTINQVAQDLTAASGRIDGL 418

Query: 401 S---QSGLNDIQNLVRKLQETVNHFDDCLNNFER 431
           S   Q+ L  +         T+      +   +R
Sbjct: 419 SLTAQTALTQVTETFANANTTLEAVTSAMETGDR 452



 Score = 40.3 bits (91), Expect = 0.73,   Method: Composition-based stats.
 Identities = 19/205 (9%), Positives = 62/205 (30%), Gaps = 9/205 (4%)

Query: 250 SNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTS 309
             +       +        +T     +        +   S   ++  T         +T+
Sbjct: 380 QTDLPVIVADIRAATQTATDTINQVAQDLTAASGRIDGLSLTAQTALTQVTETFANANTT 439

Query: 310 NMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNISA--LKENNS 367
               + +             +       I  +L+         ++ +N   A    +  +
Sbjct: 440 LEAVTSAMETGDRTLEVAERTFAGADRIINEDLDGIISGLETSLASLNGAIAQVSDDIPA 499

Query: 368 LFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLN 427
           +  + + A  +  +    +++ + + G ++  F+++GL     L  + +         ++
Sbjct: 500 ITAELRNASQSAAEAFRSLDQVVDNAGPSVTEFTRTGLPLYTRLAVETRG-------LIS 552

Query: 428 NFERNPQDIVWGREKGSVKIYKPKH 452
           N +R  Q I     +  +    P++
Sbjct: 553 NLDRLTQQIQRDPARFFLNQQSPEY 577


>gi|288962791|ref|YP_003453085.1| ABC transport system substrate-binding protein [Azospirillum sp.
           B510]
 gi|288915057|dbj|BAI76541.1| ABC transport system substrate-binding protein [Azospirillum sp.
           B510]
          Length = 319

 Score =  130 bits (324), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 40/153 (26%), Positives = 71/153 (46%), Gaps = 3/153 (1%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++  Y  VG FV++++        W+++  Q D       I   GSV GL   S VR+
Sbjct: 1   METRASYVLVGSFVLALVAGLLVFTAWIAKV-QLDETRETYRIYFTGSVTGLQQGSPVRY 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G+PVG +  + LD +          ++  TP+   + A++  QG+ G  Y+++S     
Sbjct: 60  RGVPVGTVADIRLDPDNVTRVRVTIQVQNGTPIMSDSIASLELQGITGGAYVQISGGTVG 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAEN 153
            K +   AT+ +    I + PS +   + +A  
Sbjct: 120 GKHL--TATDADGVPTIPSRPSSLTAVVDSAPQ 150



 Score = 70.0 bits (168), Expect = 8e-10,   Method: Composition-based stats.
 Identities = 20/200 (10%), Positives = 76/200 (38%), Gaps = 5/200 (2%)

Query: 247 QVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAFLENIAD 306
           +  +         + +    +     +  ++  +   +++     +  +   A  + +A+
Sbjct: 121 KHLTATDADGVPTIPSRPSSLTAVVDSAPQLVNRSLEVVTRLGEMLNGENQKAVADILAN 180

Query: 307 STSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNISALKENN 366
           + +       A   + +   +   T+N  E +   L  +  +  + ++ ++         
Sbjct: 181 ARTISAELAGASAGLEETMAQARRTLNGFETVGPQLARTLAQAHDTLATVDGT-----AK 235

Query: 367 SLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCL 426
            L  + +  + + + TS+ +N         +++F+ +GL ++  L+ +L++        +
Sbjct: 236 QLGGETRELLRSLKRTSDTLNALAAENREPVRDFTATGLYELTLLITQLRDLSGQLSRVV 295

Query: 427 NNFERNPQDIVWGREKGSVK 446
              E +P + ++G  +  V+
Sbjct: 296 TRIENDPSNFLFGGTRQGVE 315


>gi|298292075|ref|YP_003694014.1| hypothetical protein Snov_2099 [Starkeya novella DSM 506]
 gi|296928586|gb|ADH89395.1| Mammalian cell entry related domain protein [Starkeya novella DSM
           506]
          Length = 348

 Score =  128 bits (320), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 61/337 (18%), Positives = 121/337 (35%), Gaps = 3/337 (0%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++  YT +GLF ++++   FF ++W +  N   GP     +   G V GL T S+V F
Sbjct: 1   METRANYTIIGLFTLAVVAAGFFFVWWFTGLNN-RGPRTSYDVVFSGVVSGLQTGSAVTF 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NGIPVG + GL LD + P   +A   ++P+TP+   T A + +  L G++ + L     +
Sbjct: 60  NGIPVGEVTGLRLDAQDPRKVVATIAVQPNTPVKSDTRANLDSTLLTGLSSVGLVGGSTD 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
              +         R       S +   + +A     ++ D +  I  ++   +  + + I
Sbjct: 120 AAPLPPPPEGELPRIDANT--SAVQDLMRSAREVLGRVDDIATRIDDLLRANDSKIASVI 177

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
            N++  S  L +N  +ID  +           +              +K+   ID     
Sbjct: 178 DNVDKFSKALGDNAQNIDAFLRQVGGAADRISTLANNLDKVVTSFDPNKVGDTIDDVNRF 237

Query: 241 QILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAF 300
               +      N +  +   + T  + +           +I  L  +   +     T+  
Sbjct: 238 TQQLDGMAMKFNTILDNVNSMTTSEEGKGMFNEISSAATEIRKLAVNLDKRTAELSTNLN 297

Query: 301 LENIADSTSNMRSSISAIREITDQRQKIISTINTIEN 337
                        +    + + +  +           
Sbjct: 298 QFTGPGLRQYEALAADGRKTLAEIDRVFRKFERNPRQ 334



 Score = 82.7 bits (201), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 31/205 (15%), Positives = 74/205 (36%)

Query: 238 KVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKET 297
             + + + ++ +     +  D        +R        V   +D          ++ + 
Sbjct: 137 NTSAVQDLMRSAREVLGRVDDIATRIDDLLRANDSKIASVIDNVDKFSKALGDNAQNIDA 196

Query: 298 SAFLENIADSTSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKIN 357
                  A    +  ++       +    K+  TI+ +   T  L+  + KF  ++  +N
Sbjct: 197 FLRQVGGAADRISTLANNLDKVVTSFDPNKVGDTIDDVNRFTQQLDGMAMKFNTILDNVN 256

Query: 358 NISALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQE 417
           +++  +E   +F +   A    R  +  +++    +  NL  F+  GL   + L    ++
Sbjct: 257 SMTTSEEGKGMFNEISSAATEIRKLAVNLDKRTAELSTNLNQFTGPGLRQYEALAADGRK 316

Query: 418 TVNHFDDCLNNFERNPQDIVWGREK 442
           T+   D     FERNP+  ++G   
Sbjct: 317 TLAEIDRVFRKFERNPRQFLFGGSN 341


>gi|146280486|ref|YP_001170639.1| ABC transporter permease [Pseudomonas stutzeri A1501]
 gi|145568691|gb|ABP77797.1| ABC transporter permease [Pseudomonas stutzeri A1501]
          Length = 312

 Score =  128 bits (320), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 62/297 (20%), Positives = 126/297 (42%), Gaps = 7/297 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++ ++  +GLF V  +  +     WL +S+  D       I    +V GLS  S+V +
Sbjct: 1   METRAHHVLIGLFTVLAVGGALLFALWLGKSSM-DREYNYYEISFNRAVSGLSNGSAVEY 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           +GI VG +  L+L+ + P    A+  I   TP+   T A +    + G   I+L +   +
Sbjct: 60  SGIKVGDVEALWLEPDDPRKVRARIRIYSGTPIKQDTRARLALANITGSMIIQLHSGTPQ 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQ-KIIENIEKPLTTT 179
              +     +R +  +I A PS ++  + N E+    I++  R     + E+    +  T
Sbjct: 120 SPPLEG---KRGEPPLIIADPSPLSALLENGEDLMTNINNLLRSANLMLSEDNAGRIGRT 176

Query: 180 IANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKV 239
           +AN+E  ++VLA     + + +         +++      IT L  + + +I     Q +
Sbjct: 177 LANLEQATSVLAEQRGDLSEALTQLSQLGQQTNTA--LAEITRLTQNANGLIDDEGRQLL 234

Query: 240 NQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKE 296
           +   E++        +  + + +    +    Q F E+G  I+ L     +  +  +
Sbjct: 235 SSAGESMAALERATSRLDELLSSNQGALNNGLQGFSELGPAINELRGTLGALRRVTQ 291



 Score = 79.2 bits (192), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 27/178 (15%), Positives = 66/178 (37%), Gaps = 4/178 (2%)

Query: 273 TFQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNMRSSISAIREITDQRQKIISTI 332
               + +  + L+++ ++ ++S       +N       + +   A   + +QR  +   +
Sbjct: 139 PLSALLENGEDLMTNINNLLRSANLMLSEDNAGRIGRTLANLEQATSVLAEQRGDLSEAL 198

Query: 333 NTIENITSNLNDSSQKFAELMSKINNISALKENNSLFKDAQRAMHTFRDTSEKINRYIPS 392
             +  +    N +  +   L    N +    E   L   A  +M      + +++  + S
Sbjct: 199 TQLSQLGQQTNTALAEITRLTQNANGLI-DDEGRQLLSSAGESMAALERATSRLDELLSS 257

Query: 393 IGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFERNPQDIVWGREKGSVKIYKP 450
               L N    G +++   + +L+ T+          E NP   + GREK  ++ + P
Sbjct: 258 NQGALNN-GLQGFSELGPAINELRGTLGALRRVTQRLEDNPSGFLLGREK--IQEFTP 312


>gi|209964743|ref|YP_002297658.1| hypothetical protein RC1_1441 [Rhodospirillum centenum SW]
 gi|209958209|gb|ACI98845.1| conserved hypothetical protein [Rhodospirillum centenum SW]
          Length = 320

 Score =  127 bits (318), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 42/174 (24%), Positives = 79/174 (45%), Gaps = 4/174 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++  YT VG FV++++   F  + WL++  Q +G      I   G+V GL   S VR+
Sbjct: 1   MENRASYTIVGAFVLALVAGLFVFVVWLAKV-QLEGATTPYRIYFTGTVTGLVEGSPVRY 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G+ VG +  + LD +          +  DTP+     A++   G+ G  Y+E++   ++
Sbjct: 60  RGVAVGTVSDIRLDPDNVERVQVTVEVPEDTPIKTDALASLEPVGVTGGVYVEIAGGSRD 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEK 174
              +   A E     +I + PS I   ++ A      +   S  +  ++ +  +
Sbjct: 120 APLL---AAEEGGIPVIPSRPSTIAEVLAQAPQLLGNLIAISEKVSTLLNDENQ 170



 Score = 61.9 bits (147), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 21/196 (10%), Positives = 64/196 (32%), Gaps = 2/196 (1%)

Query: 253 FVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNMR 312
                  +           +   +  Q + +L++                  A   +   
Sbjct: 123 LAAEEGGIPVIPSRPSTIAEVLAQAPQLLGNLIAISEKVSTLLNDENQKAFAAILGNLAA 182

Query: 313 SSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKI--NNISALKENNSLFK 370
           +S  A   + +  Q +      ++ ++           ++++ +  +  +   E     +
Sbjct: 183 ASDGANTTMRNADQLVGELRTEVKAVSRQATQLLGNANKVVAGVGADVQTVAAELAKTSR 242

Query: 371 DAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFE 430
           D  R   +   T+E++   +      +++F+   L +   L  +LQ+   +        E
Sbjct: 243 DLTRLTSSLATTAEEVRAMVHENREPIRDFTNETLYEFGALTIQLQDLAANLSRVTGRLE 302

Query: 431 RNPQDIVWGREKGSVK 446
           R+P  +++G  +  V+
Sbjct: 303 RDPSQLIFGTGRTGVE 318


>gi|327478708|gb|AEA82018.1| ABC transporter permease [Pseudomonas stutzeri DSM 4166]
          Length = 312

 Score =  127 bits (317), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 58/296 (19%), Positives = 121/296 (40%), Gaps = 11/296 (3%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++ ++  +GLF V  +  +     WL +S+  D       I    +V GLS  SSV +
Sbjct: 1   METRAHHVLIGLFTVLAVGGALLFALWLGKSSM-DREYNYYEISFNRAVSGLSNGSSVEY 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           +GI VG +  L+L+ + P    A+  +   TP+   T A +    + G   I+L +   +
Sbjct: 60  SGIKVGDVEALWLEPDDPRKVRARIRVYAGTPIKQDTRARLALANITGSMIIQLHSGTPQ 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQ-KIIENIEKPLTTT 179
              +     +R +  +I A PS ++  + N E+    I++  R     + E+    +  T
Sbjct: 120 SPPLEG---KRGEPPLIIADPSPLSALLENGEDLMTNINNLLRSANLMLSEDNAGRIGRT 176

Query: 180 IANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKV 239
           +AN+E  ++VLA     + + +                N+    IT L +    +   + 
Sbjct: 177 LANLEQATSVLAEQRGDLSQALTQL------GQLGQQTNSALAEITRLTQNANGLIDDEG 230

Query: 240 NQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSK 295
            Q+L     S     +++ ++   + D +       +    +   +++    + + 
Sbjct: 231 RQLLSRAGDSMAALERATSRLDTLLSDNQGALNNGLQGFSDLGPAINELRGTLGAL 286



 Score = 77.7 bits (188), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 27/178 (15%), Positives = 65/178 (36%), Gaps = 4/178 (2%)

Query: 273 TFQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNMRSSISAIREITDQRQKIISTI 332
               + +  + L+++ ++ ++S       +N       + +   A   + +QR  +   +
Sbjct: 139 PLSALLENGEDLMTNINNLLRSANLMLSEDNAGRIGRTLANLEQATSVLAEQRGDLSQAL 198

Query: 333 NTIENITSNLNDSSQKFAELMSKINNISALKENNSLFKDAQRAMHTFRDTSEKINRYIPS 392
             +  +    N +  +   L    N +    E   L   A  +M      + +++  +  
Sbjct: 199 TQLGQLGQQTNSALAEITRLTQNANGLI-DDEGRQLLSRAGDSMAALERATSRLDTLLSD 257

Query: 393 IGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFERNPQDIVWGREKGSVKIYKP 450
               L N    G +D+   + +L+ T+          E NP   + GREK  ++ + P
Sbjct: 258 NQGALNN-GLQGFSDLGPAINELRGTLGALRRVTQRLEDNPSGFLLGREK--IQEFNP 312


>gi|319956952|ref|YP_004168215.1| mammalian cell entry related domain protein [Nitratifractor
           salsuginis DSM 16511]
 gi|319419356|gb|ADV46466.1| Mammalian cell entry related domain protein [Nitratifractor
           salsuginis DSM 16511]
          Length = 310

 Score =  126 bits (316), Expect = 6e-27,   Method: Composition-based stats.
 Identities = 51/295 (17%), Positives = 120/295 (40%), Gaps = 5/295 (1%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M SK  YT VGLFV+     +F   +WL++   ++       +     VDGL+ DS+V+ 
Sbjct: 1   MYSKINYTLVGLFVLLFTILAFAFAFWLAKYG-FEEKYDYYYLYFTEPVDGLTMDSTVKL 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G+ VG++  + +D         K  ++  TP+     A ++ QG+ G++Y+++   +K 
Sbjct: 60  KGVDVGKVSRIEIDPTNVERIRVKIRLKAGTPIVKGMYALLKLQGITGLSYVQIEGGKKG 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
              +        Q  +I   PS ++    +A     K+  ++  + K+     +   T I
Sbjct: 120 APRL---TAPEGQIPVIPTHPSLLHRLSESAPKFLDKLQHTADGLNKLFSQHNQQQLTKI 176

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
            N    +T  A  + +    +        +         + D +  +   ++      ++
Sbjct: 177 LNNTAEATGKAVAVENRLITLSDEFNRTLAHF-DRRSAQLVDSVDQVTDTLQKKLPPLMD 235

Query: 241 QILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSK 295
            + E  +  ++       ++    +D+R+  +  Q   +++ +   + +  +K+ 
Sbjct: 236 HVDEAGRNIADLARGIDRRLKRGEYDLRKMIRPIQIDIKELSYSYQELAEDLKNL 290



 Score = 47.6 bits (110), Expect = 0.004,   Method: Composition-based stats.
 Identities = 22/177 (12%), Positives = 56/177 (31%), Gaps = 12/177 (6%)

Query: 268 RETTQTFQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNMRSSISAIREITDQRQK 327
              +++  +   K+ H     +            + + ++      +++    +     +
Sbjct: 141 HRLSESAPKFLDKLQHTADGLNKLFSQHNQQQLTKILNNTAEATGKAVAVENRLITLSDE 200

Query: 328 IISTINTIENITSNLNDSSQKFAELMSKINNISALKENNSLFKDAQRAMHTFRDTSEKIN 387
              T+   +  ++ L DS  +  + + K        +   L      A     D +  I+
Sbjct: 201 FNRTLAHFDRRSAQLVDSVDQVTDTLQK--------KLPPLMDHVDEAGRNIADLARGID 252

Query: 388 RYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFERNPQDIVWGREKGS 444
           R +     +L+   +    DI+ L    QE          N  R+P  +++G     
Sbjct: 253 RRLKRGEYDLRKMIRPIQIDIKELSYSYQELAEDLK----NLSRHPSSLIFGAGSPP 305


>gi|77456267|ref|YP_345772.1| hypothetical protein Pfl01_0039 [Pseudomonas fluorescens Pf0-1]
 gi|77380270|gb|ABA71783.1| conserved hypothetical protein [Pseudomonas fluorescens Pf0-1]
          Length = 312

 Score =  126 bits (315), Expect = 7e-27,   Method: Composition-based stats.
 Identities = 53/302 (17%), Positives = 115/302 (38%), Gaps = 2/302 (0%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++ ++  +GLF V ++  +     WL++S+  D    +  +    +V GLS  S V++
Sbjct: 1   METRAHHVLIGLFTVIVVAGALLFGLWLAKSS-VDTEFKDYEVVFNEAVSGLSRGSPVQY 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           +GI VG +V L LD + P   LA+  +  DTP+   T A +   G+ G + I+LS    +
Sbjct: 60  SGIKVGDVVSLRLDPKDPRRVLARIRLAGDTPVKEDTEAKLALAGITGTSIIQLSGGTPQ 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
              +              +  S +    ++  +    +  ++  +    +NIE+   T  
Sbjct: 120 SSKLKGHDGNLPTIVASPSPISRLLSDSNDLMSGVTTLLSNANQM-FSADNIERVSKTLE 178

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
              +T  ++          M     V   + +     + +      L        L    
Sbjct: 179 HLEQTTGSINDQRGDLRQAMQQLATVGKQAGNMLEQTSALMRNANGLLNDQGKQALGSAE 238

Query: 241 QILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAF 300
           Q +++++ SS        +  N++    +         +++   L+   +  +  E +  
Sbjct: 239 QAMKSLEQSSVTINGLLSKNQNSLDSGMQGLNGLAPAIRELRETLNSLRAISQRLEANPS 298

Query: 301 LE 302
             
Sbjct: 299 GY 300



 Score = 73.0 bits (176), Expect = 8e-11,   Method: Composition-based stats.
 Identities = 35/178 (19%), Positives = 71/178 (39%), Gaps = 4/178 (2%)

Query: 273 TFQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNMRSSISAIREITDQRQKIISTI 332
               +    + L+S  ++ + +       +NI   +  +         I DQR  +   +
Sbjct: 139 PISRLLSDSNDLMSGVTTLLSNANQMFSADNIERVSKTLEHLEQTTGSINDQRGDLRQAM 198

Query: 333 NTIENITSNLNDSSQKFAELMSKINNISALKENNSLFKDAQRAMHTFRDTSEKINRYIPS 392
             +  +     +  ++ + LM   N +   +   +L   A++AM +   +S  IN  +  
Sbjct: 199 QQLATVGKQAGNMLEQTSALMRNANGLLNDQGKQAL-GSAEQAMKSLEQSSVTINGLLSK 257

Query: 393 IGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFERNPQDIVWGREKGSVKIYKP 450
             N+L +    GLN +   +R+L+ET+N         E NP   + G +K   K + P
Sbjct: 258 NQNSLDS-GMQGLNGLAPAIRELRETLNSLRAISQRLEANPSGYLLGSDKN--KEFTP 312


>gi|182680565|ref|YP_001834711.1| hypothetical protein Bind_3670 [Beijerinckia indica subsp. indica
           ATCC 9039]
 gi|182636448|gb|ACB97222.1| Mammalian cell entry related domain protein [Beijerinckia indica
           subsp. indica ATCC 9039]
          Length = 353

 Score =  126 bits (315), Expect = 7e-27,   Method: Composition-based stats.
 Identities = 75/344 (21%), Positives = 134/344 (38%), Gaps = 8/344 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++  Y  +G F ++++   F  I W S SN+       + +   GS+ GLS   +V F
Sbjct: 1   METRANYALIGGFTLAVIVSIFLFILWFSGSNRPAHQ-VPLRVLFNGSISGLSRGGAVLF 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NG+ VG +  + L  + P+   A  +I    PL   T A +    L GI  + L+    +
Sbjct: 60  NGVKVGEVTHIDLAPDDPSRVQADVVIDARVPLRSDTKARLEFTNLTGIAALALTGGSSD 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
              +   A      ++I A  S     + +A   + + S+       ++++    L  TI
Sbjct: 120 APPLPAAA--DGGPSVIRADRSDFQDLLESARRIATQASEFLDRANGLVDSNSASLGKTI 177

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
            N E  S  LA N   I   M    +       K     +  L T  DK++K+I+  +V 
Sbjct: 178 KNAEKFSDALAANSDGIKDFM--GSMADIGRTIKPLTGKLETLATDTDKVVKSIEPDRVK 235

Query: 241 QILENIQVSSNNFVKSSDQVINTVHDVRETT--QTFQEVGQKIDHLLSDFSSKMKSKETS 298
            ILE+    S     + +++   +  +         +     I    S+ +S  K+   +
Sbjct: 236 SILEHADSFSGKLDAAGNKIEGVMASLESFLGSGESKNALNDIKGSFSEVASAAKAVRRA 295

Query: 299 AFLENIADSTSNMRSSISAIREITDQRQKIISTINTIENITSNL 342
           A   N   + S +R   +   +       I   + +IEN     
Sbjct: 296 ADNIN-RFAGSGLRQYEALAVDGRKTLDTISQAVRSIENNPQQF 338



 Score = 76.1 bits (184), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 25/197 (12%), Positives = 73/197 (37%), Gaps = 5/197 (2%)

Query: 253 FVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNMR 312
             +++  V +    + +T +  ++    +          M S                  
Sbjct: 159 LDRANGLVDSNSASLGKTIKNAEKFSDALAANSDGIKDFMGSMADIGRTIKPLTGKLETL 218

Query: 313 SSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNISALKENNSLFKDA 372
           ++ +     + +  ++ S +   ++ +  L+ +  K   +M+ + +     E+ +   D 
Sbjct: 219 ATDTDKVVKSIEPDRVKSILEHADSFSGKLDAAGNKIEGVMASLESFLGSGESKNALNDI 278

Query: 373 QRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFERN 432
           + +       +    + +    +N+  F+ SGL   + L    ++T++     + + E N
Sbjct: 279 KGSFSEVASAA----KAVRRAADNINRFAGSGLRQYEALAVDGRKTLDTISQAVRSIENN 334

Query: 433 PQDIVWGREKGSVKIYK 449
           PQ  ++G+ K S+  Y 
Sbjct: 335 PQQFLFGK-KSSIPEYT 350


>gi|330806717|ref|YP_004351179.1| hypothetical protein PSEBR_a55 [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
 gi|327374825|gb|AEA66175.1| Conserved hypothetical protein [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
          Length = 312

 Score =  125 bits (313), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 57/308 (18%), Positives = 125/308 (40%), Gaps = 11/308 (3%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++ ++  +GLF V ++  +     WL++ +  D       +    +V GLS  SSV +
Sbjct: 1   METRAHHVLIGLFTVIVVAGALLFGLWLAK-SNVDSEFKYYEVVFNEAVSGLSRGSSVEY 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           +GI VG +V L LD   P   LA+  +  +TP+   T A +   G+ G + I+LS    +
Sbjct: 60  SGIKVGDVVNLRLDPNDPRRVLARVRLSGETPVKQDTQAKLALTGITGTSIIQLSGGTPQ 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPL-TTT 179
              +        +  +I A PS I   ++N+++    I+    +  ++  +        T
Sbjct: 120 SPVLTGH---DGEPPVIIAAPSPIARLLNNSDDLMTSINLLLHNANEVFSSDNVQSLGKT 176

Query: 180 IANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKV 239
           + ++E  + V+A     I + M         +      +   +  T+L +    +   + 
Sbjct: 177 LEHLEQTTGVIAEQRGDIRQAMQQL------ASIGKQASATLEQTTALMRNANGLLNDQG 230

Query: 240 NQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSA 299
            Q   N   +  +  +S+  +   ++D R++     +    +   + +    + +    +
Sbjct: 231 KQAFGNAGQAMQSLARSTATLDKLLNDNRDSLNNGMQGLNALAPAVRELRETLSALRGIS 290

Query: 300 FLENIADS 307
              +   S
Sbjct: 291 RRLDANPS 298



 Score = 73.4 bits (177), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 31/178 (17%), Positives = 70/178 (39%), Gaps = 4/178 (2%)

Query: 273 TFQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNMRSSISAIREITDQRQKIISTI 332
               +    D L++  +  + +       +N+      +         I +QR  I   +
Sbjct: 139 PIARLLNNSDDLMTSINLLLHNANEVFSSDNVQSLGKTLEHLEQTTGVIAEQRGDIRQAM 198

Query: 333 NTIENITSNLNDSSQKFAELMSKINNISALKENNSLFKDAQRAMHTFRDTSEKINRYIPS 392
             + +I    + + ++   LM   N +    +    F +A +AM +   ++  +++ +  
Sbjct: 199 QQLASIGKQASATLEQTTALMRNANGLLN-DQGKQAFGNAGQAMQSLARSTATLDKLLND 257

Query: 393 IGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFERNPQDIVWGREKGSVKIYKP 450
             ++L N    GLN +   VR+L+ET++         + NP   + G +K   K + P
Sbjct: 258 NRDSLNN-GMQGLNALAPAVRELRETLSALRGISRRLDANPSGYLLGNDKD--KEFTP 312


>gi|237808111|ref|YP_002892551.1| Mammalian cell entry related domain-containing protein [Tolumonas
           auensis DSM 9187]
 gi|237500372|gb|ACQ92965.1| Mammalian cell entry related domain protein [Tolumonas auensis DSM
           9187]
          Length = 312

 Score =  125 bits (311), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 52/296 (17%), Positives = 113/296 (38%), Gaps = 9/296 (3%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++ ++  +GLF+V           WL +S+   G      +     V GL+  S+V +
Sbjct: 1   METRAHHVLIGLFIVIAFGGILLFTLWLGKSSSERG-FVYYDVLFNEEVSGLTAGSAVEY 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           +GI VG +  L LD + P    A   +  DTP+  +T A +    + G   I L      
Sbjct: 60  SGIKVGEVESLQLDPQDPRKVWAHTRLSADTPVKKNTRARLALANITGSALIRLFDGSPT 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
              +        +  +I A PS I+ F++N EN    I++ + ++ ++           +
Sbjct: 120 SPLLQG---IDGRVPVIIADPSPISRFLANGENLMGNINNLAGNLNQLFSK-----ENIL 171

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
           +  +T++ V         +     +     +      N     I+ L +    +   +  
Sbjct: 172 SLSKTLNHVEQVTEVLATQRSDLAETIRQINTLSKEANIAMHDISRLARNTDKLIGDQGQ 231

Query: 241 QILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKE 296
           ++L N   S     +++ ++   + + +   Q   +    +   + +  + + S  
Sbjct: 232 RVLNNAAQSMATLEQATRRIDQLISNNQAPLQNGLQSLNDLGPAMQELRAALASLN 287



 Score = 73.8 bits (178), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 29/178 (16%), Positives = 68/178 (38%), Gaps = 4/178 (2%)

Query: 273 TFQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNMRSSISAIREITDQRQKIISTI 332
                    ++L+ + ++   +       ENI   +  +         +  QR  +  TI
Sbjct: 139 PISRFLANGENLMGNINNLAGNLNQLFSKENILSLSKTLNHVEQVTEVLATQRSDLAETI 198

Query: 333 NTIENITSNLNDSSQKFAELMSKINNISALKENNSLFKDAQRAMHTFRDTSEKINRYIPS 392
             I  ++   N +    + L    + +    +   +  +A ++M T    + +I++ I +
Sbjct: 199 RQINTLSKEANIAMHDISRLARNTDKLIG-DQGQRVLNNAAQSMATLEQATRRIDQLISN 257

Query: 393 IGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFERNPQDIVWGREKGSVKIYKP 450
               LQN     LND+   +++L+  +   +      E +P   +  REK   + ++P
Sbjct: 258 NQAPLQN-GLQSLNDLGPAMQELRAALASLNRLSRRLEEDPSGFLLDREKN--EEFQP 312


>gi|225627499|ref|ZP_03785536.1| Hypothetical protein, conserved [Brucella ceti str. Cudo]
 gi|260168731|ref|ZP_05755542.1| ABC transporter, periplasmic substrate-binding protein, putative
           [Brucella sp. F5/99]
 gi|261758209|ref|ZP_06001918.1| ABC transporter [Brucella sp. F5/99]
 gi|225617504|gb|EEH14549.1| Hypothetical protein, conserved [Brucella ceti str. Cudo]
 gi|261738193|gb|EEY26189.1| ABC transporter [Brucella sp. F5/99]
          Length = 331

 Score =  123 bits (308), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 68/283 (24%), Positives = 125/283 (44%), Gaps = 3/283 (1%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K  Y  VG+F + +   +F  +YW++R  +       + +RI GSV GL   S V F
Sbjct: 1   METKANYVLVGVFTLLVSLLAFGFVYWIARYGE-ARDSLPLDVRIQGSVTGLGIGSQVLF 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NGI VG +  L LD   P   + +  +   TP+  STTAT+  QGL G  YIEL   R +
Sbjct: 60  NGIKVGDVRRLHLDDSNPGMVIVQTRVNATTPITRSTTATLGFQGLTGQAYIELKGGRLD 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
           +  +   A + +  A I A PS +N  ++ A++ + + ++    ++  +++   PLT TI
Sbjct: 120 EPNLLTEAAKEDTVARINADPSAVNNLLATAQDIAARANNVLSQLEGFVKDARGPLTDTI 179

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
            N +T +  LA+N   I ++              +  + +  L  +  K+   ++     
Sbjct: 180 NNTKTFTQALADNADIIQELGQNAGNIRQI--VVDAKDMMARLNAASVKVESILNKTDKM 237

Query: 241 QILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDH 283
              ++        + +   +  T +++            +   
Sbjct: 238 LSADDKNGLVAQAITTLQSIRETSNNLDARLAPIANNLDRFSG 280



 Score = 95.4 bits (234), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 40/202 (19%), Positives = 84/202 (41%), Gaps = 6/202 (2%)

Query: 247 QVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAFLENIAD 306
           + +          V N +   ++       V  +++  + D          +  + N   
Sbjct: 130 EDTVARINADPSAVNNLLATAQDIAARANNVLSQLEGFVKDARG-----PLTDTINNTKT 184

Query: 307 STSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNISALKENN 366
            T  +  +   I+E+      I   +   +++ + LN +S K   +++K + + +  + N
Sbjct: 185 FTQALADNADIIQELGQNAGNIRQIVVDAKDMMARLNAASVKVESILNKTDKMLSADDKN 244

Query: 367 SLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCL 426
            L   A   + + R+TS  ++  +  I NNL  FS  GL ++Q +V   +  +   +  +
Sbjct: 245 GLVAQAITTLQSIRETSNNLDARLAPIANNLDRFSGQGLREMQGVVIDSRRAIQRIEQVI 304

Query: 427 NNFERNPQDIVWGREKGSVKIY 448
              ERNPQ +++G   GSV  Y
Sbjct: 305 TELERNPQRLIFGG-PGSVPQY 325


>gi|23501901|ref|NP_698028.1| ABC transporter periplasmic substrate-binding protein [Brucella
           suis 1330]
 gi|23347842|gb|AAN29943.1| ABC transporter, periplasmic substrate-binding protein, putative
           [Brucella suis 1330]
          Length = 331

 Score =  123 bits (307), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 68/283 (24%), Positives = 124/283 (43%), Gaps = 3/283 (1%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K  Y  VG+F + +   +F  +YW++R  +       + +RI GSV GL   S V F
Sbjct: 1   METKANYVLVGVFTLLVSLLAFGFVYWIARYGE-ARDSLPLDVRIQGSVTGLGIGSQVLF 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NGI VG +  L LD   P   + +  +   TP+  STTAT+  QGL G  YIEL   R +
Sbjct: 60  NGIKVGDVRRLHLDDSNPGMVIVQTRVNATTPITRSTTATLGFQGLTGQAYIELKGGRLD 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
           +  +   A + +  A I A PS +N  ++ A++ + + ++    ++  ++    PLT TI
Sbjct: 120 EPNLLTEAAKEDTVARIDADPSAVNNLLATAQDIAARANNVLSQLEGFVKGARGPLTDTI 179

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
            N +T +  LA+N   I ++              +  + +  L  +  K+   ++     
Sbjct: 180 NNTKTFTQALADNADIIQELGQNAGNIRQI--VVDAKDMMARLNAASVKVESILNKTDKM 237

Query: 241 QILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDH 283
              ++        + +   +  T +++            +   
Sbjct: 238 LSADDKNGLVAQAITTLQSIRETSNNLDARLAPIANNLDRFSG 280



 Score = 95.0 bits (233), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 42/196 (21%), Positives = 87/196 (44%), Gaps = 3/196 (1%)

Query: 255 KSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSK--ETSAFLENIADSTSNMR 312
            +  ++      V     T Q++  + +++LS     +K      +  + N    T  + 
Sbjct: 131 DTVARIDADPSAVNNLLATAQDIAARANNVLSQLEGFVKGARGPLTDTINNTKTFTQALA 190

Query: 313 SSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNISALKENNSLFKDA 372
            +   I+E+      I   +   +++ + LN +S K   +++K + + +  + N L   A
Sbjct: 191 DNADIIQELGQNAGNIRQIVVDAKDMMARLNAASVKVESILNKTDKMLSADDKNGLVAQA 250

Query: 373 QRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFERN 432
              + + R+TS  ++  +  I NNL  FS  GL ++Q +V   +  +   +  +   ERN
Sbjct: 251 ITTLQSIRETSNNLDARLAPIANNLDRFSGQGLREMQGVVIDSRRAIQRIEQVITELERN 310

Query: 433 PQDIVWGREKGSVKIY 448
           PQ +++G   GSV  Y
Sbjct: 311 PQRLIFGG-PGSVPQY 325


>gi|161618973|ref|YP_001592860.1| hypothetical protein BCAN_A1036 [Brucella canis ATCC 23365]
 gi|254701772|ref|ZP_05163600.1| hypothetical protein Bsuib55_13071 [Brucella suis bv. 5 str. 513]
 gi|254704314|ref|ZP_05166142.1| hypothetical protein Bsuib36_10364 [Brucella suis bv. 3 str. 686]
 gi|254706784|ref|ZP_05168612.1| hypothetical protein BpinM_07300 [Brucella pinnipedialis
           M163/99/10]
 gi|254710106|ref|ZP_05171917.1| hypothetical protein BpinB_07491 [Brucella pinnipedialis B2/94]
 gi|254714107|ref|ZP_05175918.1| hypothetical protein BcetM6_12270 [Brucella ceti M644/93/1]
 gi|254716836|ref|ZP_05178647.1| hypothetical protein BcetM_10524 [Brucella ceti M13/05/1]
 gi|254719097|ref|ZP_05180908.1| hypothetical protein Bru83_06090 [Brucella sp. 83/13]
 gi|256031602|ref|ZP_05445216.1| hypothetical protein BpinM2_13273 [Brucella pinnipedialis
           M292/94/1]
 gi|256061113|ref|ZP_05451267.1| hypothetical protein Bneo5_12207 [Brucella neotomae 5K33]
 gi|256159740|ref|ZP_05457487.1| hypothetical protein BcetM4_12243 [Brucella ceti M490/95/1]
 gi|256255002|ref|ZP_05460538.1| hypothetical protein BcetB_12045 [Brucella ceti B1/94]
 gi|256369445|ref|YP_003106953.1| ABC transporter, periplasmic substrate-binding protein, putative
           [Brucella microti CCM 4915]
 gi|260566439|ref|ZP_05836909.1| ABC transporter [Brucella suis bv. 4 str. 40]
 gi|261218638|ref|ZP_05932919.1| conserved hypothetical protein [Brucella ceti M13/05/1]
 gi|261222190|ref|ZP_05936471.1| conserved hypothetical protein [Brucella ceti B1/94]
 gi|261314252|ref|ZP_05953449.1| conserved hypothetical protein [Brucella pinnipedialis M163/99/10]
 gi|261317655|ref|ZP_05956852.1| conserved hypothetical protein [Brucella pinnipedialis B2/94]
 gi|261321864|ref|ZP_05961061.1| conserved hypothetical protein [Brucella ceti M644/93/1]
 gi|261325114|ref|ZP_05964311.1| conserved hypothetical protein [Brucella neotomae 5K33]
 gi|261752325|ref|ZP_05996034.1| conserved hypothetical protein [Brucella suis bv. 5 str. 513]
 gi|261754983|ref|ZP_05998692.1| conserved hypothetical protein [Brucella suis bv. 3 str. 686]
 gi|265984088|ref|ZP_06096823.1| conserved hypothetical protein [Brucella sp. 83/13]
 gi|265988690|ref|ZP_06101247.1| conserved hypothetical protein [Brucella pinnipedialis M292/94/1]
 gi|265998154|ref|ZP_06110711.1| conserved hypothetical protein [Brucella ceti M490/95/1]
 gi|294852388|ref|ZP_06793061.1| ABC transport system substrate-binding protein [Brucella sp. NVSL
           07-0026]
 gi|306838381|ref|ZP_07471226.1| ABC transporter, periplasmic substrate-binding protein [Brucella
           sp. NF 2653]
 gi|161335784|gb|ABX62089.1| Mammalian cell entry related domain protein [Brucella canis ATCC
           23365]
 gi|255999605|gb|ACU48004.1| ABC transporter, periplasmic substrate-binding protein, putative
           [Brucella microti CCM 4915]
 gi|260155957|gb|EEW91037.1| ABC transporter [Brucella suis bv. 4 str. 40]
 gi|260920774|gb|EEX87427.1| conserved hypothetical protein [Brucella ceti B1/94]
 gi|260923727|gb|EEX90295.1| conserved hypothetical protein [Brucella ceti M13/05/1]
 gi|261294554|gb|EEX98050.1| conserved hypothetical protein [Brucella ceti M644/93/1]
 gi|261296878|gb|EEY00375.1| conserved hypothetical protein [Brucella pinnipedialis B2/94]
 gi|261301094|gb|EEY04591.1| conserved hypothetical protein [Brucella neotomae 5K33]
 gi|261303278|gb|EEY06775.1| conserved hypothetical protein [Brucella pinnipedialis M163/99/10]
 gi|261742078|gb|EEY30004.1| conserved hypothetical protein [Brucella suis bv. 5 str. 513]
 gi|261744736|gb|EEY32662.1| conserved hypothetical protein [Brucella suis bv. 3 str. 686]
 gi|262552622|gb|EEZ08612.1| conserved hypothetical protein [Brucella ceti M490/95/1]
 gi|264660887|gb|EEZ31148.1| conserved hypothetical protein [Brucella pinnipedialis M292/94/1]
 gi|264662680|gb|EEZ32941.1| conserved hypothetical protein [Brucella sp. 83/13]
 gi|294820977|gb|EFG37976.1| ABC transport system substrate-binding protein [Brucella sp. NVSL
           07-0026]
 gi|306406521|gb|EFM62755.1| ABC transporter, periplasmic substrate-binding protein [Brucella
           sp. NF 2653]
          Length = 331

 Score =  123 bits (307), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 68/283 (24%), Positives = 125/283 (44%), Gaps = 3/283 (1%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K  Y  VG+F + +   +F  +YW++R  +       + +RI GSV GL   S V F
Sbjct: 1   METKANYVLVGVFTLLVSLLAFGFVYWIARYGE-ARDSLPLDVRIQGSVTGLGIGSQVLF 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NGI VG +  L LD   P   + +  +   TP+  STTAT+  QGL G  YIEL   R +
Sbjct: 60  NGIKVGDVRRLHLDDSNPGMVIVQTRVNATTPITRSTTATLGFQGLTGQAYIELKGGRLD 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
           +  +   A + +  A I A PS +N  ++ A++ + + ++    ++  +++   PLT TI
Sbjct: 120 EPNLLTEAAKEDTVARIDADPSAVNNLLATAQDIAARANNVLSQLEGFVKDARGPLTDTI 179

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
            N +T +  LA+N   I ++              +  + +  L  +  K+   ++     
Sbjct: 180 NNTKTFTQALADNADIIQELGQNAGNIRQI--VVDAKDMMARLNAASVKVESILNKTDKM 237

Query: 241 QILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDH 283
              ++        + +   +  T +++            +   
Sbjct: 238 LSADDKNGLVAQAITTLQSIRETSNNLDARLAPIANNLDRFSG 280



 Score = 95.4 bits (234), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 40/202 (19%), Positives = 84/202 (41%), Gaps = 6/202 (2%)

Query: 247 QVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAFLENIAD 306
           + +          V N +   ++       V  +++  + D          +  + N   
Sbjct: 130 EDTVARIDADPSAVNNLLATAQDIAARANNVLSQLEGFVKDARG-----PLTDTINNTKT 184

Query: 307 STSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNISALKENN 366
            T  +  +   I+E+      I   +   +++ + LN +S K   +++K + + +  + N
Sbjct: 185 FTQALADNADIIQELGQNAGNIRQIVVDAKDMMARLNAASVKVESILNKTDKMLSADDKN 244

Query: 367 SLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCL 426
            L   A   + + R+TS  ++  +  I NNL  FS  GL ++Q +V   +  +   +  +
Sbjct: 245 GLVAQAITTLQSIRETSNNLDARLAPIANNLDRFSGQGLREMQGVVIDSRRAIQRIEQVI 304

Query: 427 NNFERNPQDIVWGREKGSVKIY 448
              ERNPQ +++G   GSV  Y
Sbjct: 305 TELERNPQRLIFGG-PGSVPQY 325


>gi|90425516|ref|YP_533886.1| hypothetical protein RPC_4041 [Rhodopseudomonas palustris BisB18]
 gi|90107530|gb|ABD89567.1| Mammalian cell entry related [Rhodopseudomonas palustris BisB18]
          Length = 367

 Score =  123 bits (307), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 59/390 (15%), Positives = 130/390 (33%), Gaps = 31/390 (7%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++  +  VG FV++ +   F  + WL  ++          ++  GSV GL   ++V F
Sbjct: 1   METRAPFIIVGAFVLAAIAAVFGFVLWLHNTSGLGARTT-YHVQFNGSVPGLLVGAAVLF 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NGI VG +  L L  + P    A   +   TP+   T   +  QGL G            
Sbjct: 60  NGIRVGEVTELGLAPDNPRQVNATIGVDATTPVRADTKVGLDFQGLTG------------ 107

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
              +  IA E   +   + T   +       ++ ++   ++ R +  ++    +PL  TI
Sbjct: 108 ---VPVIALEGGTQLAPSGTVPTLVADPGAGQSMTQAAREALRKVDAVLTENAEPLKATI 164

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
            +++  +  LA N   +D +M   +                        + K +   +  
Sbjct: 165 GDLKIFAEGLARNTGKLDGIMAGVERM---------------TGADKPVVTKVVYDLRAA 209

Query: 241 QILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAF 300
             L   +        +    +      R       +         SD   K+   +    
Sbjct: 210 TDLPPGKPIKGQLAIAEPTYVVMFDTQRLLLAPGLDYPAFAGFQWSDSIPKLVQAKLIQS 269

Query: 301 LENIADSTSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNIS 360
            EN   + + +R+S +   +           +    ++ + +  S++  ++   ++    
Sbjct: 270 FENYDIAHAPLRASDALQADHQLLIDIRSFQVGGSPDLAAEVAFSAKIVSKDGKQVAAKL 329

Query: 361 ALKENNSLFKDAQRAMHTFRDTSEKINRYI 390
                     +   A+  F +    + + +
Sbjct: 330 FRASAPLDKPEPLAALAAFNEAFGSVAKEL 359


>gi|163843289|ref|YP_001627693.1| hypothetical protein BSUIS_A1064 [Brucella suis ATCC 23445]
 gi|163674012|gb|ABY38123.1| Mammalian cell entry related domain protein [Brucella suis ATCC
           23445]
          Length = 331

 Score =  123 bits (307), Expect = 6e-26,   Method: Composition-based stats.
 Identities = 68/283 (24%), Positives = 125/283 (44%), Gaps = 3/283 (1%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K  Y  VG+F + +   +F  +YW++R  +       + +RI GSV GL   S V F
Sbjct: 1   METKANYVLVGVFTLLVSLLAFGFVYWIARYGE-ARDSLPLDVRIQGSVTGLGIGSQVLF 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NGI VG +  L LD   P   + +  +   TP+  STTAT+  QGL G  YIEL   R +
Sbjct: 60  NGIKVGDVRRLHLDDSNPGMVIVQTRVNATTPITRSTTATLGFQGLTGQAYIELKGGRLD 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
           +  +   A + +  A I A PS +N  ++ A++ + + ++    ++  +++   PLT TI
Sbjct: 120 EPNLLTEAAKEDTVARIDADPSAVNNLLATAQDIAARANNVLSQLEGFVKDARGPLTDTI 179

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
            N +T +  LA+N   I ++              +  + +  L  +  K+   ++     
Sbjct: 180 NNTKTFTQALADNADIIQELGQNAG--SIRQIVVDAKDMMARLNAASVKVESILNKTDKM 237

Query: 241 QILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDH 283
              ++        + +   +  T +++            +   
Sbjct: 238 LSADDKNGLVAQAITTLQSIRETSNNLDARLAPIANNLDRFSG 280



 Score = 95.0 bits (233), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 40/202 (19%), Positives = 84/202 (41%), Gaps = 6/202 (2%)

Query: 247 QVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAFLENIAD 306
           + +          V N +   ++       V  +++  + D          +  + N   
Sbjct: 130 EDTVARIDADPSAVNNLLATAQDIAARANNVLSQLEGFVKDARG-----PLTDTINNTKT 184

Query: 307 STSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNISALKENN 366
            T  +  +   I+E+      I   +   +++ + LN +S K   +++K + + +  + N
Sbjct: 185 FTQALADNADIIQELGQNAGSIRQIVVDAKDMMARLNAASVKVESILNKTDKMLSADDKN 244

Query: 367 SLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCL 426
            L   A   + + R+TS  ++  +  I NNL  FS  GL ++Q +V   +  +   +  +
Sbjct: 245 GLVAQAITTLQSIRETSNNLDARLAPIANNLDRFSGQGLREMQGVVIDSRRAIQRIEQVI 304

Query: 427 NNFERNPQDIVWGREKGSVKIY 448
              ERNPQ +++G   GSV  Y
Sbjct: 305 TELERNPQRLIFGG-PGSVPQY 325


>gi|306840508|ref|ZP_07473267.1| ABC transporter, periplasmic substrate-binding protein [Brucella
           sp. BO2]
 gi|306843895|ref|ZP_07476490.1| ABC transporter, periplasmic substrate-binding protein [Brucella
           sp. BO1]
 gi|306275650|gb|EFM57374.1| ABC transporter, periplasmic substrate-binding protein [Brucella
           sp. BO1]
 gi|306289523|gb|EFM60741.1| ABC transporter, periplasmic substrate-binding protein [Brucella
           sp. BO2]
          Length = 331

 Score =  123 bits (307), Expect = 6e-26,   Method: Composition-based stats.
 Identities = 68/283 (24%), Positives = 125/283 (44%), Gaps = 3/283 (1%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K  Y  VG+F + +   +F  +YW++R  +       + +RI GSV GL   S V F
Sbjct: 1   METKANYVLVGVFTLLVSLLAFGFVYWIARYGE-ARDSLPLDVRIQGSVTGLGIGSQVLF 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NGI VG +  L LD   P   + +  +   TP+  STTAT+  QGL G  YIEL   R +
Sbjct: 60  NGIKVGDVRRLHLDDSNPGMVIVQTRVNATTPITRSTTATLGFQGLTGQAYIELKGGRLD 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
           +  +   A + +  A I A PS +N  ++ A++ + + ++    ++  +++   PLT TI
Sbjct: 120 EPNLLTEAAKEDTVARIDADPSAVNNLLATAQDIAARANNVLSELEGFVKDARGPLTDTI 179

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
            N +T +  LA+N   I ++              +  + +  L  +  K+   ++     
Sbjct: 180 NNTKTFTQALADNADIIQELGQNAGNIRQI--VVDAKDMMARLNAASVKVESILNKTDKM 237

Query: 241 QILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDH 283
              ++        + +   +  T +++            +   
Sbjct: 238 LSADDKNGLVAQAITTLQSIRETSNNLDARLAPIANNLDRFSG 280



 Score = 95.4 bits (234), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 40/202 (19%), Positives = 84/202 (41%), Gaps = 6/202 (2%)

Query: 247 QVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAFLENIAD 306
           + +          V N +   ++       V  +++  + D          +  + N   
Sbjct: 130 EDTVARIDADPSAVNNLLATAQDIAARANNVLSELEGFVKDARG-----PLTDTINNTKT 184

Query: 307 STSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNISALKENN 366
            T  +  +   I+E+      I   +   +++ + LN +S K   +++K + + +  + N
Sbjct: 185 FTQALADNADIIQELGQNAGNIRQIVVDAKDMMARLNAASVKVESILNKTDKMLSADDKN 244

Query: 367 SLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCL 426
            L   A   + + R+TS  ++  +  I NNL  FS  GL ++Q +V   +  +   +  +
Sbjct: 245 GLVAQAITTLQSIRETSNNLDARLAPIANNLDRFSGQGLREMQGVVIDSRRAIQRIEQVI 304

Query: 427 NNFERNPQDIVWGREKGSVKIY 448
              ERNPQ +++G   GSV  Y
Sbjct: 305 TELERNPQRLIFGG-PGSVPQY 325


>gi|119897563|ref|YP_932776.1| hypothetical protein azo1272 [Azoarcus sp. BH72]
 gi|119669976|emb|CAL93889.1| conserved hypothetical secreted protein [Azoarcus sp. BH72]
          Length = 313

 Score =  123 bits (307), Expect = 6e-26,   Method: Composition-based stats.
 Identities = 51/304 (16%), Positives = 107/304 (35%), Gaps = 5/304 (1%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++ ++  +GLF V ++  +     WL + +  D       +    +V+GLS  S+V F
Sbjct: 1   METRAHHVLIGLFTVLVVGAALSFALWLGKVDS-DTQFNLYDVVFEEAVNGLSKGSTVEF 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NGI +G +  L LD + P   LA+  +    P+   T A +  QG+ GI  I LS+    
Sbjct: 60  NGIKIGEVSNLRLDPKDPRRVLARIRVDSAAPIRSDTRARLAPQGITGIYTIRLSSGNDP 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPL--TT 178
                +    + +  +I A PS ++  ++N E+    +++     + +           T
Sbjct: 120 GSVALEP--RQGEVPVIIADPSPLSRLLANGEDVMVNVNELLMQARVLFSAENAASLGRT 177

Query: 179 TIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQK 238
                +T   + A        +    + +  ++ +      +      L        LQ 
Sbjct: 178 LGHLEQTTGALAAQREDMGRALRELARASEQANAALAEATKMMSATNRLIDTQGKETLQS 237

Query: 239 VNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETS 298
             + +   + +     K        +               ++   L+   +  +  E  
Sbjct: 238 AQRSMAAFEQAMQTVDKLVADNRGQLDSGMRGIADLGPALSELRRTLASLRTITRQLEDR 297

Query: 299 AFLE 302
               
Sbjct: 298 PADY 301



 Score = 66.9 bits (160), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 25/178 (14%), Positives = 63/178 (35%), Gaps = 4/178 (2%)

Query: 273 TFQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNMRSSISAIREITDQRQKIISTI 332
               +    + ++ + +  +         EN A     +         +  QR+ +   +
Sbjct: 140 PLSRLLANGEDVMVNVNELLMQARVLFSAENAASLGRTLGHLEQTTGALAAQREDMGRAL 199

Query: 333 NTIENITSNLNDSSQKFAELMSKINNISALKENNSLFKDAQRAMHTFRDTSEKINRYIPS 392
             +   +   N +  +  ++MS  N +    +     + AQR+M  F    + +++ +  
Sbjct: 200 RELARASEQANAALAEATKMMSATNRLI-DTQGKETLQSAQRSMAAFEQAMQTVDKLVAD 258

Query: 393 IGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFERNPQDIVWGREKGSVKIYKP 450
               L +    G+ D+   + +L+ T+          E  P D + G E    + ++P
Sbjct: 259 NRGQLDS-GMRGIADLGPALSELRRTLASLRTITRQLEDRPADYLLGLEPT--REFQP 313


>gi|17987246|ref|NP_539880.1| toluene tolerance protein TTG2C [Brucella melitensis bv. 1 str.
           16M]
 gi|62289944|ref|YP_221737.1| ABC transporter periplasmic substrate-binding protein [Brucella
           abortus bv. 1 str. 9-941]
 gi|82699872|ref|YP_414446.1| hypothetical protein BAB1_1040 [Brucella melitensis biovar Abortus
           2308]
 gi|189024187|ref|YP_001934955.1| ABC transporter, periplasmic substrate-binding protein [Brucella
           abortus S19]
 gi|225852526|ref|YP_002732759.1| mammalian cell entry related domain-containing protein [Brucella
           melitensis ATCC 23457]
 gi|237815445|ref|ZP_04594443.1| toluene tolerance protein TTG2C [Brucella abortus str. 2308 A]
 gi|254689251|ref|ZP_05152505.1| Mammalian cell entry related domain protein [Brucella abortus bv. 6
           str. 870]
 gi|254693735|ref|ZP_05155563.1| Mammalian cell entry related domain protein [Brucella abortus bv. 3
           str. Tulya]
 gi|254697386|ref|ZP_05159214.1| Mammalian cell entry related domain protein [Brucella abortus bv. 2
           str. 86/8/59]
 gi|254730284|ref|ZP_05188862.1| Mammalian cell entry related domain protein [Brucella abortus bv. 4
           str. 292]
 gi|256044680|ref|ZP_05447584.1| Mammalian cell entry related domain protein [Brucella melitensis
           bv. 1 str. Rev.1]
 gi|256113574|ref|ZP_05454394.1| Mammalian cell entry related domain protein [Brucella melitensis
           bv. 3 str. Ether]
 gi|256257501|ref|ZP_05463037.1| Mammalian cell entry related domain protein [Brucella abortus bv. 9
           str. C68]
 gi|256263984|ref|ZP_05466516.1| ABC transporter [Brucella melitensis bv. 2 str. 63/9]
 gi|260545307|ref|ZP_05821048.1| ABC transporter [Brucella abortus NCTC 8038]
 gi|260564026|ref|ZP_05834512.1| ABC transporter [Brucella melitensis bv. 1 str. 16M]
 gi|260754757|ref|ZP_05867105.1| conserved hypothetical protein [Brucella abortus bv. 6 str. 870]
 gi|260757980|ref|ZP_05870328.1| conserved hypothetical protein [Brucella abortus bv. 4 str. 292]
 gi|260761803|ref|ZP_05874146.1| conserved hypothetical protein [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260883777|ref|ZP_05895391.1| conserved hypothetical protein [Brucella abortus bv. 9 str. C68]
 gi|261214009|ref|ZP_05928290.1| conserved hypothetical protein [Brucella abortus bv. 3 str. Tulya]
 gi|265991104|ref|ZP_06103661.1| conserved hypothetical protein [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|265994941|ref|ZP_06107498.1| conserved hypothetical protein [Brucella melitensis bv. 3 str.
           Ether]
 gi|297248345|ref|ZP_06932063.1| ABC transport system substrate-binding protein [Brucella abortus
           bv. 5 str. B3196]
 gi|17982920|gb|AAL52144.1| toluene tolerance protein ttg2c [Brucella melitensis bv. 1 str.
           16M]
 gi|62196076|gb|AAX74376.1| ABC transporter, periplasmic substrate-binding protein [Brucella
           abortus bv. 1 str. 9-941]
 gi|82615973|emb|CAJ10996.1| Mce4/Rv3499c/MTV023.06c protein [Brucella melitensis biovar Abortus
           2308]
 gi|189019759|gb|ACD72481.1| ABC transporter, periplasmic substrate-binding protein [Brucella
           abortus S19]
 gi|225640891|gb|ACO00805.1| Mammalian cell entry related domain protein [Brucella melitensis
           ATCC 23457]
 gi|237790282|gb|EEP64492.1| toluene tolerance protein TTG2C [Brucella abortus str. 2308 A]
 gi|260096714|gb|EEW80589.1| ABC transporter [Brucella abortus NCTC 8038]
 gi|260154042|gb|EEW89134.1| ABC transporter [Brucella melitensis bv. 1 str. 16M]
 gi|260668298|gb|EEX55238.1| conserved hypothetical protein [Brucella abortus bv. 4 str. 292]
 gi|260672235|gb|EEX59056.1| conserved hypothetical protein [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260674865|gb|EEX61686.1| conserved hypothetical protein [Brucella abortus bv. 6 str. 870]
 gi|260873305|gb|EEX80374.1| conserved hypothetical protein [Brucella abortus bv. 9 str. C68]
 gi|260915616|gb|EEX82477.1| conserved hypothetical protein [Brucella abortus bv. 3 str. Tulya]
 gi|262766054|gb|EEZ11843.1| conserved hypothetical protein [Brucella melitensis bv. 3 str.
           Ether]
 gi|263001888|gb|EEZ14463.1| conserved hypothetical protein [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|263094128|gb|EEZ18050.1| ABC transporter [Brucella melitensis bv. 2 str. 63/9]
 gi|297175514|gb|EFH34861.1| ABC transport system substrate-binding protein [Brucella abortus
           bv. 5 str. B3196]
 gi|326409042|gb|ADZ66107.1| ABC transporter, periplasmic substrate-binding protein [Brucella
           melitensis M28]
 gi|326538751|gb|ADZ86966.1| mammalian cell entry related domain protein [Brucella melitensis
           M5-90]
          Length = 331

 Score =  123 bits (306), Expect = 7e-26,   Method: Composition-based stats.
 Identities = 68/283 (24%), Positives = 125/283 (44%), Gaps = 3/283 (1%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K  Y  VG+F + +   +F  +YW++R  +       + +RI GSV GL   S V F
Sbjct: 1   METKANYVLVGVFTLLVSLLAFGFVYWIARYGE-ARDSLPLDVRIQGSVTGLGIGSQVLF 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NGI VG +  L LD   P   + +  +   TP+  STTAT+  QGL G  YIEL   R +
Sbjct: 60  NGIKVGDVRRLHLDDSNPGMVIVQTRVNATTPITRSTTATLGFQGLTGQAYIELKGGRLD 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
           +  +   A + +  A I A PS +N  ++ A++ + + ++    ++  +++   PLT TI
Sbjct: 120 EPNLLTEAAKEDTVARIDADPSAVNNLLATAQDIAARANNVLSQLEGFVKDARGPLTDTI 179

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
            N +T +  LA+N   I ++              +  + +  L  +  K+   ++     
Sbjct: 180 NNTKTFTQALADNADIIQELGQNAGNIRQI--VVDAKDMMARLNAASVKVESILNKTDKM 237

Query: 241 QILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDH 283
              ++        + +   +  T +++            +   
Sbjct: 238 LSADDKNGLVAQAITTLQSIRETSNNLDARLAPIANNLDRFSG 280



 Score = 93.8 bits (230), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 39/202 (19%), Positives = 83/202 (41%), Gaps = 6/202 (2%)

Query: 247 QVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAFLENIAD 306
           + +          V N +   ++       V  +++  + D          +  + N   
Sbjct: 130 EDTVARIDADPSAVNNLLATAQDIAARANNVLSQLEGFVKDARG-----PLTDTINNTKT 184

Query: 307 STSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNISALKENN 366
            T  +  +   I+E+      I   +   +++ + LN +S K   +++K + + +  + N
Sbjct: 185 FTQALADNADIIQELGQNAGNIRQIVVDAKDMMARLNAASVKVESILNKTDKMLSADDKN 244

Query: 367 SLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCL 426
            L   A   + + R+TS  ++  +  I NNL  FS  GL ++Q +V   +  +   +  +
Sbjct: 245 GLVAQAITTLQSIRETSNNLDARLAPIANNLDRFSGQGLREMQGVVIDSRRAIQRIEQVI 304

Query: 427 NNFERNPQDIVWGREKGSVKIY 448
              ERNPQ +++G    SV  Y
Sbjct: 305 TELERNPQRLIFGG-PVSVPQY 325


>gi|323136830|ref|ZP_08071911.1| Mammalian cell entry related domain protein [Methylocystis sp. ATCC
           49242]
 gi|322398147|gb|EFY00668.1| Mammalian cell entry related domain protein [Methylocystis sp. ATCC
           49242]
          Length = 301

 Score =  123 bits (306), Expect = 8e-26,   Method: Composition-based stats.
 Identities = 63/285 (22%), Positives = 108/285 (37%), Gaps = 5/285 (1%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++  Y  +G F ++I F +F  +YW S  +Q         I   G+V GL+  S V F
Sbjct: 1   METRANYALIGAFTLAIAFAAFGFVYWFSGPSQIGRQET-YQIVFSGAVSGLTRGSGVLF 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NG+ VG +  L + +  P+    +  I   TP+   T A + T+G  G+  + L      
Sbjct: 60  NGVKVGEVTHLAISESDPSKVDVEVKIDNRTPVKTDTRARLETRGFTGVADVLLVGGTPR 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
              +   A    +   I A  S I   + N ++ S K ++    + K+++     +T T+
Sbjct: 120 APKLV--AQPGQRYPQIQAERSEIQNLLGNVQHLSTKAAEVLVKLDKLLDQNSDSITATL 177

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHS--SDSKNTFNTITDLITSLDKMIKAIDLQK 238
            N ET +  LA+N S +   M       HS    +      +      L  +      + 
Sbjct: 178 KNAETFTKTLADNSSAVTAFMRDAADVAHSLKPVAARLDKVLAAGEARLKAIDPRKIKEI 237

Query: 239 VNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDH 283
              I       +        Q      D R+   T     + I+ 
Sbjct: 238 TGNIAGASANINKFSATGLRQYEALAVDGRKAVDTLDRTLRSIEK 282



 Score = 60.7 bits (144), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 28/197 (14%), Positives = 68/197 (34%), Gaps = 10/197 (5%)

Query: 253 FVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNMR 312
            V  + +    V    +     Q    +I +LL +               +      N  
Sbjct: 113 LVGGTPRAPKLVAQPGQRYPQIQAERSEIQNLLGNVQHLSTKAAEVLVKLD-KLLDQNSD 171

Query: 313 SSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNISALKENNSLFKDA 372
           S  + ++      + +    + +     +  D +     + ++++ + A  E      D 
Sbjct: 172 SITATLKNAETFTKTLADNSSAVTAFMRDAADVAHSLKPVAARLDKVLAAGEARLKAIDP 231

Query: 373 QRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFERN 432
           ++         ++I   I     N+  FS +GL   + L    ++ V+  D  L + E++
Sbjct: 232 RKI--------KEITGNIAGASANINKFSATGLRQYEALAVDGRKAVDTLDRTLRSIEKD 283

Query: 433 PQDIVWGREKGSVKIYK 449
           P   ++G  + +V  Y+
Sbjct: 284 PSQFIFGPSQ-TVPEYQ 299


>gi|104779406|ref|YP_605904.1| hypothetical protein PSEEN0096 [Pseudomonas entomophila L48]
 gi|95108393|emb|CAK13087.1| conserved hypothetical protein [Pseudomonas entomophila L48]
          Length = 312

 Score =  123 bits (306), Expect = 8e-26,   Method: Composition-based stats.
 Identities = 53/295 (17%), Positives = 114/295 (38%), Gaps = 9/295 (3%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++ ++  +GL  V ++  +     WL++S+  D    +  +    +V GLS  S V++
Sbjct: 1   METRAHHVLIGLVTVLVVAGAMLFGLWLTKSS-VDTAFKDYEVVFNEAVSGLSRGSPVQY 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NGI VG +  L LD + P   LA+  +  DTP+   T A +   G+ G  +I+LS     
Sbjct: 60  NGIKVGDVSSLRLDPKDPRRVLARVRLSGDTPVKEDTQAKLTLAGVTGNAFIQLSGGTPH 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
              +     +        +  S       +++  +          Q   E   + L+ T+
Sbjct: 120 SPELKGKDGKLPVIVASPSPIS--RLLNDSSDLVTNINLLLHNANQMFSEGNIERLSNTL 177

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
           AN+E  +   AN    I   +         +      N       +L +    +   +  
Sbjct: 178 ANLEQTTGAFANQKGGISAAIEQL------AQVGKQANATLAETQALMRNANGLLGNQGK 231

Query: 241 QILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSK 295
           Q + + + +     +S+  + + + D R++     +   ++   + +    + + 
Sbjct: 232 QAIGSAEQAMQALAESAATLNSLLQDNRQSIDDGAQGLNQLSPAIRELRETLNAL 286



 Score = 79.6 bits (193), Expect = 9e-13,   Method: Composition-based stats.
 Identities = 28/178 (15%), Positives = 68/178 (38%), Gaps = 4/178 (2%)

Query: 273 TFQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNMRSSISAIREITDQRQKIISTI 332
               +      L+++ +  + +        NI   ++ + +         +Q+  I + I
Sbjct: 139 PISRLLNDSSDLVTNINLLLHNANQMFSEGNIERLSNTLANLEQTTGAFANQKGGISAAI 198

Query: 333 NTIENITSNLNDSSQKFAELMSKINNISALKENNSLFKDAQRAMHTFRDTSEKINRYIPS 392
             +  +    N +  +   LM   N +    +       A++AM    +++  +N  +  
Sbjct: 199 EQLAQVGKQANATLAETQALMRNANGLLGN-QGKQAIGSAEQAMQALAESAATLNSLLQD 257

Query: 393 IGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFERNPQDIVWGREKGSVKIYKP 450
              ++ +    GLN +   +R+L+ET+N         E +P   + GR+    K ++P
Sbjct: 258 NRQSIDD-GAQGLNQLSPAIRELRETLNALKGISRRLEADPSGYLLGRDNN--KEFQP 312


>gi|70733610|ref|YP_257250.1| MCE-like family protein [Pseudomonas fluorescens Pf-5]
 gi|68347909|gb|AAY95515.1| mce related protein family [Pseudomonas fluorescens Pf-5]
          Length = 312

 Score =  122 bits (305), Expect = 9e-26,   Method: Composition-based stats.
 Identities = 52/306 (16%), Positives = 121/306 (39%), Gaps = 9/306 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++ ++  +GLF V ++  +     WL++S+  D    +  I    +V GLS  SSV++
Sbjct: 1   METRAHHVLIGLFTVIVVAGALLFGLWLAKSS-VDSAFQDYQIVFNEAVSGLSKGSSVQY 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           +GI VG +V L LD + P   LA+  +  +TP+   T A +   G+ G + I+LS    +
Sbjct: 60  SGIKVGDVVNLRLDPKDPRRVLAQIRLGSETPIKEDTQAKLALTGITGTSIIQLSGGTPQ 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
             T+     +  +   I A+PS I   ++N+ +    ++    +  ++         ++ 
Sbjct: 120 SPTLKG---KDGELPTIIASPSPIARLLNNSNDLMTGVNLLLHNANRMFSPDNVARVSST 176

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
            +    ++          + +                  + +  T+L +    +   +  
Sbjct: 177 LDNLQKTSASIAEQRDDLRQL-----MQQLGSISKQTGAMLEQTTALMRNANGLLNDQGK 231

Query: 241 QILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAF 300
           Q+  + + +  +  +SS  +   + D +++     +    +   + +    + S      
Sbjct: 232 QMFGSAEHAMRSLEQSSATLNKLLSDNQDSLNNGMQGLNGLAPAVRELRETLSSLRAITR 291

Query: 301 LENIAD 306
                 
Sbjct: 292 RLEANP 297



 Score = 73.4 bits (177), Expect = 6e-11,   Method: Composition-based stats.
 Identities = 35/178 (19%), Positives = 73/178 (41%), Gaps = 4/178 (2%)

Query: 273 TFQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNMRSSISAIREITDQRQKIISTI 332
               +    + L++  +  + +       +N+A  +S + +       I +QR  +   +
Sbjct: 139 PIARLLNNSNDLMTGVNLLLHNANRMFSPDNVARVSSTLDNLQKTSASIAEQRDDLRQLM 198

Query: 333 NTIENITSNLNDSSQKFAELMSKINNISALKENNSLFKDAQRAMHTFRDTSEKINRYIPS 392
             + +I+       ++   LM   N +    +   +F  A+ AM +   +S  +N+ +  
Sbjct: 199 QQLGSISKQTGAMLEQTTALMRNANGLLN-DQGKQMFGSAEHAMRSLEQSSATLNKLLSD 257

Query: 393 IGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFERNPQDIVWGREKGSVKIYKP 450
             ++L N    GLN +   VR+L+ET++         E NP   + G EK   K + P
Sbjct: 258 NQDSLNN-GMQGLNGLAPAVRELRETLSSLRAITRRLEANPGGYLLGNEKN--KEFTP 312


>gi|296445996|ref|ZP_06887946.1| Mammalian cell entry related domain protein [Methylosinus
           trichosporium OB3b]
 gi|296256514|gb|EFH03591.1| Mammalian cell entry related domain protein [Methylosinus
           trichosporium OB3b]
          Length = 294

 Score =  122 bits (304), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 51/204 (25%), Positives = 91/204 (44%), Gaps = 3/204 (1%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++  Y  +G F ++++F +F  ++W S  +          I   GSV GL+   +V F
Sbjct: 1   METRANYALIGAFTIAVVFAAFGFVFWFSGPSTT-AQYKTYQIVFSGSVSGLTRGGAVEF 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           +G+ VG +  L + +E P+       I   TP+   T A + + G  G+  + L      
Sbjct: 60  DGLKVGEVTQLAISEEDPSRVDVLVNIDKKTPIKIDTKARLESAGFTGVKTVALVGGTPR 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
              +   A        I A  S +   I + +  SKK +D+   I K+++     ++ T+
Sbjct: 120 APVL--AAAPGQAYPRIEAEGSDLQNIIDSVQRLSKKATDALDKIDKLLDANSATISQTL 177

Query: 181 ANIETISTVLANNISHIDKMMHTT 204
            N ET +  LA+N  +I  +M   
Sbjct: 178 QNAETFTKALADNSENIGSVMKDM 201



 Score = 60.3 bits (143), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 33/201 (16%), Positives = 75/201 (37%), Gaps = 32/201 (15%)

Query: 280 KIDHLLSDFSSKMKSKETSAFLENIADSTSNMRSSISAIREITDQRQKIISTINTIENIT 339
           KID      S+     +T A +     +     +   A   I  +   + + I++++ ++
Sbjct: 93  KIDTKARLESAGFTGVKTVALVGGTPRAPVLAAAPGQAYPRIEAEGSDLQNIIDSVQRLS 152

Query: 340 SNLNDSSQKFAELMSKINNIS----------------ALKENNSLFKDAQRAMHTFRDTS 383
               D+  K  +L+   +                     +   S+ KD      + +   
Sbjct: 153 KKATDALDKIDKLLDANSATISQTLQNAETFTKALADNSENIGSVMKDMAALGRSLKPIP 212

Query: 384 EKINRYIPSI---------------GNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNN 428
           E++++ + +I                NNL+ FS  GL   + L    ++T+   +  + +
Sbjct: 213 ERLDKLLAAIDPKKLSSISTDIAAASNNLKTFSGGGLKQYELLAVDARKTLETVERAVRS 272

Query: 429 FERNPQDIVWGREKGSVKIYK 449
            E+NPQ +++G    ++  YK
Sbjct: 273 LEKNPQQVLFGAT-PALPEYK 292


>gi|170724244|ref|YP_001751932.1| hypothetical protein PputW619_5087 [Pseudomonas putida W619]
 gi|169762247|gb|ACA75563.1| Mammalian cell entry related domain protein [Pseudomonas putida
           W619]
          Length = 312

 Score =  122 bits (304), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 55/295 (18%), Positives = 121/295 (41%), Gaps = 9/295 (3%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++ ++  +GL  V ++  +     WL++S+  D    +  +    +V GLS  S V++
Sbjct: 1   METRAHHVLIGLVTVLVVAGAMLFGLWLTKSS-VDDAFKDYEVIFNEAVSGLSRGSPVQY 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NGI VG +  L LD + P   LA+  +  DTP+   T A +   G+ G ++I+LS    +
Sbjct: 60  NGIKVGDVTSLRLDPKDPRRVLARVRLSGDTPVKEDTQAKLTLAGVTGNSFIQLSGGTPK 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
              +     +        +  S       +++  +          Q   EN    L+ T+
Sbjct: 120 SPELKGKDGKLPVIIASPSPIS--QLLNDSSDLVTNINLLLHNANQMFSENNIDRLSNTL 177

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
           AN+E  ++  AN+   I + +         +      N       +L +   ++   +  
Sbjct: 178 ANLEQTTSAFANHKGGISQAI------EQLAQVGKQANATLAETQALMRNANSLLGTQGK 231

Query: 241 QILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSK 295
           Q + + + +  +   S+  + + ++D R++     +   ++   + +    + S 
Sbjct: 232 QAIGSAEQAMQSLAASTATINSLLNDNRQSIDDGAQGLNQLTPAIRELRETLNSL 286



 Score = 81.9 bits (199), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 28/178 (15%), Positives = 70/178 (39%), Gaps = 4/178 (2%)

Query: 273 TFQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNMRSSISAIREITDQRQKIISTI 332
              ++      L+++ +  + +        NI   ++ + +         + +  I   I
Sbjct: 139 PISQLLNDSSDLVTNINLLLHNANQMFSENNIDRLSNTLANLEQTTSAFANHKGGISQAI 198

Query: 333 NTIENITSNLNDSSQKFAELMSKINNISALKENNSLFKDAQRAMHTFRDTSEKINRYIPS 392
             +  +    N +  +   LM   N++    +       A++AM +   ++  IN  +  
Sbjct: 199 EQLAQVGKQANATLAETQALMRNANSLLGT-QGKQAIGSAEQAMQSLAASTATINSLLND 257

Query: 393 IGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFERNPQDIVWGREKGSVKIYKP 450
              ++ +    GLN +   +R+L+ET+N         E +P   + GR+  ++K ++P
Sbjct: 258 NRQSIDD-GAQGLNQLTPAIRELRETLNSLKGISRRLEADPSGYLLGRD--NIKEFQP 312


>gi|239831969|ref|ZP_04680298.1| Hypothetical protein, conserved [Ochrobactrum intermedium LMG 3301]
 gi|239824236|gb|EEQ95804.1| Hypothetical protein, conserved [Ochrobactrum intermedium LMG 3301]
          Length = 331

 Score =  122 bits (304), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 71/283 (25%), Positives = 130/283 (45%), Gaps = 3/283 (1%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K  Y  VG+F + +   +F  ++W++R  +      E+ +RIPGSV GLS  S V F
Sbjct: 1   METKANYVLVGVFTLIVSLLAFAFVFWIARFGE-ARDSLELDVRIPGSVTGLSIGSQVLF 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NGI VG +  L LD+  P   + K  +   TP+  ST AT+  QGL G  YIEL   R +
Sbjct: 60  NGIKVGDVRALHLDETNPEMVIVKTRVNATTPITRSTAATLGFQGLTGQAYIELKGGRLD 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
           +  +   A + +  A I A PS IN  ++ A++ + + +     ++  +++   PLT TI
Sbjct: 120 EPNLLTEAAKVDSVARIDADPSSINNLLATAQDIAARANSVLGQLEGFVKDARGPLTDTI 179

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
            N +T +  LA N + I+++         +    +  + +  L  +  ++   +      
Sbjct: 180 NNTKTFTDALAKNANIIEEL--GQNTGNINQIVTDAKDMMARLNAASVRVDAILAKTDKL 237

Query: 241 QILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDH 283
              ++          + + +  T  ++ +      +  Q+   
Sbjct: 238 LSSDDKDGVVAQAKATLESIRQTSDNLDKRLGPIADNLQRFSG 280



 Score =  100 bits (248), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 38/196 (19%), Positives = 92/196 (46%), Gaps = 3/196 (1%)

Query: 255 KSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSK--ETSAFLENIADSTSNMR 312
            S  ++      +     T Q++  + + +L      +K      +  + N    T  + 
Sbjct: 131 DSVARIDADPSSINNLLATAQDIAARANSVLGQLEGFVKDARGPLTDTINNTKTFTDALA 190

Query: 313 SSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNISALKENNSLFKDA 372
            + + I E+      I   +   +++ + LN +S +   +++K + + +  + + +   A
Sbjct: 191 KNANIIEELGQNTGNINQIVTDAKDMMARLNAASVRVDAILAKTDKLLSSDDKDGVVAQA 250

Query: 373 QRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFERN 432
           +  + + R TS+ +++ +  I +NLQ FS  GL D+Q++V   + ++   +  + + ERN
Sbjct: 251 KATLESIRQTSDNLDKRLGPIADNLQRFSGQGLRDVQSVVVDSRRSIQRIEQAITDLERN 310

Query: 433 PQDIVWGREKGSVKIY 448
           PQ +++G + G+V  Y
Sbjct: 311 PQRLIFGGQ-GNVPRY 325


>gi|285019445|ref|YP_003377156.1| ABC transporter substrate-binding protein [Xanthomonas albilineans
           GPE PC73]
 gi|283474663|emb|CBA17162.1| putative abc transporter substrate-binding protein [Xanthomonas
           albilineans]
          Length = 308

 Score =  122 bits (304), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 50/297 (16%), Positives = 100/297 (33%), Gaps = 13/297 (4%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K  Y  +G F +           W ++ +  D    E  +    +V GLS  S V++
Sbjct: 1   METKANYVLIGAFTIVTGIALLLFGLWAAKYSS-DRTWQEYRVVFREAVTGLSVGSPVQY 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NGI VG I  L L    P   +A+  +   TP+   T A +    L G T I+LS    E
Sbjct: 60  NGIAVGSITELTLAPNDPRQVVARIRVNSTTPIKSDTRANLGITSLTGPTIIQLSGGAPE 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISD----------SSRHIQKIIE 170
              +   A + +   +I  TPS +      A    +++ +          ++        
Sbjct: 120 APKL--TAIDNSDAPIIQTTPSALQNITDTANQIVERLDELLSKSNVASITATLHNLEKI 177

Query: 171 NIEKPLTTTIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKM 230
           +              +S   A              +     +       + + +      
Sbjct: 178 SGALADRDNGVQSLILSARDATRHLDATLNTANGTIQHLDQNLVKQLPPLLNKLEDTLSK 237

Query: 231 IKAIDLQKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSD 287
           + +        + EN    ++       Q+  T+ ++R   +  ++V  +++   + 
Sbjct: 238 LDSAAGNADKILGENRSAINSFANDGLGQLGPTLTELRSLIRDLRQVSDRLEKNPAR 294



 Score = 83.1 bits (202), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 24/204 (11%), Positives = 71/204 (34%), Gaps = 3/204 (1%)

Query: 248 VSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAFLENIADS 307
            +       + +               Q     + ++    +  ++  +      N+A  
Sbjct: 108 PTIIQLSGGAPEAPKLTAIDNSDAPIIQTTPSALQNITDTANQIVERLDELLSKSNVASI 167

Query: 308 TSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNISALKENNS 367
           T+ + +       + D+   + S I +  + T +L+ +       +  ++    +K+   
Sbjct: 168 TATLHNLEKISGALADRDNGVQSLILSARDATRHLDATLNTANGTIQHLDQNL-VKQLPP 226

Query: 368 LFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLN 427
           L    +  +      +   ++ +    + + +F+  GL  +   + +L+  +       +
Sbjct: 227 LLNKLEDTLSKLDSAAGNADKILGENRSAINSFANDGLGQLGPTLTELRSLIRDLRQVSD 286

Query: 428 NFERNPQDIVWGREKGSVKIYKPK 451
             E+NP   + GR+    K +KPK
Sbjct: 287 RLEKNPARYLLGRDTP--KEFKPK 308


>gi|312115047|ref|YP_004012643.1| hypothetical protein Rvan_2320 [Rhodomicrobium vannielii ATCC
           17100]
 gi|311220176|gb|ADP71544.1| Mammalian cell entry related domain protein [Rhodomicrobium
           vannielii ATCC 17100]
          Length = 311

 Score =  121 bits (303), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 62/291 (21%), Positives = 117/291 (40%), Gaps = 5/291 (1%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++  Y  VG+FV+ ++      IYW+   +   G      + + GSV G++  S V F
Sbjct: 1   METRANYLIVGIFVLGLIAALLGFIYWMKHDSD-GGDGKAYHVILDGSVQGITVASPVMF 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NGI  G +  + L  E          +R DTP+  ++ A I  QGLAG   +E++    +
Sbjct: 60  NGIRFGAVRKIELLPEDTRKVRILISVRQDTPVRTNSHARISQQGLAGWVAMEITPGTPD 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
              +     E+   A+I+A P       +   + + + S  +  +  +I N E  L  T+
Sbjct: 120 MPMLEPKPGEK--IAVISADPGASGSLFAGVSDAAGQASALAVRLNNLIANNEDSLHRTV 177

Query: 181 ANIETISTVLANNISHIDKMMHTTQV--TPHSSDSKNTFNTITDLITSLDKMIKAIDLQK 238
           AN+ET + ++A     I  ++   +      ++ S    + +  L         +I  Q 
Sbjct: 178 ANLETFTGMMAERKDDIAAVIQNVRQLSEKLAAVSAKIDSAVDRLAGESSDNPNSIVSQV 237

Query: 239 VNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFS 289
               +   Q+S        D+          + + F+ + +    L+    
Sbjct: 238 QQAAISIRQLSEKLDKSVGDKSGALTQQADRSLREFELLAKDGRRLVDSLD 288



 Score = 71.9 bits (173), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 24/145 (16%), Positives = 56/145 (38%), Gaps = 1/145 (0%)

Query: 300 FLENIADSTSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNI 359
              N       + +  +    + +++  I + I  +  ++  L   S K    + ++   
Sbjct: 166 IANNEDSLHRTVANLETFTGMMAERKDDIAAVIQNVRQLSEKLAAVSAKIDSAVDRLAGE 225

Query: 360 SALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETV 419
           S     NS+    Q+A  + R  SEK+++ +      L   +   L + + L +  +  V
Sbjct: 226 S-SDNPNSIVSQVQQAAISIRQLSEKLDKSVGDKSGALTQQADRSLREFELLAKDGRRLV 284

Query: 420 NHFDDCLNNFERNPQDIVWGREKGS 444
           +  D  +   +RNP   + G ++  
Sbjct: 285 DSLDRVVQKIDRNPTGFLLGGQQSP 309


>gi|192293076|ref|YP_001993681.1| mammalian cell entry related domain protein [Rhodopseudomonas
           palustris TIE-1]
 gi|192286825|gb|ACF03206.1| Mammalian cell entry related domain protein [Rhodopseudomonas
           palustris TIE-1]
          Length = 398

 Score =  121 bits (302), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 65/421 (15%), Positives = 135/421 (32%), Gaps = 34/421 (8%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++  +  VG FV++ +F  F  ++WL  ++          ++    V GL   ++V F
Sbjct: 1   METRAPFVIVGAFVLAAIFAVFGFVFWLHNTSGVGART-SYHVQFRDPVPGLLVGAAVLF 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NGI VG +  L L  + P    A   + P TP+ P T   +  QGL G+  +        
Sbjct: 60  NGIRVGEVTALALAPDDPRRVDATIAVAPSTPVRPDTKVGLDFQGLTGVPVV-------- 111

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
                  A E  ++   +A  + +        + ++   ++ R +  ++     PL  TI
Sbjct: 112 -------ALEGGKQLSGSAIATTLIAEPGAGMSMTQAAREALRKVDSVLGENSGPLKDTI 164

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
           +N +T S  LA     +D ++   +    +++             +              
Sbjct: 165 SNFKTFSEWLAGKTEKLDGILGGVERMTGANEPVVKKVVYDLSAATGFP----------- 213

Query: 241 QILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAF 300
               +               +      +       EV        SD   KM  ++    
Sbjct: 214 ---PSSPPLKGQLTIPESNTVVLFDSQKMLLAPGLEVPAFAGAQWSDSLPKMLQEKLIQS 270

Query: 301 LENIADSTSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQK-FAELMSKINNI 359
            EN   + + MR + +   +           +    +        S K   +    +   
Sbjct: 271 FENYDIAHAPMRPNDAVQPDYQLLTDIRSFQVIGEGDALRAEIAFSAKIIDKDGKLVAAR 330

Query: 360 SALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETV 419
              + +     +   A+  F  + + I + +            SG  +++      + T 
Sbjct: 331 LFQQASPLDKPEPAAAVSAFDKSFDTIAKELVPWA---AQALASGHAEVEPAATTSRPTT 387

Query: 420 N 420
            
Sbjct: 388 A 388


>gi|167031177|ref|YP_001666408.1| hypothetical protein PputGB1_0156 [Pseudomonas putida GB-1]
 gi|166857665|gb|ABY96072.1| Mammalian cell entry related domain protein [Pseudomonas putida
           GB-1]
          Length = 312

 Score =  121 bits (302), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 53/302 (17%), Positives = 112/302 (37%), Gaps = 2/302 (0%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++ ++  +GL  V ++  +     WL++S+  D    +  +    +V GLS  S V++
Sbjct: 1   METRAHHVLIGLVTVLVVAGAMLFGLWLAKSS-VDDAFKDYEVVFNEAVSGLSRGSPVQY 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NGI VG +  L LD + P   LA+  +  DTP+   T A +   G+ G ++I+LS    +
Sbjct: 60  NGIKVGDVSTLRLDPKDPRRVLARVRLSGDTPVKEDTQAKLTLAGVTGNSFIQLSGGTPQ 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
              +     +     + + +P       S+   T+  +   + +     +NI     T  
Sbjct: 120 SPELKGKDGKL-PVIIASPSPISRLLNDSSDLVTNINLLLHNANQMFSEDNIGHLSNTLA 178

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
              +T       + S  + +    QV   +S +     T+      L        +    
Sbjct: 179 NLDKTTGAFAGQHGSIAEAIEQLVQVGKQASATLAETQTLMRNANGLLGSEGKQAIGSAE 238

Query: 241 QILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAF 300
           + ++++  S+             + D  +         +++   L+      +  E    
Sbjct: 239 RAMQSLAESTATINNLLKNNSEAIGDGAQGLNQLTPAIRELRETLNALKGISRQLEADPS 298

Query: 301 LE 302
             
Sbjct: 299 GY 300



 Score = 78.8 bits (191), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 30/178 (16%), Positives = 67/178 (37%), Gaps = 4/178 (2%)

Query: 273 TFQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNMRSSISAIREITDQRQKIISTI 332
               +      L+++ +  + +       +NI   ++ + +          Q   I   I
Sbjct: 139 PISRLLNDSSDLVTNINLLLHNANQMFSEDNIGHLSNTLANLDKTTGAFAGQHGSIAEAI 198

Query: 333 NTIENITSNLNDSSQKFAELMSKINNISALKENNSLFKDAQRAMHTFRDTSEKINRYIPS 392
             +  +    + +  +   LM   N +    E       A+RAM +  +++  IN  + +
Sbjct: 199 EQLVQVGKQASATLAETQTLMRNANGLLGS-EGKQAIGSAERAMQSLAESTATINNLLKN 257

Query: 393 IGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFERNPQDIVWGREKGSVKIYKP 450
               + +    GLN +   +R+L+ET+N         E +P   + GR+    K ++P
Sbjct: 258 NSEAIGD-GAQGLNQLTPAIRELRETLNALKGISRQLEADPSGYLLGRDNN--KEFQP 312


>gi|146342152|ref|YP_001207200.1| ABC transporter substrate-binding protein [Bradyrhizobium sp.
           ORS278]
 gi|146194958|emb|CAL78983.1| Putative ABC transporter (substrate binding protein)
           [Bradyrhizobium sp. ORS278]
          Length = 366

 Score =  121 bits (302), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 67/390 (17%), Positives = 130/390 (33%), Gaps = 32/390 (8%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++  +  +G FV++ +   F  +YWL+ +    GP     ++  GSV GL   ++V F
Sbjct: 1   METRAPFAVIGGFVLAAIVAIFGFVYWLNNTGGL-GPRTTYHVQFEGSVPGLLVGAAVLF 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NGI VG +  L L  + P    A   +   TP+   T   +  QGL G+  + L      
Sbjct: 60  NGIRVGEVTELGLAPDNPRRVNATISVASSTPVRTDTKVGLEFQGLTGVPVVALEAGS-- 117

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
                             A  S +       ++ ++   D+ R +  ++     PL  TI
Sbjct: 118 --------------LTAAAPGSTLMAEPGAGQSMTQAARDALRRVDAVLAENAGPLKDTI 163

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
           AN++T S  LA N   +D ++   +                                   
Sbjct: 164 ANLKTFSDGLARNTGKLDGIVSGLEKMTGGGAPAQKVTYDLTA---------------PR 208

Query: 241 QILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAF 300
            +    +             +  +   R      ++     D L +D   K+        
Sbjct: 209 DLGPVNKTIKGQLAIPEPTAVAMLQTQRMLFSPAKDYPGFGDVLWADSIPKLLQARLIDT 268

Query: 301 LENIADSTSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNIS 360
            EN   + + +R+S     ++          IN      +++  S++   +    I +  
Sbjct: 269 FENYDVAHAPLRASDLGQPDVQLLIDVRRFRINVDATAVADIGLSARLVDKSGKIIASRL 328

Query: 361 ALKENNSLFKDAQRAMHTFRDTSEKINRYI 390
             +       +   A+  F     ++ + I
Sbjct: 329 FDESQPVGQINPADAVAAFDQAFGRLAKSI 358


>gi|158423839|ref|YP_001525131.1| ABC-type transport system protein [Azorhizobium caulinodans ORS
           571]
 gi|158330728|dbj|BAF88213.1| ABC-type transport system protein [Azorhizobium caulinodans ORS
           571]
          Length = 307

 Score =  121 bits (301), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 43/289 (14%), Positives = 94/289 (32%), Gaps = 1/289 (0%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++  YT +G+F ++++  +F  +YW +     D       +   GSV GL   ++V F
Sbjct: 1   METRANYTVIGIFTLAVIAAAFVFVYWFAGPKDSDKRK-LYEVLYQGSVSGLREGNAVLF 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NGIPVG++  L L    PN  L +  +R D P+     A++ +QG+ GI  + +     +
Sbjct: 60  NGIPVGQVTKLGLVPGAPNEVLVQIGVRNDVPILADARASLESQGITGIVAVSIQGGNAK 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
              I        +   +  T        +            +    ++ + +      + 
Sbjct: 120 AGPIPPGPNGLPRIEALGGTGMAGLLQNAQGTVAKVNSILDAIDPDQVRQIVANVENVSK 179

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
              +    + +      D +    ++              +     L             
Sbjct: 180 QLSDNSGDIASMISGVKDAVAQVNEIAKKVDVVVVNLQHASGDKDGLLNQATEAATAVRK 239

Query: 241 QILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFS 289
                 Q ++    + S      +          +    +I+ +  +  
Sbjct: 240 LADNLDQRTALLTNEISRFTGPGLRQYEALAADGRRTLTEIERVFRNLE 288



 Score = 82.3 bits (200), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 28/168 (16%), Positives = 70/168 (41%), Gaps = 4/168 (2%)

Query: 281 IDHLLSDFSSKMKSKETSAFLENIADSTSNMRSSISAIREITDQRQKIISTINTIENITS 340
           +  LL +    +    +     +       + +  +  ++++D    I S I+ +++  +
Sbjct: 141 MAGLLQNAQGTVAKVNSILDAIDPDQVRQIVANVENVSKQLSDNSGDIASMISGVKDAVA 200

Query: 341 NLNDSSQKFAELMSKINNISALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNF 400
            +N+ ++K   ++  +N   A  + + L   A  A    R  ++ +++    + N +  F
Sbjct: 201 QVNEIAKKVDVVV--VNLQHASGDKDGLLNQATEAATAVRKLADNLDQRTALLTNEISRF 258

Query: 401 SQSGLNDIQNLVRKLQETVNHFDDCLNNFERNPQDIVWGREKGSVKIY 448
           +  GL   + L    + T+   +    N ERNP+  ++G    S+  Y
Sbjct: 259 TGPGLRQYEALAADGRRTLTEIERVFRNLERNPRQFIFGG--NSIPEY 304


>gi|300312194|ref|YP_003776286.1| organic solvents resistance ABC transporter periplasmic protein
           [Herbaspirillum seropedicae SmR1]
 gi|300074979|gb|ADJ64378.1| ABC-type transport system involved in resistance to organic
           solvents, periplasmic component protein [Herbaspirillum
           seropedicae SmR1]
          Length = 305

 Score =  121 bits (301), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 50/296 (16%), Positives = 115/296 (38%), Gaps = 6/296 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++ ++  +GLF + +   +     WL+++ Q D  +    +    +V GLS  S V++
Sbjct: 1   METRAHHVLIGLFTILVALGALGFCLWLTKAGQ-DRDVDYYTVIFNEAVSGLSRGSPVQY 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           +GI VG +VGL LD   P    A+  +    P+   T A +   G+ G   I+L+    +
Sbjct: 60  SGIKVGDVVGLSLDPADPRKVRARIRVVGRAPIKEDTGAKLALAGITGTALIQLTNGSPQ 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKI--IENIEKPLTT 178
              +     +     +I A+PS ++  +SN E+    +++   + ++    +N  +   T
Sbjct: 120 SPRLES---KDGSDPVIIASPSPLSALLSNGEDLLGNVNEVLINAKQFLAPDNARRLNAT 176

Query: 179 TIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQK 238
                E  ST+ A   +    M    +    ++ +  + N +     +         ++ 
Sbjct: 177 LAHLEELTSTLAAQRNNAGAAMQELAEAARQANLAMQSANQLLSTRGNDAMSNLQQAMRS 236

Query: 239 VNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKS 294
           +    + ++        + +     V ++       +     +  +     S   +
Sbjct: 237 LAASSQQVERLIQQNQAALNNGAQGVAEIGPAIAELRATLSSVRAVSRKLESNPGA 292



 Score = 61.9 bits (147), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 28/170 (16%), Positives = 67/170 (39%), Gaps = 4/170 (2%)

Query: 281 IDHLLSDFSSKMKSKETSAFLENIADSTSNMRSSISAIREITDQRQKIISTINTIENITS 340
           +  LLS+    + +            +  N R   + +  + +    + +  N       
Sbjct: 140 LSALLSNGEDLLGNVNEVLINAKQFLAPDNARRLNATLAHLEELTSTLAAQRNNAGAAMQ 199

Query: 341 NLNDSSQKFAELMSKINNISALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNF 400
            L +++++    M   N + + +  N    + Q+AM +   +S+++ R I      L N 
Sbjct: 200 ELAEAARQANLAMQSANQLLSTR-GNDAMSNLQQAMRSLAASSQQVERLIQQNQAALNN- 257

Query: 401 SQSGLNDIQNLVRKLQETVNHFDDCLNNFERNPQDIVWGREKGSVKIYKP 450
              G+ +I   + +L+ T++         E NP   + G +  +V+ ++P
Sbjct: 258 GAQGVAEIGPAIAELRATLSSVRAVSRKLESNPGAYLLGHD--NVQEFQP 305


>gi|160872759|ref|ZP_02062891.1| ABC transport system periplasmic substrate binding protein
           [Rickettsiella grylli]
 gi|159121558|gb|EDP46896.1| ABC transport system periplasmic substrate binding protein
           [Rickettsiella grylli]
          Length = 265

 Score =  121 bits (301), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 55/229 (24%), Positives = 95/229 (41%), Gaps = 4/229 (1%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M++K  YT VG FV+ +       I WLS +          ++ +  SV GL+ +S V++
Sbjct: 1   MDTKVNYTLVGAFVLILTMTLVIFIVWLS-TGISTKRYKHFLVIMHESVSGLAVNSPVKY 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NG+ VG +  ++L Q  P        I   TP+   TTAT+ +QGL GI Y+ L      
Sbjct: 60  NGVVVGSVKKIYLTQNNPEQVRLLLQIEEHTPVTEGTTATLNSQGLTGIVYVALKGSDTH 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQ-KIIENIEKPLTTT 179
              I ++  E+    +I +TPS          + +  ++  +  I   +       L   
Sbjct: 120 LNPIPRLHGEK--YPIIKSTPSFFFRLDHTLRDLNHNMNQITEDINGILGGENPILLKKI 177

Query: 180 IANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLD 228
           + N+   S  LA      D ++  T  +  S  +     +   L ++  
Sbjct: 178 LNNLSITSQHLAAQSKCFDTILINTARSSRSFPALMNTLSQQTLPSTNQ 226



 Score = 42.6 bits (97), Expect = 0.13,   Method: Composition-based stats.
 Identities = 24/190 (12%), Positives = 60/190 (31%), Gaps = 4/190 (2%)

Query: 260 VINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNM-RSSISAI 318
           +     +        +E     +   +  +S+  +      L+      + + R      
Sbjct: 72  LTQNNPEQVRLLLQIEEHTPVTEGTTATLNSQGLTGIVYVALKGSDTHLNPIPRLHGEKY 131

Query: 319 REITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNISALKENNSLFKDAQRAMHT 378
             I           +T+ ++  N+N  ++    ++   N I   K  N+L   +Q     
Sbjct: 132 PIIKSTPSFFFRLDHTLRDLNHNMNQITEDINGILGGENPILLKKILNNLSITSQHLAAQ 191

Query: 379 ---FRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFERNPQD 435
              F        R   S    +   SQ  L     ++  L    ++  +  ++  +NP  
Sbjct: 192 SKCFDTILINTARSSRSFPALMNTLSQQTLPSTNQVLNNLSLITDNLLELSDHLRQNPSL 251

Query: 436 IVWGREKGSV 445
           ++ G++   +
Sbjct: 252 LIRGQKPPPL 261


>gi|148257021|ref|YP_001241606.1| ABC transporter substrate-binding protein [Bradyrhizobium sp.
           BTAi1]
 gi|146409194|gb|ABQ37700.1| Putative ABC transporter (substrate binding protein)
           [Bradyrhizobium sp. BTAi1]
          Length = 367

 Score =  120 bits (300), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 67/390 (17%), Positives = 128/390 (32%), Gaps = 31/390 (7%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++  +  +G FV++ +   F  +YWL+ +    GP     ++  GSV GL   ++V F
Sbjct: 1   METRAPFAVIGGFVLAAIVAIFGFVYWLNNTGGL-GPRTSYHVQFEGSVPGLLVGAAVLF 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NGI VG +  L L  + P    A   +    P+   T   +  QGL G            
Sbjct: 60  NGIRVGEVTDLVLAPDNPRRVNATISVATSVPVRSDTKVGLEFQGLTG------------ 107

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
              +  IA E       +   S +       ++ ++   D+ R +  ++     PL  TI
Sbjct: 108 ---VPVIALEGGSSTATSGPVSILIAEPGAGQSMTQAARDALRRVDAVLAENAGPLKDTI 164

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
           AN+ T S  LA N   +D ++   +                        +          
Sbjct: 165 ANLRTFSDGLARNTGKLDSIVSGLEKMTGGGAPAQKVTYDLRAPRDFGPI---------- 214

Query: 241 QILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAF 300
                 +             +  +   R      ++     D L +D   K+        
Sbjct: 215 -----AKTIKGQLAIPEPTAVAMLQTQRILFSPAKDYPGFGDALWADSIPKLLQARLIDA 269

Query: 301 LENIADSTSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNIS 360
            EN   + + +R++     ++          INT       +  S++   +    I +  
Sbjct: 270 FENYDIAHAPLRTADLGQPDVQLLVDVRRFRINTDPTAVVEIGLSARLVDKSGKIIASRL 329

Query: 361 ALKENNSLFKDAQRAMHTFRDTSEKINRYI 390
             +       D   A+  F     ++ + +
Sbjct: 330 FDESQPVDRLDPAIAVTAFDQAFGRVAKSL 359


>gi|39937296|ref|NP_949572.1| hypothetical protein RPA4236 [Rhodopseudomonas palustris CGA009]
 gi|39651154|emb|CAE29677.1| Mce4/Rv3499c/MTV023.06c protein [Rhodopseudomonas palustris CGA009]
          Length = 398

 Score =  120 bits (300), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 65/417 (15%), Positives = 133/417 (31%), Gaps = 34/417 (8%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++  +  VG FV++ +F  F  ++WL  ++          ++    V GL   ++V F
Sbjct: 1   METRAPFVIVGAFVLAAIFAVFGFVFWLHNTSGVGART-SYHVQFRDPVPGLLVGAAVLF 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NGI VG +  L L  + P    A   + P TP+ P T   +  QGL G+  +        
Sbjct: 60  NGIRVGEVTALALAPDDPRRVDATIAVAPSTPVRPDTKVGLDFQGLTGVPVV-------- 111

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
                  A E  ++   +A  + +        + ++   ++ R +  ++     PL  TI
Sbjct: 112 -------ALEGGKQLSGSAIATTLVAEPGAGMSMTQAAREALRKVDSVLGENSGPLKDTI 164

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
           AN +T S  LA     +D ++   +    +++             +              
Sbjct: 165 ANFKTFSEWLAGKTEKLDGILGGVERMTGANEPVVKKVVYDLSAATGFPPPSP------- 217

Query: 241 QILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAF 300
                               +      +       EV        SD   KM  ++    
Sbjct: 218 -------PLKGQLTIPESNTVVLFDSQKMLLAPGLEVPAFAGAQWSDSLPKMLQEKLIQS 270

Query: 301 LENIADSTSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQK-FAELMSKINNI 359
            EN   + + MR + +   +           +    +        S K   +    +   
Sbjct: 271 FENYDIAHAPMRPNDAVQPDYQLLTDIRSFQVIGEGDALRAEIAFSAKIIDKDGKLVAAR 330

Query: 360 SALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQ 416
              + +     +   A+  F  + + I + +            SG  +++      +
Sbjct: 331 LFQQASPLDKPEPAAAVSAFDKSFDTIAKELVPWA---AQALASGRAEVEPAATTSR 384


>gi|153009439|ref|YP_001370654.1| hypothetical protein Oant_2109 [Ochrobactrum anthropi ATCC 49188]
 gi|151561327|gb|ABS14825.1| Mammalian cell entry related domain protein [Ochrobactrum anthropi
           ATCC 49188]
          Length = 331

 Score =  120 bits (300), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 71/283 (25%), Positives = 128/283 (45%), Gaps = 3/283 (1%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K  Y  VG+F + +   +F  ++W++R  +      E+ +RIPGSV GLS  S V F
Sbjct: 1   METKANYVLVGVFTLIVSLLAFAFVFWIARFGE-ARDSQELDVRIPGSVTGLSLGSQVLF 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NGI VG +  L LD+  P   + K  +   TP+  ST AT+  QGL G  YIEL   R +
Sbjct: 60  NGIKVGDVRALKLDETNPEMVIVKTRVNATTPITRSTAATLGFQGLTGQAYIELKGGRLD 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
           +  +   A   +  A I A PS IN  ++ A++ + + +     ++  +++   PLT TI
Sbjct: 120 EPNLLTEAANVDSVARIDADPSSINNLLATAQDIAARANAVLGQLEGFVKDARGPLTDTI 179

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
            N +T +  LA N + I ++         +    +  + +  L  +  ++   +      
Sbjct: 180 NNTKTFTDALAQNANIIQEL--GENTGNINQIVTDAKDMMARLNAASVRVDAILAKTDKL 237

Query: 241 QILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDH 283
              ++          + + +  T  ++ +      +  Q+   
Sbjct: 238 LSSDDKDGVVAQAKATLESIRQTSDNLDKRMGPIADNLQRFSG 280



 Score =  101 bits (251), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 39/196 (19%), Positives = 94/196 (47%), Gaps = 3/196 (1%)

Query: 255 KSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSK--ETSAFLENIADSTSNMR 312
            S  ++      +     T Q++  + + +L      +K      +  + N    T  + 
Sbjct: 131 DSVARIDADPSSINNLLATAQDIAARANAVLGQLEGFVKDARGPLTDTINNTKTFTDALA 190

Query: 313 SSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNISALKENNSLFKDA 372
            + + I+E+ +    I   +   +++ + LN +S +   +++K + + +  + + +   A
Sbjct: 191 QNANIIQELGENTGNINQIVTDAKDMMARLNAASVRVDAILAKTDKLLSSDDKDGVVAQA 250

Query: 373 QRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFERN 432
           +  + + R TS+ +++ +  I +NLQ FS  GL D+Q++V   + ++   +  + + ERN
Sbjct: 251 KATLESIRQTSDNLDKRMGPIADNLQRFSGQGLRDVQSVVVDSRRSIQRIEQAITDLERN 310

Query: 433 PQDIVWGREKGSVKIY 448
           PQ +++G  KG+V  Y
Sbjct: 311 PQRLIFGG-KGNVPQY 325


>gi|325273984|ref|ZP_08140143.1| hypothetical protein G1E_12677 [Pseudomonas sp. TJI-51]
 gi|324100873|gb|EGB98560.1| hypothetical protein G1E_12677 [Pseudomonas sp. TJI-51]
          Length = 312

 Score =  120 bits (300), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 53/302 (17%), Positives = 110/302 (36%), Gaps = 2/302 (0%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++ ++  +GL  V ++  +     WL++S+  D    +  +    +V GLS  S V++
Sbjct: 1   METRAHHVLIGLVTVLVVAGAMLFGLWLTKSS-VDDAFKDYEVVFNEAVSGLSRGSPVQY 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NGI VG +  L LD + P   LA+  +  DTP+   T A +   G+ G ++I+LS    +
Sbjct: 60  NGIKVGDVSTLRLDPKDPRRVLARVRLSGDTPVKEDTQAKLTLAGVTGNSFIQLSGGTPQ 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
              +     +     + + +P       S+   T+  +   + +      NI+    T  
Sbjct: 120 SPELKGKDGKL-PVIIASPSPISRLLNDSSDLVTNINLLLHNANQMFSEGNIDHLSNTLA 178

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
              +T       + S    +    QV   +S +      +      L        +    
Sbjct: 179 NLDKTTGAFAGEHGSISQAIEQLVQVGKQASATLAETQVLMRNANGLLGTEGKQAIGSAE 238

Query: 241 QILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAF 300
           Q ++++  S+             + D  +         +++   L+      +  E    
Sbjct: 239 QAMQSLAQSTATINSLLKDNSEAIGDGAQGLNQLTPAIRELRETLNALKGISRQLEADPS 298

Query: 301 LE 302
             
Sbjct: 299 GY 300



 Score = 78.8 bits (191), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 28/178 (15%), Positives = 64/178 (35%), Gaps = 4/178 (2%)

Query: 273 TFQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNMRSSISAIREITDQRQKIISTI 332
               +      L+++ +  + +        NI   ++ + +          +   I   I
Sbjct: 139 PISRLLNDSSDLVTNINLLLHNANQMFSEGNIDHLSNTLANLDKTTGAFAGEHGSISQAI 198

Query: 333 NTIENITSNLNDSSQKFAELMSKINNISALKENNSLFKDAQRAMHTFRDTSEKINRYIPS 392
             +  +    + +  +   LM   N +    E       A++AM +   ++  IN  +  
Sbjct: 199 EQLVQVGKQASATLAETQVLMRNANGLLGT-EGKQAIGSAEQAMQSLAQSTATINSLLKD 257

Query: 393 IGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFERNPQDIVWGREKGSVKIYKP 450
               + +    GLN +   +R+L+ET+N         E +P   + GR+    K ++P
Sbjct: 258 NSEAIGD-GAQGLNQLTPAIRELRETLNALKGISRQLEADPSGYLLGRDNN--KEFQP 312


>gi|154248036|ref|YP_001418994.1| hypothetical protein Xaut_4115 [Xanthobacter autotrophicus Py2]
 gi|154162121|gb|ABS69337.1| Mammalian cell entry related domain protein [Xanthobacter
           autotrophicus Py2]
          Length = 307

 Score =  120 bits (300), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 40/118 (33%), Positives = 60/118 (50%), Gaps = 1/118 (0%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++  YT +G F +++L  +F  +YW +         A   +   GSV GL   ++V F
Sbjct: 1   METRANYTIIGAFTLAVLAAAFGFVYWFAGPQDSSARKA-YEVLFDGSVAGLRQGNNVLF 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLR 118
           NGIPVG++ GL L    P   LA+  I  D P+    TA + +QGL GI  + +    
Sbjct: 60  NGIPVGQVTGLGLVPGQPGQVLARVAINNDVPVLSDATAGLESQGLTGIVVVSIHGGH 117



 Score = 88.1 bits (215), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 31/197 (15%), Positives = 72/197 (36%), Gaps = 3/197 (1%)

Query: 252 NFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNM 311
           +                   +   + G  +  L++      +  E      N  D  + +
Sbjct: 112 SIHGGHPGAPPLPLGPNGVPRITADGGAGMSGLINSAQGVARKIEVVLDAINPQDIKNII 171

Query: 312 RSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNISALKENNSLFKD 371
            +  +  + +  + + + S I     +   LN  ++K   ++  +    A ++ + L   
Sbjct: 172 ANIDTFSKAVASKSEDVASLIEQSNALVKQLNGVAEKVDRVVVNLQK--ATEDKDGLLVQ 229

Query: 372 AQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFER 431
           A  A  + R  ++ +++    +   +  F+  GL   + L    + T++  D  L N ER
Sbjct: 230 ATDAATSVRKLADNLDQRTALLTEQVSRFTGPGLKQYEALATDGRRTLSEIDRVLRNIER 289

Query: 432 NPQDIVWGREKGSVKIY 448
           NPQ  ++G    S+  Y
Sbjct: 290 NPQQFIFGG-GNSIPKY 305


>gi|120554122|ref|YP_958473.1| hypothetical protein Maqu_1195 [Marinobacter aquaeolei VT8]
 gi|120323971|gb|ABM18286.1| Mammalian cell entry related domain protein [Marinobacter aquaeolei
           VT8]
          Length = 312

 Score =  120 bits (300), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 43/292 (14%), Positives = 101/292 (34%), Gaps = 6/292 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME K ++  +G F ++ +  +     WL +S+  D   A   I     V GL+  + V +
Sbjct: 1   MEPKAHHVIIGFFTLAAVIAALLFALWLGKSST-DTNWAYYRIGFDHPVGGLAKGNPVLY 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G+PVG ++ L L  + P H      +  D P+  +T A +    + G   I+ +    +
Sbjct: 60  TGVPVGDVLDLTLAPDNPAHVRVLVRVNQDIPVRENTRAGLVLANITGSMSIQFTGGTPD 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
              +      +    +I A PS  +  ++N E    K      +  +++          I
Sbjct: 120 SPILEGH---KANPPLIAAEPSAFSNLLTNGEAMLGKAEQLLENANRLMSEDNLSNIAEI 176

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQ--K 238
                 ++          + + T          +           S + + + ++     
Sbjct: 177 LENARQASESLLASRDELEALMTRFDEAGIRAEEAAIKVSAAADRSREVLDERVEPVLLA 236

Query: 239 VNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSS 290
           +++ L  +Q + +     +      +    +         +++   L + +S
Sbjct: 237 MSRALTTLQPTLDRLDTLTGDNELALDAGLQGLGEITPALRELRSTLRNLNS 288



 Score = 61.1 bits (145), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 24/176 (13%), Positives = 69/176 (39%), Gaps = 4/176 (2%)

Query: 274 FQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNMRSSISAIREITDQRQKIISTIN 333
           F  +    + +L      +++       +N+++    + ++  A   +   R ++ + + 
Sbjct: 140 FSNLLTNGEAMLGKAEQLLENANRLMSEDNLSNIAEILENARQASESLLASRDELEALMT 199

Query: 334 TIENITSNLNDSSQKFAELMSKINNISALKENNSLFKDAQRAMHTFRDTSEKINRYIPSI 393
             +       +++ K +    +   +   +    L     RA+ T + T ++++      
Sbjct: 200 RFDEAGIRAEEAAIKVSAAADRSREVLDERVEPVLLA-MSRALTTLQPTLDRLDTLTGDN 258

Query: 394 GNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFERNPQDIVWGREKGSVKIYK 449
              L +    GL +I   +R+L+ T+ + +      E++P   +WG     +K Y+
Sbjct: 259 ELAL-DAGLQGLGEITPALRELRSTLRNLNSFTRRLEQDPTGTLWGGTG--IKEYE 311


>gi|148560680|ref|YP_001258962.1| putative ABC transporter periplasmic substrate-binding protein
           [Brucella ovis ATCC 25840]
 gi|148371937|gb|ABQ61916.1| putative ABC transporter, periplasmic substrate-binding protein
           [Brucella ovis ATCC 25840]
          Length = 331

 Score =  120 bits (300), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 67/283 (23%), Positives = 123/283 (43%), Gaps = 3/283 (1%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K  Y  VG+F + +   +F  +YW++R  +       + +RI GSV GL   S V F
Sbjct: 1   METKANYVLVGVFTLLVSLLAFGFVYWIARYGE-ARDSLPLDVRIQGSVTGLGIGSQVLF 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NGI VG +  L LD   P   + +  +   TP+  STTAT+  QGL G  YIEL   R +
Sbjct: 60  NGIKVGDVRRLHLDDSNPGMVIVQTHVNATTPITRSTTATLGFQGLTGQAYIELKGGRLD 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
           +  +   A + +  A I A  S +N  ++ A++ + + ++    ++  +++   PLT TI
Sbjct: 120 EPNLLTEAAKEDTVARIDADLSAVNNLLATAQDIAARANNVLSQLEGFVKDARGPLTDTI 179

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
            N +T +  LA+N   I ++              +  + +  L  +  K+   ++     
Sbjct: 180 NNTKTFTQALADNADIIQELGQNASNIRQI--VVDAKDMMARLNAASVKVESILNKTDKM 237

Query: 241 QILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDH 283
              ++        + +   +  T ++             +   
Sbjct: 238 LSADDKNGLVAQAITTLQSIRETSNNFEARLAPIANNLDRFSG 280



 Score = 93.1 bits (228), Expect = 9e-17,   Method: Composition-based stats.
 Identities = 40/202 (19%), Positives = 82/202 (40%), Gaps = 6/202 (2%)

Query: 247 QVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAFLENIAD 306
           + +          V N +   ++       V  +++  + D          +  + N   
Sbjct: 130 EDTVARIDADLSAVNNLLATAQDIAARANNVLSQLEGFVKDARG-----PLTDTINNTKT 184

Query: 307 STSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNISALKENN 366
            T  +  +   I+E+      I   +   +++ + LN +S K   +++K + + +  + N
Sbjct: 185 FTQALADNADIIQELGQNASNIRQIVVDAKDMMARLNAASVKVESILNKTDKMLSADDKN 244

Query: 367 SLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCL 426
            L   A   + + R+TS      +  I NNL  FS  GL ++Q +V   +  +   +  +
Sbjct: 245 GLVAQAITTLQSIRETSNNFEARLAPIANNLDRFSGQGLREMQGVVIDSRRAIQRIEQVI 304

Query: 427 NNFERNPQDIVWGREKGSVKIY 448
              ERNPQ +++G   GSV  Y
Sbjct: 305 TELERNPQRLIFGG-PGSVPQY 325


>gi|92117462|ref|YP_577191.1| hypothetical protein Nham_1923 [Nitrobacter hamburgensis X14]
 gi|91800356|gb|ABE62731.1| Mammalian cell entry related protein [Nitrobacter hamburgensis X14]
          Length = 369

 Score =  120 bits (299), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 36/118 (30%), Positives = 58/118 (49%), Gaps = 1/118 (0%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++  +  +G FV++ +   F  +YWL  +    GP A   ++  GSV GL   ++V F
Sbjct: 1   METRAPFVIIGAFVLAAIAAVFGFVYWLHNTGGL-GPRATYHVQFEGSVPGLLVGAAVLF 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLR 118
           NGI VG +  L L  + P+   A   +   TP+   T   +  QGL G+  + L   +
Sbjct: 60  NGIRVGEVTELSLAPDNPHRVDAAIAVTSTTPVRSDTKVGLEFQGLTGVPVVALEGGQ 117


>gi|163744193|ref|ZP_02151553.1| Putative ABC transporter, periplasmic substrate-binding protein
           [Oceanibulbus indolifex HEL-45]
 gi|161381011|gb|EDQ05420.1| Putative ABC transporter, periplasmic substrate-binding protein
           [Oceanibulbus indolifex HEL-45]
          Length = 571

 Score =  120 bits (298), Expect = 6e-25,   Method: Composition-based stats.
 Identities = 50/397 (12%), Positives = 125/397 (31%), Gaps = 19/397 (4%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++  +  +G F ++I+  +     WLS   Q D   A   I     V GL    +V F
Sbjct: 1   METRANFILIGAFTLAIIIGTLGFFIWLSSV-QIDRQYATYGILF-DDVSGLDPSGNVLF 58

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NGI VG++ G+ + ++  +       I   TP+  +T A +++QG+ G+ YI LS     
Sbjct: 59  NGISVGKVTGINIHEDDASKVFVTIEIDSSTPVRANTVAQVQSQGVTGVAYISLSGGTPG 118

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
              +        ++  +   PS  +      E+    +  ++  + ++   +        
Sbjct: 119 AAPL------EAEQDGLPMIPSERSTVQLLVEDAPDLMVQANDLMAQLQALLGP------ 166

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
                  T +A  + +++                +          SL             
Sbjct: 167 ----ENQTRVAGILQNLESSSGRLDQALTDFSEISGTVNEATAQISLFTDKLDSITGSAQ 222

Query: 241 QILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAF 300
             L     +  +   + +   +++       +  +        LL +    +    +   
Sbjct: 223 ATLGRADAALASAQSAFETAESSMAATDSAIRNVEGTFDAAQVLLRNTLPPLLEDLSHTI 282

Query: 301 LENIADSTSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNIS 360
                      +   + +  + +    + + ++ +       + +           + + 
Sbjct: 283 GRADDAIADLQQRGGATLDGVAETSGLLNARLSDLGQTLDEADRAFVSVTSAADSFD-ML 341

Query: 361 ALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNL 397
              E   +  +A+  + T     E +   + S    +
Sbjct: 342 VSGEGAQMVTEARTVLGTANVALETLEGLVQSDIPAV 378



 Score = 53.4 bits (125), Expect = 7e-05,   Method: Composition-based stats.
 Identities = 17/182 (9%), Positives = 57/182 (31%), Gaps = 9/182 (4%)

Query: 266 DVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNMRSSISAIREITDQR 325
           DV   T  F  +  + +  L   ++  +  + S    +   + ++   + +         
Sbjct: 399 DVTGATTRFVPITAQAEAALGSANALFERAQLSLSRLDTTLAGTDGALASAETALDAVSG 458

Query: 326 QKIISTINTIENITSNLNDSSQKFAELMSKINNISALKENNSLFKDAQRAMHTFRDTSEK 385
                    + ++ +     S    ++           +  ++  D +  +         
Sbjct: 459 VIQTDFAPVLMDLRTASERISIAVEDVTR---------DVPAIAADLRGLIARADTVVAS 509

Query: 386 INRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFERNPQDIVWGREKGSV 445
               I +    L NF+++GL ++  L  + +  V   ++ +   + +P   +  +     
Sbjct: 510 AQSAIDATAPGLGNFARTGLPELTRLSAEARGLVATLNNLVRRIDSDPARFLLDKRVPDY 569

Query: 446 KI 447
           + 
Sbjct: 570 RR 571


>gi|115523757|ref|YP_780668.1| hypothetical protein RPE_1739 [Rhodopseudomonas palustris BisA53]
 gi|115517704|gb|ABJ05688.1| Mammalian cell entry related domain protein [Rhodopseudomonas
           palustris BisA53]
          Length = 384

 Score =  120 bits (298), Expect = 6e-25,   Method: Composition-based stats.
 Identities = 37/145 (25%), Positives = 62/145 (42%), Gaps = 1/145 (0%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++  +  VG FV++ +   F  ++WL  S+          +   GSV GL   ++V F
Sbjct: 1   METRAPFILVGAFVLAAIGAVFGFVFWLHNSSGLGART-SYQVHFNGSVPGLLVGAAVLF 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NGI VG +  L L  + P    A   +   TP+   T   +  QGL G+  I L    ++
Sbjct: 60  NGIRVGEVTALGLAPDDPRQVNASIAVDVATPVRADTKVGLDFQGLTGVPVIALEGGSQK 119

Query: 121 KKTIFQIATERNQRAMITATPSGIN 145
             +        +  A  + T +  +
Sbjct: 120 TASGPVPTLIADPGAGQSMTQAARD 144


>gi|152987511|ref|YP_001347294.1| hypothetical protein PSPA7_1913 [Pseudomonas aeruginosa PA7]
 gi|150962669|gb|ABR84694.1| hypothetical protein PSPA7_1913 [Pseudomonas aeruginosa PA7]
          Length = 312

 Score =  120 bits (298), Expect = 7e-25,   Method: Composition-based stats.
 Identities = 57/293 (19%), Positives = 120/293 (40%), Gaps = 7/293 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++ ++  +GLF V ++  +     WL++S   +G      I    +V GLS  SSV++
Sbjct: 1   METRAHHVLIGLFSVIVIGAALLFGLWLAKSGS-EGKFNYYDIVFNEAVSGLSQGSSVQY 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           +GI VG +  L LD + P    A+  +    P+   TTA +   G+ G + I+LS+    
Sbjct: 60  SGIKVGDVAFLRLDPQDPRKVWARIRVVASAPIKQDTTAKLALTGITGTSIIQLSSGTPS 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISD-SSRHIQKIIENIEKPLTTT 179
              +     +  +  +I ATPS +   +SN E+    I+   +R    + E     ++ T
Sbjct: 120 SPMLEG---KDGKIPVIVATPSPLTQLLSNGEDLMGNINQLIARFSNLLSEENSARISRT 176

Query: 180 IANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKV 239
           + +++  +  L+    ++  +M        S  +       ++L+ + + ++       +
Sbjct: 177 LDHLDQATGALSAERENVSAVMQQLA--QASKQANAALAQASELMRNANGLLNEQGKGML 234

Query: 240 NQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKM 292
               + +             +    H +    Q   E+G  +  L    ++  
Sbjct: 235 ENASKTMASLERTSATLDQLISENRHSLDGGIQGIAELGPAVSELRDTLAALR 287



 Score = 75.4 bits (182), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 31/182 (17%), Positives = 75/182 (41%), Gaps = 4/182 (2%)

Query: 269 ETTQTFQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNMRSSISAIREITDQRQKI 328
            T     ++    + L+ + +  +         EN A  +  +     A   ++ +R+ +
Sbjct: 135 ATPSPLTQLLSNGEDLMGNINQLIARFSNLLSEENSARISRTLDHLDQATGALSAERENV 194

Query: 329 ISTINTIENITSNLNDSSQKFAELMSKINNISALKENNSLFKDAQRAMHTFRDTSEKINR 388
            + +  +   +   N +  + +ELM   N +   ++   + ++A + M +   TS  +++
Sbjct: 195 SAVMQQLAQASKQANAALAQASELMRNANGLLN-EQGKGMLENASKTMASLERTSATLDQ 253

Query: 389 YIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFERNPQDIVWGREKGSVKIY 448
            I    ++L      G+ ++   V +L++T+          E NP + + GREK   K +
Sbjct: 254 LISENRHSLDG-GIQGIAELGPAVSELRDTLAALRGISRRLEENPANYLLGREKT--KEF 310

Query: 449 KP 450
            P
Sbjct: 311 TP 312


>gi|49085066|gb|AAT51249.1| PA3213 [synthetic construct]
          Length = 313

 Score =  120 bits (298), Expect = 7e-25,   Method: Composition-based stats.
 Identities = 56/295 (18%), Positives = 120/295 (40%), Gaps = 9/295 (3%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++ ++  +GLF V ++  +     WL++S   +G      I    +V GLS  SSV++
Sbjct: 1   METRAHHVLIGLFSVIVIGAALLFGLWLAKSGS-EGKFNYYDIVFNEAVSGLSQGSSVQY 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           +GI VG +  L LD + P    A+  +    P+   TTA +   G+ G + I+LS+    
Sbjct: 60  SGIKVGDVAFLRLDPKDPRKVWARIRVVASAPIKQDTTAKLALTGITGTSIIQLSSGTPA 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
              +     +  +  +I ATPS +   +SN E+    I+        ++         T 
Sbjct: 120 SPMLEG---KDGKIPVIVATPSPLTQSLSNGEDLMGNINQLIARFSNLLSE-----ENTA 171

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
               T+  +     +   +  + + V    + +    N      + L +    +  ++  
Sbjct: 172 RISRTLDHLDQATGALSAERENVSAVMQQLAQASRQANAALAQASELMRSANGLLNEQGK 231

Query: 241 QILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSK 295
            +LEN   +  +  ++S  +   + + R +     +   ++   +S+    + + 
Sbjct: 232 GMLENANKTMASLERTSATLDQLISENRHSLDGGIQGLAELGPAVSELRDTLAAL 286



 Score = 75.7 bits (183), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 32/182 (17%), Positives = 74/182 (40%), Gaps = 4/182 (2%)

Query: 269 ETTQTFQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNMRSSISAIREITDQRQKI 328
            T     +     + L+ + +  +         EN A  +  +     A   ++ +R+ +
Sbjct: 135 ATPSPLTQSLSNGEDLMGNINQLIARFSNLLSEENTARISRTLDHLDQATGALSAERENV 194

Query: 329 ISTINTIENITSNLNDSSQKFAELMSKINNISALKENNSLFKDAQRAMHTFRDTSEKINR 388
            + +  +   +   N +  + +ELM   N +   ++   + ++A + M +   TS  +++
Sbjct: 195 SAVMQQLAQASRQANAALAQASELMRSANGLLN-EQGKGMLENANKTMASLERTSATLDQ 253

Query: 389 YIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFERNPQDIVWGREKGSVKIY 448
            I    ++L      GL ++   V +L++T+          E NP + + GREK   K +
Sbjct: 254 LISENRHSLDG-GIQGLAELGPAVSELRDTLAALRGISRRLEENPANYLLGREKT--KEF 310

Query: 449 KP 450
            P
Sbjct: 311 TP 312


>gi|15598409|ref|NP_251903.1| hypothetical protein PA3213 [Pseudomonas aeruginosa PAO1]
 gi|107102743|ref|ZP_01366661.1| hypothetical protein PaerPA_01003810 [Pseudomonas aeruginosa PACS2]
 gi|116051203|ref|YP_789966.1| hypothetical protein PA14_22660 [Pseudomonas aeruginosa UCBPP-PA14]
 gi|218890594|ref|YP_002439458.1| ABC-type transporter, periplasmic component [Pseudomonas aeruginosa
           LESB58]
 gi|254236175|ref|ZP_04929498.1| hypothetical protein PACG_02140 [Pseudomonas aeruginosa C3719]
 gi|254241901|ref|ZP_04935223.1| hypothetical protein PA2G_02622 [Pseudomonas aeruginosa 2192]
 gi|9949333|gb|AAG06601.1|AE004744_16 hypothetical protein PA3213 [Pseudomonas aeruginosa PAO1]
 gi|115586424|gb|ABJ12439.1| ABC-type transporter, periplasmic component [Pseudomonas aeruginosa
           UCBPP-PA14]
 gi|126168106|gb|EAZ53617.1| hypothetical protein PACG_02140 [Pseudomonas aeruginosa C3719]
 gi|126195279|gb|EAZ59342.1| hypothetical protein PA2G_02622 [Pseudomonas aeruginosa 2192]
 gi|218770817|emb|CAW26582.1| ABC-type transporter, periplasmic component [Pseudomonas aeruginosa
           LESB58]
          Length = 312

 Score =  119 bits (297), Expect = 8e-25,   Method: Composition-based stats.
 Identities = 56/295 (18%), Positives = 120/295 (40%), Gaps = 9/295 (3%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++ ++  +GLF V ++  +     WL++S   +G      I    +V GLS  SSV++
Sbjct: 1   METRAHHVLIGLFSVIVIGAALLFGLWLAKSGS-EGKFNYYDIVFNEAVSGLSQGSSVQY 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           +GI VG +  L LD + P    A+  +    P+   TTA +   G+ G + I+LS+    
Sbjct: 60  SGIKVGDVAFLRLDPKDPRKVWARIRVVASAPIKQDTTAKLALTGITGTSIIQLSSGTPA 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
              +     +  +  +I ATPS +   +SN E+    I+        ++         T 
Sbjct: 120 SPMLEG---KDGKIPVIVATPSPLTQLLSNGEDLMGNINQLIARFSNLLSE-----ENTA 171

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
               T+  +     +   +  + + V    + +    N      + L +    +  ++  
Sbjct: 172 RISRTLDHLDQATGALSAERENVSAVMQQLAQASRQANAALAQASELMRSANGLLNEQGK 231

Query: 241 QILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSK 295
            +LEN   +  +  ++S  +   + + R +     +   ++   +S+    + + 
Sbjct: 232 GMLENANKTMASLERTSATLDQLISENRHSLDGGIQGLAELGPAVSELRDTLAAL 286



 Score = 76.1 bits (184), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 32/182 (17%), Positives = 75/182 (41%), Gaps = 4/182 (2%)

Query: 269 ETTQTFQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNMRSSISAIREITDQRQKI 328
            T     ++    + L+ + +  +         EN A  +  +     A   ++ +R+ +
Sbjct: 135 ATPSPLTQLLSNGEDLMGNINQLIARFSNLLSEENTARISRTLDHLDQATGALSAERENV 194

Query: 329 ISTINTIENITSNLNDSSQKFAELMSKINNISALKENNSLFKDAQRAMHTFRDTSEKINR 388
            + +  +   +   N +  + +ELM   N +   ++   + ++A + M +   TS  +++
Sbjct: 195 SAVMQQLAQASRQANAALAQASELMRSANGLLN-EQGKGMLENANKTMASLERTSATLDQ 253

Query: 389 YIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFERNPQDIVWGREKGSVKIY 448
            I    ++L      GL ++   V +L++T+          E NP + + GREK   K +
Sbjct: 254 LISENRHSLDG-GIQGLAELGPAVSELRDTLAALRGISRRLEENPANYLLGREKT--KEF 310

Query: 449 KP 450
            P
Sbjct: 311 TP 312


>gi|300917989|ref|ZP_07134615.1| virulence factor Mce family protein [Escherichia coli MS 115-1]
 gi|300414815|gb|EFJ98125.1| virulence factor Mce family protein [Escherichia coli MS 115-1]
          Length = 312

 Score =  119 bits (297), Expect = 8e-25,   Method: Composition-based stats.
 Identities = 52/293 (17%), Positives = 125/293 (42%), Gaps = 6/293 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++ ++  +GLF + ++  +     WL+ S   D       I     V GLS  S+V++
Sbjct: 1   METRAHHVVIGLFTLIVVSAALLFCLWLTNSGS-DRQFRLYDIVFNEPVSGLSQGSTVQY 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           +GI VG +  L LD++ PN   A+  +   TP+   T A +   G+ G + I+ S+  + 
Sbjct: 60  SGIRVGEVTQLRLDRDNPNKVWARIRVSASTPIREDTQARLTVAGITGTSNIQFSSGSQT 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPL-TTT 179
              +     + ++  +I ATPS ++  ++N EN     ++    + +++    +    TT
Sbjct: 120 SPLLEG---KDDEVPIIIATPSPMSQLLANGENFMTNANEVLVRLNQLLAPDNQQRLVTT 176

Query: 180 IANIETISTVLANNISHIDKMMHTTQV-TPHSSDSKNTFNTITDLITSLDKMIKAIDLQK 238
           + N+  ++  +A+    +  ++      +  ++++    N +      L        +  
Sbjct: 177 LDNLALVTQTVADQRGDLRTLLQQLAQASKQANETLTQTNRLLRNANGLMDGQGKQLVSD 236

Query: 239 VNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSK 291
             + + ++Q +S    K   +   ++++  +          ++   L+   + 
Sbjct: 237 AAKTMASLQNTSTILNKLVSENKTSLNNGMQGMNELGPAVDELRRTLATLRAA 289



 Score = 73.8 bits (178), Expect = 6e-11,   Method: Composition-based stats.
 Identities = 29/182 (15%), Positives = 76/182 (41%), Gaps = 4/182 (2%)

Query: 269 ETTQTFQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNMRSSISAIREITDQRQKI 328
            T     ++    ++ +++ +  +         +N     + + +     + + DQR  +
Sbjct: 135 ATPSPMSQLLANGENFMTNANEVLVRLNQLLAPDNQQRLVTTLDNLALVTQTVADQRGDL 194

Query: 329 ISTINTIENITSNLNDSSQKFAELMSKINNISALKENNSLFKDAQRAMHTFRDTSEKINR 388
            + +  +   +   N++  +   L+   N +    +   L  DA + M + ++TS  +N+
Sbjct: 195 RTLLQQLAQASKQANETLTQTNRLLRNANGLM-DGQGKQLVSDAAKTMASLQNTSTILNK 253

Query: 389 YIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFERNPQDIVWGREKGSVKIY 448
            +     +L N    G+N++   V +L+ T+      ++  E NP  ++ GRE+   + +
Sbjct: 254 LVSENKTSLNN-GMQGMNELGPAVDELRRTLATLRAAVSRLEENPAALLRGRERT--QEF 310

Query: 449 KP 450
            P
Sbjct: 311 TP 312


>gi|254488024|ref|ZP_05101229.1| mce related protein [Roseobacter sp. GAI101]
 gi|214044893|gb|EEB85531.1| mce related protein [Roseobacter sp. GAI101]
          Length = 571

 Score =  119 bits (297), Expect = 8e-25,   Method: Composition-based stats.
 Identities = 73/447 (16%), Positives = 152/447 (34%), Gaps = 34/447 (7%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++  +  +G F +  +  +     WL+   Q D   A   I     V GL     V F
Sbjct: 1   METRANFILIGAFFLLSIIGTLGFFIWLASV-QIDRQYATYGILF-DDVSGLDPSGDVLF 58

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NGI VG+++GL +  + P+  L    I   TP+   T A +++QG+ G+ YI LS     
Sbjct: 59  NGISVGKVIGLEIYPQNPSKVLTTIEIDTATPVTSGTIAQLQSQGVTGVAYISLSGDALG 118

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
              I    T      MI +  S +   + +A +   + ++  +  Q +     +   T I
Sbjct: 119 TAPIEMPDT---GLPMIASKRSTVQALVQDAPDLLAQANELLKQFQSLTSPENQVYVTRI 175

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
                 S+   +        + +T     +  ++ T                      V 
Sbjct: 176 LRNLDTSSARLDQALTDFSSITSTVGEATAQITQFTGRL-------------DSIGASVQ 222

Query: 241 QILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAF 300
             L     + +   ++ D    T+ D     Q+ +    + + +L D   ++ S  ++A 
Sbjct: 223 TTLTKSNTALDAAQRAFDTADKTLIDSGAAIQSVEGTFTQAEQILRDRIPEILSDISAAV 282

Query: 301 LENIADSTSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNIS 360
               A      + S   +    D    + + +  +E   +  N +     +     + + 
Sbjct: 283 ARTDAAIVDLQKRSADTLDGFGDTASLLNARLTELEQTLAEANIAFVAVTDASDSFDALV 342

Query: 361 ALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVN 420
              +   L  DA+  +   +     I   +              + D+  ++  ++  V 
Sbjct: 343 -TGDGTMLVGDARAVLADAKVAIATIQNVV--------------VQDVPVIMADIRAAVA 387

Query: 421 HFDDCLNNFERNPQDIVWGREKGSVKI 447
              D ++   ++    + GR    V  
Sbjct: 388 TASDAVDRVAQDVTG-LTGRFDPLVAE 413



 Score = 55.3 bits (130), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 26/218 (11%), Positives = 68/218 (31%), Gaps = 12/218 (5%)

Query: 232 KAIDLQKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSK 291
             I    V  +   +         +SD V     DV   T  F  +  + +  L+  ++ 
Sbjct: 365 ATIQNVVVQDVPVIMADIRAAVATASDAVDRVAQDVTGLTGRFDPLVAEAEQALASANAL 424

Query: 292 MKSKETSAFLENIADSTSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAE 351
               + S    + A  ++    + +                  + ++ +  +  S    +
Sbjct: 425 FVRAQGSLGTLDTALDSAQGALASAEAAFDGATDVLRTDVGPMLSDLRTASDRISVAVED 484

Query: 352 LMSKINNISALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNL 411
           +   I          ++  D +  +        ++   + +    +  F+++GL ++  L
Sbjct: 485 VTRDI---------PAIATDLRALIGRADAVVAQVQGAVSASAPGIGAFAKTGLPELTRL 535

Query: 412 VRKLQETVNHFDDCLNNFERNPQDIVWGREKGSVKIYK 449
             + +  V+  +      ERNP   +       V  Y+
Sbjct: 536 SAEARSLVSTLNSLARRIERNPAGFIL---DNRVPEYR 570


>gi|296388300|ref|ZP_06877775.1| ABC-type transporter, periplasmic component [Pseudomonas aeruginosa
           PAb1]
          Length = 312

 Score =  119 bits (297), Expect = 9e-25,   Method: Composition-based stats.
 Identities = 58/293 (19%), Positives = 120/293 (40%), Gaps = 7/293 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++ ++  +GLF V ++  +     WL++S   +G      I    +V GLS  SSV++
Sbjct: 1   METRAHHVLIGLFSVIVIGAALLFGLWLAKSGS-EGKFNYYDIVFNEAVSGLSQGSSVQY 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           +GI VG +  L LD + P    A+  +    P+   TTA +   G+ G + I+LS+    
Sbjct: 60  SGIKVGDVAFLRLDPQDPRKVWARIRVVASAPIKQDTTAKLALTGITGTSIIQLSSGTPA 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISD-SSRHIQKIIENIEKPLTTT 179
              +     +  +  +I ATPS +   +SN E+    I+   +R    + E     ++ T
Sbjct: 120 SPMLEG---KDGKIPVIVATPSPLTQLLSNGEDLMGNINQLIARFSNLLSEENTARISRT 176

Query: 180 IANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKV 239
           + +++  +  L+    ++  +M        S  +       ++L+ S + ++       +
Sbjct: 177 LDHLDQATGALSAERENVSAVMQQLA--QASRQANAALAQASELMRSANGLLNEQGKGMM 234

Query: 240 NQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKM 292
               + +             +    H +    Q   E+G  +  L    ++  
Sbjct: 235 ENANKTMASLERTSATLDQLISENRHSLDGGIQGLAELGPAVSELRDTLAALR 287



 Score = 75.7 bits (183), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 32/182 (17%), Positives = 75/182 (41%), Gaps = 4/182 (2%)

Query: 269 ETTQTFQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNMRSSISAIREITDQRQKI 328
            T     ++    + L+ + +  +         EN A  +  +     A   ++ +R+ +
Sbjct: 135 ATPSPLTQLLSNGEDLMGNINQLIARFSNLLSEENTARISRTLDHLDQATGALSAERENV 194

Query: 329 ISTINTIENITSNLNDSSQKFAELMSKINNISALKENNSLFKDAQRAMHTFRDTSEKINR 388
            + +  +   +   N +  + +ELM   N +   ++   + ++A + M +   TS  +++
Sbjct: 195 SAVMQQLAQASRQANAALAQASELMRSANGLLN-EQGKGMMENANKTMASLERTSATLDQ 253

Query: 389 YIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFERNPQDIVWGREKGSVKIY 448
            I    ++L      GL ++   V +L++T+          E NP + + GREK   K +
Sbjct: 254 LISENRHSLDG-GIQGLAELGPAVSELRDTLAALRGISRRLEENPANYLLGREKT--KEF 310

Query: 449 KP 450
            P
Sbjct: 311 TP 312


>gi|313108530|ref|ZP_07794531.1| ABC-type transporter, periplasmic component [Pseudomonas aeruginosa
           39016]
 gi|310881033|gb|EFQ39627.1| ABC-type transporter, periplasmic component [Pseudomonas aeruginosa
           39016]
          Length = 312

 Score =  119 bits (297), Expect = 9e-25,   Method: Composition-based stats.
 Identities = 56/295 (18%), Positives = 120/295 (40%), Gaps = 9/295 (3%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++ ++  +GLF V ++  +     WL++S   +G      I    +V GLS  SSV++
Sbjct: 1   METRAHHVLIGLFSVIVIGAALLFGLWLAKSGS-EGKFNYYDIVFNEAVSGLSQGSSVQY 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           +GI VG +  L LD + P    A+  +    P+   TTA +   G+ G + I+LS+    
Sbjct: 60  SGIKVGDVAFLRLDPQDPRKVWARIRVVASAPIKQDTTAKLALTGITGTSIIQLSSGTPA 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
              +     +  +  +I ATPS +   +SN E+    I+        ++         T 
Sbjct: 120 SPMLEG---KDGKIPVIVATPSPLTQLLSNGEDLMGNINQLIARFSNLLSE-----ENTA 171

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
               T+  +     +   +  + + V    + +    N      + L +    +  ++  
Sbjct: 172 RISRTLDHLDQATGALSAERENVSAVMQQLAQASRQANAALAQASELMRSANGLLNEQGK 231

Query: 241 QILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSK 295
            +LEN   +  +  ++S  +   + + R +     +   ++   +S+    + + 
Sbjct: 232 GMLENANKTMASLERTSATLDQLISENRHSLDGGIQGLAELGPAVSELRDTLAAL 286



 Score = 76.1 bits (184), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 32/182 (17%), Positives = 75/182 (41%), Gaps = 4/182 (2%)

Query: 269 ETTQTFQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNMRSSISAIREITDQRQKI 328
            T     ++    + L+ + +  +         EN A  +  +     A   ++ +R+ +
Sbjct: 135 ATPSPLTQLLSNGEDLMGNINQLIARFSNLLSEENTARISRTLDHLDQATGALSAERENV 194

Query: 329 ISTINTIENITSNLNDSSQKFAELMSKINNISALKENNSLFKDAQRAMHTFRDTSEKINR 388
            + +  +   +   N +  + +ELM   N +   ++   + ++A + M +   TS  +++
Sbjct: 195 SAVMQQLAQASRQANAALAQASELMRSANGLLN-EQGKGMLENANKTMASLERTSATLDQ 253

Query: 389 YIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFERNPQDIVWGREKGSVKIY 448
            I    ++L      GL ++   V +L++T+          E NP + + GREK   K +
Sbjct: 254 LISENRHSLDG-GIQGLAELGPAVSELRDTLAALRGISRRLEENPANYLLGREKT--KEF 310

Query: 449 KP 450
            P
Sbjct: 311 TP 312


>gi|238791988|ref|ZP_04635624.1| hypothetical protein yinte0001_8880 [Yersinia intermedia ATCC
           29909]
 gi|238728619|gb|EEQ20137.1| hypothetical protein yinte0001_8880 [Yersinia intermedia ATCC
           29909]
          Length = 312

 Score =  119 bits (296), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 51/293 (17%), Positives = 124/293 (42%), Gaps = 6/293 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++ ++  +GLF + ++  +     WL+ S   D       I     V GLS  S+V++
Sbjct: 1   METRAHHVVIGLFTLIVVSAALLFCLWLTNSGS-DRQFRLYDIVFNEPVSGLSQGSTVQY 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           +GI VG +  L LD++ P+   A+  +   TP+   T A +   G+ G + I+ S+  + 
Sbjct: 60  SGIRVGEVTQLRLDRDNPSKVWARIRVSASTPIREDTQARLTVAGITGTSNIQFSSGSQT 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPL-TTT 179
              +     + ++  +I ATPS ++  ++N EN     ++    + +++    +    TT
Sbjct: 120 SPLLEG---KDDEVPIIIATPSPMSQLLANGENFMTNANEVLVRLNQLLAPDNQQRLVTT 176

Query: 180 IANIETISTVLANNISHIDKMMHTTQV-TPHSSDSKNTFNTITDLITSLDKMIKAIDLQK 238
           + N+  ++  +A+    +  ++      +  ++++    N +      L        +  
Sbjct: 177 LDNLALVTQTVADQRGDLRTLLQQLAQASKQANETLTQTNRLLRNANGLMDGQGKQLVSD 236

Query: 239 VNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSK 291
             + + ++Q +S    K   +   ++++             ++   L+   + 
Sbjct: 237 AAKTMASLQNTSAILDKLVSENKTSLNNGMRGMNELGPAVDELRRTLATLRAA 289



 Score = 73.4 bits (177), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 28/182 (15%), Positives = 76/182 (41%), Gaps = 4/182 (2%)

Query: 269 ETTQTFQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNMRSSISAIREITDQRQKI 328
            T     ++    ++ +++ +  +         +N     + + +     + + DQR  +
Sbjct: 135 ATPSPMSQLLANGENFMTNANEVLVRLNQLLAPDNQQRLVTTLDNLALVTQTVADQRGDL 194

Query: 329 ISTINTIENITSNLNDSSQKFAELMSKINNISALKENNSLFKDAQRAMHTFRDTSEKINR 388
            + +  +   +   N++  +   L+   N +    +   L  DA + M + ++TS  +++
Sbjct: 195 RTLLQQLAQASKQANETLTQTNRLLRNANGLM-DGQGKQLVSDAAKTMASLQNTSAILDK 253

Query: 389 YIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFERNPQDIVWGREKGSVKIY 448
            +     +L N    G+N++   V +L+ T+      ++  E NP  ++ GRE+   + +
Sbjct: 254 LVSENKTSLNN-GMRGMNELGPAVDELRRTLATLRAAVSRLEENPAALLRGRERT--QEF 310

Query: 449 KP 450
            P
Sbjct: 311 TP 312


>gi|330501344|ref|YP_004378213.1| hypothetical protein MDS_0430 [Pseudomonas mendocina NK-01]
 gi|328915630|gb|AEB56461.1| hypothetical protein MDS_0430 [Pseudomonas mendocina NK-01]
          Length = 305

 Score =  119 bits (296), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 54/290 (18%), Positives = 111/290 (38%), Gaps = 4/290 (1%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME K ++  +GLF V  +  +     WL+++   D    +  +    +V GLS  S+V++
Sbjct: 1   MEPKAHHVLIGLFTVLTVGAALLFGLWLNKAGA-DRAFTDYEVIFNEAVTGLSQGSAVQY 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           +GI VG +V L LD + P    A+  I  +TP+   T A +   G+ G+  I+L     E
Sbjct: 60  SGIKVGDVVSLGLDPDDPRTVRARIRIVGNTPIKQDTRARLAITGITGLAVIQLHGGSPE 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
              +     +        +  S      +  +  S      +R  + +     + ++ T+
Sbjct: 120 SPPLEGKDGQPGIIIADRSPLS--RLMANGEDLVSNITRLLNRANRMLSRENAERVSRTL 177

Query: 181 ANIETISTVLANNISHIDKMMHTTQ-VTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKV 239
            N+E  +  +A+    + + +  T   T  ++      N + D   S         +  +
Sbjct: 178 ENLEQATAGIADQREELGEALRQTSAATREAAALMKNANQLLDSQGSQVLESAERLMASL 237

Query: 240 NQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFS 289
            +  + I+    N   + D  +  + D+  T    +E    +        
Sbjct: 238 ERSSQTIEQLLQNNRGALDSGMQGLSDLGPTISELRETLGALRGFSRRLE 287



 Score = 64.6 bits (154), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 26/170 (15%), Positives = 66/170 (38%), Gaps = 4/170 (2%)

Query: 281 IDHLLSDFSSKMKSKETSAFLENIADSTSNMRSSISAIREITDQRQKIISTINTIENITS 340
           +  L+++    + +        N   S  N       +  +      I      +     
Sbjct: 140 LSRLMANGEDLVSNITRLLNRANRMLSRENAERVSRTLENLEQATAGIADQREELGEALR 199

Query: 341 NLNDSSQKFAELMSKINNISALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNF 400
             + ++++ A LM   N +    + + + + A+R M +   +S+ I + + +    L + 
Sbjct: 200 QTSAATREAAALMKNANQLL-DSQGSQVLESAERLMASLERSSQTIEQLLQNNRGALDS- 257

Query: 401 SQSGLNDIQNLVRKLQETVNHFDDCLNNFERNPQDIVWGREKGSVKIYKP 450
              GL+D+   + +L+ET+          E++P   +   +  S+K ++P
Sbjct: 258 GMQGLSDLGPTISELRETLGALRGFSRRLEQDPSGYLLRSD--SIKEFQP 305


>gi|238754552|ref|ZP_04615906.1| hypothetical protein yruck0001_4200 [Yersinia ruckeri ATCC 29473]
 gi|238707183|gb|EEP99546.1| hypothetical protein yruck0001_4200 [Yersinia ruckeri ATCC 29473]
          Length = 312

 Score =  119 bits (296), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 54/293 (18%), Positives = 127/293 (43%), Gaps = 6/293 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++ ++  +GLF + ++  +     WL+ +   +       I     V GLS  S+V++
Sbjct: 1   METRAHHVIIGLFTLIVVSAALLFCLWLTNAGS-NSQFRLYDIVFNEPVSGLSQGSTVQY 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           +GI VG +  L LD++ PN   A+  +   TP+   T A +   G+ G + I+ S+  + 
Sbjct: 60  SGIRVGEVTQLRLDKDNPNKVWARIRVSASTPVRQDTQARLTVAGITGTSNIQFSSGSQG 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPL-TTT 179
              +     E  +  +I ATPS ++  ++N EN    +++    + +++    +     T
Sbjct: 120 SPRLEG---EDGEIPVIVATPSPMSQLLANGENFMSNVNEVLVRLNQLLAPDNQQRLVKT 176

Query: 180 IANIETISTVLANNISHIDKMMHTTQV-TPHSSDSKNTFNTITDLITSLDKMIKAIDLQK 238
           + N+E ++  +A+    +  M+      +  ++D+    N +      L +      L  
Sbjct: 177 LENLELVTQTVADQREDLRTMLQQLAQASKQANDTLAQTNRLLRNTNGLVEGQGKQLLSD 236

Query: 239 VNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSK 291
             + + ++Q +S    K  ++   ++++  +          ++   L+   + 
Sbjct: 237 AAKTMASLQNTSVILNKLVNENKTSLNNGMQGMNELGPAVDELRRTLATLRAA 289



 Score = 75.0 bits (181), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 31/182 (17%), Positives = 76/182 (41%), Gaps = 4/182 (2%)

Query: 269 ETTQTFQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNMRSSISAIREITDQRQKI 328
            T     ++    ++ +S+ +  +         +N       + +     + + DQR+ +
Sbjct: 135 ATPSPMSQLLANGENFMSNVNEVLVRLNQLLAPDNQQRLVKTLENLELVTQTVADQREDL 194

Query: 329 ISTINTIENITSNLNDSSQKFAELMSKINNISALKENNSLFKDAQRAMHTFRDTSEKINR 388
            + +  +   +   ND+  +   L+   N +    +   L  DA + M + ++TS  +N+
Sbjct: 195 RTMLQQLAQASKQANDTLAQTNRLLRNTNGLV-EGQGKQLLSDAAKTMASLQNTSVILNK 253

Query: 389 YIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFERNPQDIVWGREKGSVKIY 448
            +     +L N    G+N++   V +L+ T+      ++  E NP  ++ GRE+   + +
Sbjct: 254 LVNENKTSLNN-GMQGMNELGPAVDELRRTLATLRAAVSRLEENPAALLRGRERT--QEF 310

Query: 449 KP 450
            P
Sbjct: 311 TP 312


>gi|238789961|ref|ZP_04633740.1| hypothetical protein yfred0001_37280 [Yersinia frederiksenii ATCC
           33641]
 gi|238721909|gb|EEQ13570.1| hypothetical protein yfred0001_37280 [Yersinia frederiksenii ATCC
           33641]
          Length = 313

 Score =  119 bits (296), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 53/293 (18%), Positives = 122/293 (41%), Gaps = 6/293 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++ ++  +GLF + ++  +     WL+ +   D       I     V GLS  S+V++
Sbjct: 1   METRAHHVVIGLFTLIVVSAALLFCLWLTGAGS-DRQFRFYDIVFNEPVSGLSQGSTVQY 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           +GI VG +  L LD++ PN   A+  +   TP+   T A +   G+ G + I+ S+  + 
Sbjct: 60  SGIRVGEVTQLRLDRDNPNKVWARIRVSASTPIREDTQARLTVAGITGTSNIQFSSSSQS 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPL-TTT 179
              +        +  +I ATPS ++  ++N EN     ++    + +++    +    TT
Sbjct: 120 SPLLESH---DGEVPVIVATPSPMSQLLANGENFMSNANEVLVRLNQLLAPDNQQRLITT 176

Query: 180 IANIETISTVLANNISHIDKMMHTTQV-TPHSSDSKNTFNTITDLITSLDKMIKAIDLQK 238
           + N+  ++  +A+    I  M+      +  ++++    N +      L        +  
Sbjct: 177 LDNLALVTQTVADQRQDIRTMLQQLAQASKQANETLTQTNRLLRNANGLMDGQGKQLMND 236

Query: 239 VNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSK 291
             + + ++Q +S    K   +   ++++  +          ++   L    + 
Sbjct: 237 AAKTMASLQNTSTILSKLVSENKTSLNNGMQGMNELGPAVDELRRTLMTLRAA 289



 Score = 73.0 bits (176), Expect = 9e-11,   Method: Composition-based stats.
 Identities = 31/183 (16%), Positives = 78/183 (42%), Gaps = 4/183 (2%)

Query: 269 ETTQTFQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNMRSSISAIREITDQRQKI 328
            T     ++    ++ +S+ +  +         +N     + + +     + + DQRQ I
Sbjct: 135 ATPSPMSQLLANGENFMSNANEVLVRLNQLLAPDNQQRLITTLDNLALVTQTVADQRQDI 194

Query: 329 ISTINTIENITSNLNDSSQKFAELMSKINNISALKENNSLFKDAQRAMHTFRDTSEKINR 388
            + +  +   +   N++  +   L+   N +    +   L  DA + M + ++TS  +++
Sbjct: 195 RTMLQQLAQASKQANETLTQTNRLLRNANGLM-DGQGKQLMNDAAKTMASLQNTSTILSK 253

Query: 389 YIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFERNPQDIVWGREKGSVKIY 448
            +     +L N    G+N++   V +L+ T+      ++  E NP  ++ GRE+   + +
Sbjct: 254 LVSENKTSLNN-GMQGMNELGPAVDELRRTLMTLRAAVSRLEENPAALLRGRERT--QEF 310

Query: 449 KPK 451
            P+
Sbjct: 311 TPR 313


>gi|154252956|ref|YP_001413780.1| hypothetical protein Plav_2514 [Parvibaculum lavamentivorans DS-1]
 gi|154156906|gb|ABS64123.1| Mammalian cell entry related domain protein [Parvibaculum
           lavamentivorans DS-1]
          Length = 302

 Score =  118 bits (295), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 58/307 (18%), Positives = 120/307 (39%), Gaps = 5/307 (1%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME K+    +G+F +  +   F  + W+S   Q++   A   I   GSV GLS    V++
Sbjct: 1   MEIKSNNVLIGVFTLVTVVGMFLFLLWISGV-QFNRQFAYYKIIFDGSVSGLSQSGPVQY 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NG+PVG++  L+L    PN  +A   +   TP+   + A +   GL G+ +I+L+    E
Sbjct: 60  NGLPVGKVTDLYLMARNPNKVVAIIQVDARTPVKEDSVAQLELSGLTGVAFIQLTGGSPE 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
              +   A       +I A PS +   + +   T +  ++  + + K++ + ++ ++  +
Sbjct: 120 SAELQ--ARPGQDYPVIKAAPSSLQDLLKSGPETLQNANELIKELNKVVADNQRSISEAL 177

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
           AN+ TIS  LA++   +   +        S    +   +   L+    K   A   +   
Sbjct: 178 ANLNTISKALADSSGDVTTALDQIA--QASRHLNSISRSADGLMKEDVKAFIADAREAAR 235

Query: 241 QILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAF 300
              E          +    + + +  + +     + +   +D   S              
Sbjct: 236 SYREVANELDAILKQGGPGIASGLSQLPQLVAETRALVSSLDRFASRAQDDPARYFIGRD 295

Query: 301 LENIADS 307
           +  +   
Sbjct: 296 VPEVEAE 302



 Score = 62.6 bits (149), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 21/142 (14%), Positives = 56/142 (39%), Gaps = 5/142 (3%)

Query: 305 ADSTSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNISALKE 364
                N RS   A+  +    + +  +   +      +  +S+    +    + +   ++
Sbjct: 164 KVVADNQRSISEALANLNTISKALADSSGDVTTALDQIAQASRHLNSISRSADGLMK-ED 222

Query: 365 NNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDD 424
             +   DA+ A  ++R+ + +++  +   G  +     SGL+ +  LV + +  V+  D 
Sbjct: 223 VKAFIADAREAARSYREVANELDAILKQGGPGIA----SGLSQLPQLVAETRALVSSLDR 278

Query: 425 CLNNFERNPQDIVWGREKGSVK 446
             +  + +P     GR+   V+
Sbjct: 279 FASRAQDDPARYFIGRDVPEVE 300


>gi|146305411|ref|YP_001185876.1| hypothetical protein Pmen_0371 [Pseudomonas mendocina ymp]
 gi|145573612|gb|ABP83144.1| Mammalian cell entry related domain protein [Pseudomonas mendocina
           ymp]
          Length = 305

 Score =  118 bits (295), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 52/314 (16%), Positives = 116/314 (36%), Gaps = 16/314 (5%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME + ++  +GLF V  +  +     WL+++   D    +  +    +V GLS  S+V++
Sbjct: 1   MEPRAHHVLIGLFTVLTVGAALLFALWLNKAGA-DRAFTDYEVIFNEAVSGLSQGSAVQY 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           +GI VG ++ L LD E P    A+  I   TP+   T A +   G+ G+  I+L +   E
Sbjct: 60  SGIKVGDVISLGLDPEDPRTVRARIRIAGHTPIKQDTRARLSITGITGLAVIQLYSGSPE 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
              +     +        +  S      +  +  S      +R  + +     + ++ T+
Sbjct: 120 SPPLEGKDGQPGIIIADRSPLS--RLMANGEDLVSNITRLLNRANRMLSRENAERVSRTL 177

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
            N+E  +  +A+    +   +                   T     L +    +   + +
Sbjct: 178 ENLEQATAGIASQRDELSAAL-------------QQAGAATREAAELMRTANRLLDGQGS 224

Query: 241 QILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAF 300
           Q L+N +    +  +SS  +   +   R    +  +   ++   + +    + +    + 
Sbjct: 225 QALDNAERLMASLERSSRSIEQLLESNRSALDSGMQGLGELGPAIGELRDTLSALRGFSR 284

Query: 301 LENIADSTSNMRSS 314
                 +   +RS 
Sbjct: 285 RLEQDPTGYLLRSD 298



 Score = 63.4 bits (151), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 27/170 (15%), Positives = 67/170 (39%), Gaps = 4/170 (2%)

Query: 281 IDHLLSDFSSKMKSKETSAFLENIADSTSNMRSSISAIREITDQRQKIISTINTIENITS 340
           +  L+++    + +        N   S  N       +  +      I S  + +     
Sbjct: 140 LSRLMANGEDLVSNITRLLNRANRMLSRENAERVSRTLENLEQATAGIASQRDELSAALQ 199

Query: 341 NLNDSSQKFAELMSKINNISALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNF 400
               ++++ AELM   N +    + +    +A+R M +   +S  I + + S  + L + 
Sbjct: 200 QAGAATREAAELMRTANRLL-DGQGSQALDNAERLMASLERSSRSIEQLLESNRSALDS- 257

Query: 401 SQSGLNDIQNLVRKLQETVNHFDDCLNNFERNPQDIVWGREKGSVKIYKP 450
              GL ++   + +L++T++         E++P   +   +  S+K ++P
Sbjct: 258 GMQGLGELGPAIGELRDTLSALRGFSRRLEQDPTGYLLRSD--SIKEFQP 305


>gi|311694461|gb|ADP97334.1| mammalian cell entry related domain protein [marine bacterium HP15]
          Length = 312

 Score =  118 bits (295), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 48/291 (16%), Positives = 103/291 (35%), Gaps = 6/291 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME + ++  +GLF +     +     WL++S+  D       I    +V GLS  + V +
Sbjct: 1   MEPRAHHLIIGLFTILAFAAALIFSLWLAKSSA-DREWGYYEIVFDHAVGGLSEGNPVLY 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           +G+ +G +V + LD + P H      +    P+  +T A +    + G   ++ S    +
Sbjct: 60  SGVQIGDVVEMKLDPDNPGHVRVLVRVDQSVPIRENTKAGLVLANITGSMSVQFSGGSPD 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKI--IENIEKPLTT 178
           K  +     + +   +I A PS     +SN E    K          +   +NI+     
Sbjct: 120 KPALQG---DEDNPPVIIAEPSAFTSLLSNGEQLLAKADQLLTSATALLSADNIDNASAI 176

Query: 179 TIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQK 238
                E    +L      I  +         + ++    + ++D    L +      LQ 
Sbjct: 177 LENTREATDALLDRRDQLIALLEQFDAAAIRAEEAAIKVSNVSDNANELLQNDGQRVLQS 236

Query: 239 VNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFS 289
           ++Q L  +  +     + +      +    +         +++   L   +
Sbjct: 237 MDQALAVMTTTMERIDELTRNNQGAMDAGLQGMGELAPALRELRATLRSLN 287



 Score = 60.3 bits (143), Expect = 7e-07,   Method: Composition-based stats.
 Identities = 24/168 (14%), Positives = 72/168 (42%), Gaps = 2/168 (1%)

Query: 274 FQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNMRSSISAIREITDQRQKIISTIN 333
           F  +    + LL+     + S       +NI ++++ + ++  A   + D+R ++I+ + 
Sbjct: 140 FTSLLSNGEQLLAKADQLLTSATALLSADNIDNASAILENTREATDALLDRRDQLIALLE 199

Query: 334 TIENITSNLNDSSQKFAELMSKINNISALKENNSLFKDAQRAMHTFRDTSEKINRYIPSI 393
             +       +++ K + +    N +    +   + +   +A+     T E+I+    + 
Sbjct: 200 QFDAAAIRAEEAAIKVSNVSDNANELL-QNDGQRVLQSMDQALAVMTTTMERIDELTRNN 258

Query: 394 GNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFERNPQDIVWGRE 441
              + +    G+ ++   +R+L+ T+   +   +  E++P   ++G E
Sbjct: 259 QGAM-DAGLQGMGELAPALRELRATLRSLNQFTHRLEQDPTGTLFGNE 305


>gi|26986885|ref|NP_742310.1| hypothetical protein PP_0140 [Pseudomonas putida KT2440]
 gi|24981488|gb|AAN65774.1|AE016203_7 conserved hypothetical protein [Pseudomonas putida KT2440]
 gi|313496511|gb|ADR57877.1| Hypothetical protein, conserved [Pseudomonas putida BIRD-1]
          Length = 312

 Score =  118 bits (295), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 53/302 (17%), Positives = 113/302 (37%), Gaps = 2/302 (0%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++ ++  +GL  V ++  +     WL++S+  D    +  +    +V GLS  S+V++
Sbjct: 1   METRAHHVLIGLVTVLVVTGAMLFGLWLAKSS-VDDAFKDYEVVFNEAVSGLSPGSTVQY 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NGI VG +  L LD + P   LA+  +  DTP+   T A +   G+ G ++I+LS    +
Sbjct: 60  NGIKVGDVSTLRLDPKDPRRVLARVRLSADTPVKEDTQAKLTLAGVTGNSFIQLSGGTPQ 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
              +     +     + + +P       S+   T+  +   + +     +NI     T  
Sbjct: 120 SPELKGKDGKL-PVIIASPSPISRLLNDSSDLVTNINMLLHNANQMFSEDNIGHLSNTLA 178

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
              +T       + S  + +    QV   +S +      +      L        +    
Sbjct: 179 NLDKTTGAFAGQHGSIAEAIAQLVQVGKQASATLAETQALMRNANGLLDSEGKQAIGSAE 238

Query: 241 QILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAF 300
           Q ++++  S+             + D  ++        +++   L+      +  E    
Sbjct: 239 QAMQSLAQSTATINNLLQNNSEAIGDGAQSLNQLAPAIRELRETLNALKGISRQLEADPS 298

Query: 301 LE 302
             
Sbjct: 299 GY 300



 Score = 76.9 bits (186), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 28/178 (15%), Positives = 65/178 (36%), Gaps = 4/178 (2%)

Query: 273 TFQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNMRSSISAIREITDQRQKIISTI 332
               +      L+++ +  + +       +NI   ++ + +          Q   I   I
Sbjct: 139 PISRLLNDSSDLVTNINMLLHNANQMFSEDNIGHLSNTLANLDKTTGAFAGQHGSIAEAI 198

Query: 333 NTIENITSNLNDSSQKFAELMSKINNISALKENNSLFKDAQRAMHTFRDTSEKINRYIPS 392
             +  +    + +  +   LM   N +    E       A++AM +   ++  IN  + +
Sbjct: 199 AQLVQVGKQASATLAETQALMRNANGLL-DSEGKQAIGSAEQAMQSLAQSTATINNLLQN 257

Query: 393 IGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFERNPQDIVWGREKGSVKIYKP 450
               + +     LN +   +R+L+ET+N         E +P   + GR+    K ++P
Sbjct: 258 NSEAIGD-GAQSLNQLAPAIRELRETLNALKGISRQLEADPSGYLLGRDNN--KEFQP 312


>gi|46579024|ref|YP_009832.1| hypothetical protein DVU0610 [Desulfovibrio vulgaris str.
           Hildenborough]
 gi|120603387|ref|YP_967787.1| hypothetical protein Dvul_2344 [Desulfovibrio vulgaris DP4]
 gi|46448437|gb|AAS95091.1| conserved hypothetical protein [Desulfovibrio vulgaris str.
           Hildenborough]
 gi|120563616|gb|ABM29360.1| Mammalian cell entry related domain protein [Desulfovibrio vulgaris
           DP4]
 gi|311232874|gb|ADP85728.1| Mammalian cell entry related domain protein [Desulfovibrio vulgaris
           RCH1]
          Length = 306

 Score =  118 bits (295), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 43/306 (14%), Positives = 100/306 (32%), Gaps = 1/306 (0%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++  Y  VG+F +  +  +   + W +   +    MA   +   G+V GLS  S V F
Sbjct: 1   METRASYILVGVFTLLAVTGALAFVLWTAGRGE-GKAMAAYDVHFSGNVMGLSVASDVFF 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NG+ VG +  + L+ + P     +  I   TP+   + A++  +GL G++ ++++     
Sbjct: 60  NGVKVGAVKQITLNPDDPAKVKVRIEIDATTPVREDSVASLEGRGLTGVSVVQITGGSPH 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
              +   A E    A   +    +   +     +  ++ +    +           T   
Sbjct: 120 APLLVGTAGEVPVIASRASRLEELFAGMPQLVGSGNELVNRLADVLNAENRAALASTFHA 179

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
            +  T       +          T     ++ S        D+       ++   +   N
Sbjct: 180 LDTVTARMAARADSLDRIITNMDTTTRRLANASAGLETLAGDMRDLTRGDMRDSIVAVGN 239

Query: 241 QILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAF 300
                  + +      +      + D+R      + +   ++ +     S  +       
Sbjct: 240 TARRLDALLAAAEPGVTGFSTEGLEDMRRLLIESRHLVTTLNRMAQRMESDPRRFMFGNQ 299

Query: 301 LENIAD 306
           L    +
Sbjct: 300 LPEYEE 305


>gi|148545415|ref|YP_001265517.1| hypothetical protein Pput_0158 [Pseudomonas putida F1]
 gi|148509473|gb|ABQ76333.1| Mammalian cell entry related domain protein [Pseudomonas putida F1]
          Length = 312

 Score =  118 bits (295), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 52/302 (17%), Positives = 113/302 (37%), Gaps = 2/302 (0%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++ ++  +GL  V ++  +     WL++S+  D    +  +    +V GLS  S+V++
Sbjct: 1   METRAHHVLIGLVTVLVVAGAMLFGLWLAKSS-VDDAFKDYEVVFNEAVSGLSRGSTVQY 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NGI VG +  L LD + P   LA+  +  DTP+   T A +   G+ G ++I+LS    +
Sbjct: 60  NGIKVGDVSTLRLDPKDPRRVLARVRLSADTPVKEDTQAKLTLAGVTGNSFIQLSGGTPQ 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
              +     +     + + +P       S+   T+  +   + +     +NI     T  
Sbjct: 120 SPELKGKDGKL-PVIIASPSPISRLLNDSSDLVTNINMLLHNANQMFSEDNIGHLSNTLA 178

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
              +T       + S  + +    +V   +S +      +      L        +    
Sbjct: 179 NLDKTTGAFAGQHGSIAEAIEQLVKVGNQASATLAETQALMRNANGLLGSEGKQAIGSAE 238

Query: 241 QILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAF 300
           Q ++++  S+             + D  ++        +++   L+      +  E    
Sbjct: 239 QAMQSLAQSTATINNLLQNNSEAIGDGAQSLNQLAPAIRELRETLNALKGISRQLEADPS 298

Query: 301 LE 302
             
Sbjct: 299 GY 300



 Score = 77.7 bits (188), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 28/178 (15%), Positives = 66/178 (37%), Gaps = 4/178 (2%)

Query: 273 TFQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNMRSSISAIREITDQRQKIISTI 332
               +      L+++ +  + +       +NI   ++ + +          Q   I   I
Sbjct: 139 PISRLLNDSSDLVTNINMLLHNANQMFSEDNIGHLSNTLANLDKTTGAFAGQHGSIAEAI 198

Query: 333 NTIENITSNLNDSSQKFAELMSKINNISALKENNSLFKDAQRAMHTFRDTSEKINRYIPS 392
             +  + +  + +  +   LM   N +    E       A++AM +   ++  IN  + +
Sbjct: 199 EQLVKVGNQASATLAETQALMRNANGLLGS-EGKQAIGSAEQAMQSLAQSTATINNLLQN 257

Query: 393 IGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFERNPQDIVWGREKGSVKIYKP 450
               + +     LN +   +R+L+ET+N         E +P   + GR+    K ++P
Sbjct: 258 NSEAIGD-GAQSLNQLAPAIRELRETLNALKGISRQLEADPSGYLLGRDNN--KEFQP 312


>gi|307720550|ref|YP_003891690.1| Mammalian cell entry related domain-containing protein
           [Sulfurimonas autotrophica DSM 16294]
 gi|306978643|gb|ADN08678.1| Mammalian cell entry related domain protein [Sulfurimonas
           autotrophica DSM 16294]
          Length = 320

 Score =  118 bits (295), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 51/300 (17%), Positives = 106/300 (35%), Gaps = 10/300 (3%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M +K  YT +GL V+  +       YW+ +  +      + II    SV GL+ ++ V++
Sbjct: 1   MNNKVNYTFIGLIVLLGIVSMLGFTYWMLKPAK-AEETQKYIIYFNESVLGLNLNAPVKY 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            GI VG++  L ++            I   TP+   T A +  QG+ G++YI L+     
Sbjct: 60  RGIKVGKVTRLRINPNNSEQVEVTVQILKTTPIKEDTVAKLTAQGITGLSYINLTEGSNH 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPL---- 176
              +     E     +I + PS       + ++ S+ +  +     +++ +  +      
Sbjct: 120 APPLKIK--EGQSCPVIKSAPSFFANVEQSLDSVSELLLLTLGRTNQLLNDGNQKQFSKL 177

Query: 177 --TTTIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAI 234
              + +   +  S +    ++HI K            D            +   +     
Sbjct: 178 LAKSALVMAKVDSILDEKTMAHIQKSAENLDRLTLKIDESVPNINKFVNKSIEWENKINK 237

Query: 235 DLQKVNQILENIQVSSNNFVKSSDQVINTVHDVR-ETTQTFQEVGQKIDHLLSDFSSKMK 293
               + +   ++ +  NN  KS   V   V D   +T         ++   L +    + 
Sbjct: 238 SFTSIKETYLHMGIIMNNMAKSFLHVEENVEDATVQTLPLMNSTMLEMQQTLINLDELIN 297



 Score = 43.8 bits (100), Expect = 0.056,   Method: Composition-based stats.
 Identities = 26/151 (17%), Positives = 62/151 (41%), Gaps = 5/151 (3%)

Query: 297 TSAFLENIADSTSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKI 356
           T+  L +      +   + SA+            T+  I+    NL+  + K  E +  I
Sbjct: 162 TNQLLNDGNQKQFSKLLAKSALVMAKVDSILDEKTMAHIQKSAENLDRLTLKIDESVPNI 221

Query: 357 NNISALK-----ENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNL 411
           N           + N  F   +            + +    +  N+++ +   L  + + 
Sbjct: 222 NKFVNKSIEWENKINKSFTSIKETYLHMGIIMNNMAKSFLHVEENVEDATVQTLPLMNST 281

Query: 412 VRKLQETVNHFDDCLNNFERNPQDIVWGREK 442
           + ++Q+T+ + D+ +N++ER+P DI++ +E+
Sbjct: 282 MLEMQQTLINLDELINHYERSPSDILFKKEQ 312


>gi|56551912|ref|YP_162751.1| mammalian cell entry related domain-containing protein [Zymomonas
           mobilis subsp. mobilis ZM4]
 gi|56543486|gb|AAV89640.1| Mammalian cell entry related domain protein [Zymomonas mobilis
           subsp. mobilis ZM4]
          Length = 315

 Score =  118 bits (294), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 55/307 (17%), Positives = 112/307 (36%), Gaps = 12/307 (3%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+++ Y  VG   + +L      + W+ R +       +  I    SVDGL+  SSV +
Sbjct: 1   METRSNYILVGSITLILLALIATVLVWIGRVS--GTETHQYDIFFHQSVDGLAKGSSVSY 58

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           +G+P G++  + L    P+    +  +  DTP+   TTATI + G +G++ I L+     
Sbjct: 59  SGVPSGQVKEIKLLPNNPDFVRVRISLNADTPVLEGTTATISSMGFSGVSQITLAGGVSG 118

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
            K I           + T   +      S  +   +  + + R    + ++ ++ +   +
Sbjct: 119 AKPIENHG-PFGVPVIPTKPGALGQLLNSAPQLLERITTLTERMSDLLNDHNQRSIARIL 177

Query: 181 ANIETISTVLANNISHIDKMMHTTQV---------TPHSSDSKNTFNTITDLITSLDKMI 231
            N+ T+S  LAN    I ++M                 S  ++ T NT+   I      +
Sbjct: 178 DNMNTLSGNLANQSPKIRQIMDDAHHALVNLSDAGQQISELAQTTNNTVKQDIHPATAHL 237

Query: 232 KAIDLQKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSK 291
           K   +   + +     +  +           T+    +      ++   +  L    +  
Sbjct: 238 KETVMAARDSMQNLNDMLLDARPGVHHFSNETMPQFDQLVHDLHDMIGSMSSLTDRLNQT 297

Query: 292 MKSKETS 298
                  
Sbjct: 298 GAEGMLK 304


>gi|254521254|ref|ZP_05133309.1| ABC transporter substrate-binding protein [Stenotrophomonas sp.
           SKA14]
 gi|219718845|gb|EED37370.1| ABC transporter substrate-binding protein [Stenotrophomonas sp.
           SKA14]
          Length = 308

 Score =  118 bits (294), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 34/134 (25%), Positives = 56/134 (41%), Gaps = 1/134 (0%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K  Y  +G F +           W ++ +  D    E  +    +V GLS  S V++
Sbjct: 1   METKANYVLIGAFTLITGLALLAFGLWAAKYSS-DRTWQEYRVVFREAVTGLSVGSPVQY 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NGI VG I  L L  + P   +A+  +   TP+   T A +    L G + I+LS    +
Sbjct: 60  NGIAVGSITELNLVPDDPRQVVARIRLNSTTPVKTDTRAKLAITSLTGPSIIQLSGGTPQ 119

Query: 121 KKTIFQIATERNQR 134
              +  +  +    
Sbjct: 120 SPALTTVNKDPAPI 133



 Score = 80.4 bits (195), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 18/200 (9%), Positives = 68/200 (34%), Gaps = 3/200 (1%)

Query: 252 NFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNM 311
                + Q        ++           + ++    +  ++  +      N+A   + +
Sbjct: 112 QLSGGTPQSPALTTVNKDPAPIIPTTPSALQNITDVANRIVERMDQILSDRNVASINATL 171

Query: 312 RSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNISALKENNSLFKD 371
            +  +    + D+ Q   + + +  +   +L+ + +     + +++    +++   +   
Sbjct: 172 ANLETISGGLADRDQGTQALLLSARDAARSLDTTLKTTNGTIERLDKNL-VQQLPGIIDK 230

Query: 372 AQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFER 431
               +      +   +  +      + +F+  GL  +   + +L+  +       +  E 
Sbjct: 231 LDATLGKLDSAAGNADSILGENRAAINSFANDGLGQLGPTLTELRGLIRDLRRVSDRLEN 290

Query: 432 NPQDIVWGREKGSVKIYKPK 451
           NP   + GR+    K ++PK
Sbjct: 291 NPARYLLGRDAP--KEFEPK 308


>gi|260752532|ref|YP_003225425.1| hypothetical protein Za10_0289 [Zymomonas mobilis subsp. mobilis
           NCIMB 11163]
 gi|258551895|gb|ACV74841.1| Mammalian cell entry related domain protein [Zymomonas mobilis
           subsp. mobilis NCIMB 11163]
          Length = 315

 Score =  118 bits (293), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 54/307 (17%), Positives = 112/307 (36%), Gaps = 12/307 (3%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+++ Y  VG   + +L      + W+ R +       +  I    SVDGL+  SSV +
Sbjct: 1   METRSNYILVGSITLILLALIATILVWIGRVS--GTETHQYDIFFHQSVDGLAKGSSVSY 58

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           +G+P G++  + L    P+    +  +  DTP+   TTATI + G +G++ I L+     
Sbjct: 59  SGVPSGQVKEIKLLPNNPDFVRVRISLNADTPVLEGTTATISSMGFSGVSQITLAGGVSG 118

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
            K I           + T   +      S  +   +  + + R    + ++ ++ +   +
Sbjct: 119 AKPIENHG-PFGVPVIPTKPGALGQLLNSAPQLLERITTLTERMSDLLNDHNQRSIARIL 177

Query: 181 ANIETISTVLANNISHIDKMMHTTQV---------TPHSSDSKNTFNTITDLITSLDKMI 231
            N+ T+S  LAN    + ++M                 S  ++ T NT+   I      +
Sbjct: 178 DNMNTLSGNLANQSPKMRQIMDDAHHALVNLSDAGQQISELAQTTNNTVKQDIHPATAHL 237

Query: 232 KAIDLQKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSK 291
           K   +   + +     +  +           T+    +      ++   +  L    +  
Sbjct: 238 KETVMAARDSMQNLNDMLLDARPGVHHFSNETMPQFDQLVHDLHDMIGSMSSLTDRLNQT 297

Query: 292 MKSKETS 298
                  
Sbjct: 298 GAEGMLK 304


>gi|241761772|ref|ZP_04759858.1| Mammalian cell entry related domain protein [Zymomonas mobilis
           subsp. mobilis ATCC 10988]
 gi|241373686|gb|EER63246.1| Mammalian cell entry related domain protein [Zymomonas mobilis
           subsp. mobilis ATCC 10988]
          Length = 315

 Score =  118 bits (293), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 54/307 (17%), Positives = 112/307 (36%), Gaps = 12/307 (3%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+++ Y  VG   + +L      + W+ R +       +  I    SVDGL+  SSV +
Sbjct: 1   METRSNYILVGSITLILLALIATVLVWIGRVS--GTETHQYDIFFHQSVDGLAKGSSVSY 58

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           +G+P G++  + L    P+    +  +  DTP+   TTATI + G +G++ I L+     
Sbjct: 59  SGVPSGQVKEIKLLPNNPDFVRVRISLNADTPVLEGTTATISSMGFSGVSQITLAGGVSG 118

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
            K I           + T   +      S  +   +  + + R    + ++ ++ +   +
Sbjct: 119 AKPIENHG-PFGVPVIPTKPGALGQLLNSAPQLLERITTLTERMSDLLNDHNQRSIARIL 177

Query: 181 ANIETISTVLANNISHIDKMMHTTQV---------TPHSSDSKNTFNTITDLITSLDKMI 231
            N+ T+S  LAN    + ++M                 S  ++ T NT+   I      +
Sbjct: 178 DNMNTLSGNLANQSPKMRQIMDDAHHALVNLSDAGQQISELAQTTNNTVKQDIHPATAHL 237

Query: 232 KAIDLQKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSK 291
           K   +   + +     +  +           T+    +      ++   +  L    +  
Sbjct: 238 KETVMAARDSMQNLNDMLLDARPGVHHFSNETMPQFDQLVHDLHDMIGSMSSLTDRLNQT 297

Query: 292 MKSKETS 298
                  
Sbjct: 298 GAEGMLK 304


>gi|121998620|ref|YP_001003407.1| hypothetical protein Hhal_1841 [Halorhodospira halophila SL1]
 gi|121590025|gb|ABM62605.1| Mammalian cell entry related domain protein [Halorhodospira
           halophila SL1]
          Length = 313

 Score =  117 bits (292), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 53/310 (17%), Positives = 101/310 (32%), Gaps = 1/310 (0%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++  +  +GL  ++++        WL+ S+ Y G      I     V GLS  S V+F
Sbjct: 1   METRARHFWIGLATLAMILGGILFGVWLTDSDLY-GERQRFEIVFDEDVGGLSPRSPVKF 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NGI VG I  L LD + P   +A+  +  +TP+   T A I +  L              
Sbjct: 60  NGINVGEIDHLGLDPDNPGRVIARITVSGETPVRTDTRAQIGSSSLFAGGAHIRLKPGDP 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
                +   +   R    ++P       S+           + +     EN++    T  
Sbjct: 120 DAPPLEPPEQGLARIETESSPMARLREDSDQLLAGINNLVETANQLLSAENLDTLTATLN 179

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
              +T   V A        +         +  +      +   +  L        L    
Sbjct: 180 HLEQTTGAVAARRDDLGRGITALADGGEQAERTLQEAQQLVKEVRGLLDGPGREILHSTA 239

Query: 241 QILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAF 300
           +  E ++ SS    +        V    ++ Q  + + +++   L D  S ++       
Sbjct: 240 RATEALEGSSREAQELFRDNREAVERGLQSLQDLEPLSEELQRTLGDLRSLLRRLGQDPG 299

Query: 301 LENIADSTSN 310
            + +      
Sbjct: 300 GQLLRREQME 309



 Score = 58.8 bits (139), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 25/178 (14%), Positives = 64/178 (35%), Gaps = 4/178 (2%)

Query: 273 TFQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNMRSSISAIREITDQRQKIISTI 332
               + +  D LL+  ++ +++       EN+   T+ +         +  +R  +   I
Sbjct: 140 PMARLREDSDQLLAGINNLVETANQLLSAENLDTLTATLNHLEQTTGAVAARRDDLGRGI 199

Query: 333 NTIENITSNLNDSSQKFAELMSKINNISALKENNSLFKDAQRAMHTFRDTSEKINRYIPS 392
             + +       + Q+  +L+ ++  +        +     RA      +S +       
Sbjct: 200 TALADGGEQAERTLQEAQQLVKEVRGLLDGP-GREILHSTARATEALEGSSREAQELFRD 258

Query: 393 IGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFERNPQDIVWGREKGSVKIYKP 450
               ++      L D++ L  +LQ T+      L    ++P   +  RE+  ++ Y+P
Sbjct: 259 NREAVER-GLQSLQDLEPLSEELQRTLGDLRSLLRRLGQDPGGQLLRREQ--MEEYQP 313


>gi|91975835|ref|YP_568494.1| hypothetical protein RPD_1355 [Rhodopseudomonas palustris BisB5]
 gi|91682291|gb|ABE38593.1| Mammalian cell entry related [Rhodopseudomonas palustris BisB5]
          Length = 390

 Score =  117 bits (292), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 33/119 (27%), Positives = 54/119 (45%), Gaps = 1/119 (0%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++  +  VG FV++ +   F  ++WL  ++          I+    V GL   ++V F
Sbjct: 1   METRAPFVIVGAFVLAAILAVFGFVFWLHNTSGIGART-SYHIQFRDPVPGLLVGAAVLF 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRK 119
           NGI VG +  L L  + P    A   +  DTP+   T   +  QGL G+  + L   + 
Sbjct: 60  NGIRVGEVTALGLATDDPRRVNATIAVATDTPVRLDTRVGLDFQGLTGVPVVALEGGKD 118


>gi|238751981|ref|ZP_04613466.1| hypothetical protein yrohd0001_23860 [Yersinia rohdei ATCC 43380]
 gi|238709815|gb|EEQ02048.1| hypothetical protein yrohd0001_23860 [Yersinia rohdei ATCC 43380]
          Length = 313

 Score =  117 bits (292), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 53/293 (18%), Positives = 124/293 (42%), Gaps = 6/293 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++ ++  +GLF + ++  +     WL+ +   D       I     V GLS  S+V++
Sbjct: 1   METRAHHVVIGLFTLIVVSAALLFCLWLTGAGT-DRQFRLYDIVFNEPVSGLSQGSTVQY 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           +GI VG +  L LD + P    A+  +   TP+   T A +   G+ G + I+ S+  + 
Sbjct: 60  SGIRVGEVTQLRLDTDNPTQVWARVRVSASTPIREDTQARLTVAGITGTSNIQFSSSSQA 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPL-TTT 179
              +     +  +  +I ATPS ++  ++N EN     ++    + +++E   +    TT
Sbjct: 120 SPLLES---KDGEIPVIIATPSPMSQLLANGENFMSNANEVLVRLNQLLEPDNQQRLITT 176

Query: 180 IANIETISTVLANNISHIDKMMHTTQV-TPHSSDSKNTFNTITDLITSLDKMIKAIDLQK 238
           + N+  I+  +A+    I  ++      +  ++++    N +      L        +  
Sbjct: 177 LNNLALITQTVADQRQDIRTLLQQLAQASKQANETLTQTNRLLRNANGLMDGQGKQLVND 236

Query: 239 VNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSK 291
             + + ++Q +S    K  ++   ++++  +          ++   L+   + 
Sbjct: 237 AAKTMASLQNTSVILNKLVNENKTSLNNGMQGMNELGPAVDELRRTLATLRAA 289



 Score = 73.4 bits (177), Expect = 8e-11,   Method: Composition-based stats.
 Identities = 32/183 (17%), Positives = 78/183 (42%), Gaps = 4/183 (2%)

Query: 269 ETTQTFQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNMRSSISAIREITDQRQKI 328
            T     ++    ++ +S+ +  +         +N     + + +     + + DQRQ I
Sbjct: 135 ATPSPMSQLLANGENFMSNANEVLVRLNQLLEPDNQQRLITTLNNLALITQTVADQRQDI 194

Query: 329 ISTINTIENITSNLNDSSQKFAELMSKINNISALKENNSLFKDAQRAMHTFRDTSEKINR 388
            + +  +   +   N++  +   L+   N +    +   L  DA + M + ++TS  +N+
Sbjct: 195 RTLLQQLAQASKQANETLTQTNRLLRNANGLM-DGQGKQLVNDAAKTMASLQNTSVILNK 253

Query: 389 YIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFERNPQDIVWGREKGSVKIY 448
            +     +L N    G+N++   V +L+ T+      ++  E NP  ++ GRE+   + +
Sbjct: 254 LVNENKTSLNN-GMQGMNELGPAVDELRRTLATLRAAVSRLEENPSALLRGRERT--QEF 310

Query: 449 KPK 451
            P+
Sbjct: 311 TPR 313


>gi|54297973|ref|YP_124342.1| hypothetical protein lpp2028 [Legionella pneumophila str. Paris]
 gi|148359619|ref|YP_001250826.1| ABC transport system periplasmic substrate binding protein
           [Legionella pneumophila str. Corby]
 gi|296107661|ref|YP_003619362.1| ABC transport system periplasmic substrate binding protein
           [Legionella pneumophila 2300/99 Alcoy]
 gi|53751758|emb|CAH13180.1| hypothetical protein lpp2028 [Legionella pneumophila str. Paris]
 gi|148281392|gb|ABQ55480.1| ABC transport system periplasmic substrate binding protein
           [Legionella pneumophila str. Corby]
 gi|295649563|gb|ADG25410.1| ABC transport system periplasmic substrate binding protein
           [Legionella pneumophila 2300/99 Alcoy]
          Length = 307

 Score =  117 bits (291), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 47/293 (16%), Positives = 97/293 (33%), Gaps = 1/293 (0%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           MESK  YT VGL V+ +      +  WLS             + +  SV GLS +S V+F
Sbjct: 1   MESKTNYTIVGLIVLILTAGLLSAGLWLS-VGFNQKEYTSYTVYLKESVSGLSVESPVKF 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NG+ VG +  + L++  P        I   TP+  ST+AT+ +QG+ G+TY+ LS    E
Sbjct: 60  NGVQVGYVKEIKLNKNDPRQVELLLNIEKSTPITTSTSATLISQGITGVTYVGLSAGSSE 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
              + ++  E         +       +      +         +    EN +    +  
Sbjct: 120 LTPLRKMPGEPYPVIPSKPSLLNQLDAVLKEVAENVGAVSEKAQLIFNEENADNVRKSLA 179

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
                   +     +    + +      + + +   F  +   + +     K++      
Sbjct: 180 NIERITEIIADKGQTIDSSLNNLDVFVANMAKTSKQFPQLIKDLKTGISKFKSLADNMSA 239

Query: 241 QILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMK 293
              +  +                +       +    +   ++ + ++      
Sbjct: 240 AGKDVSKTMIAGKNTIDQISQQAIPPAVILLRRLNAISANLEKVSNEMRQNPS 292



 Score = 43.8 bits (100), Expect = 0.055,   Method: Composition-based stats.
 Identities = 23/172 (13%), Positives = 66/172 (38%), Gaps = 9/172 (5%)

Query: 274 FQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNMRSSISAIREITDQRQKIISTIN 333
             ++   +  +  +  +  +  +     EN  +   ++ +       I D+ Q I S++N
Sbjct: 141 LNQLDAVLKEVAENVGAVSEKAQLIFNEENADNVRKSLANIERITEIIADKGQTIDSSLN 200

Query: 334 TIENITSNLNDSSQKFAELMSKINNISALKENNSLFKDAQRAMHTFRDTSEKINRYIPSI 393
            ++   +N+  +S++F +L+          +  +     +          + +++ + + 
Sbjct: 201 NLDVFVANMAKTSKQFPQLIK---------DLKTGISKFKSLADNMSAAGKDVSKTMIAG 251

Query: 394 GNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFERNPQDIVWGREKGSV 445
            N +   SQ  +     L+R+L     + +   N   +NP  I+ G +   +
Sbjct: 252 KNTIDQISQQAIPPAVILLRRLNAISANLEKVSNEMRQNPSVIIRGTKTPKL 303


>gi|316935756|ref|YP_004110738.1| mammalian cell entry related domain-containing protein
           [Rhodopseudomonas palustris DX-1]
 gi|315603470|gb|ADU46005.1| Mammalian cell entry related domain protein [Rhodopseudomonas
           palustris DX-1]
          Length = 399

 Score =  116 bits (290), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 34/117 (29%), Positives = 55/117 (47%), Gaps = 1/117 (0%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++  +  VG FV++ +F  F  ++WL  ++          ++    V GL   ++V F
Sbjct: 1   METRAPFAIVGAFVLAAIFAVFGFVFWLHNTSGVGARTT-YQLQFRDPVPGLLVGAAVLF 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTL 117
           NGI VG +  L L  + P    A   + P TP+ P T   +  QGL G+  + L   
Sbjct: 60  NGIRVGEVTALALAPDDPRRVDATIAVAPSTPVRPDTKVGLDFQGLTGVPVVALEGG 116


>gi|261855958|ref|YP_003263241.1| hypothetical protein Hneap_1360 [Halothiobacillus neapolitanus c2]
 gi|261836427|gb|ACX96194.1| Mammalian cell entry related domain protein [Halothiobacillus
           neapolitanus c2]
          Length = 334

 Score =  116 bits (290), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 62/309 (20%), Positives = 123/309 (39%), Gaps = 4/309 (1%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M+SK  YT+VGLFV+ ++F    ++YWL  +          +I    SV GL+ +S V +
Sbjct: 1   MDSKINYTAVGLFVLLLIFGLAGTVYWL-VTGGKQQAFTPYVIYATDSVAGLTVNSHVLY 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G+ VG++  + +D+  P        I  + P++  T A +R QG+ G++ + L+  +  
Sbjct: 60  RGVDVGQVKSIRIDRNNPGRIRILVDIDENVPIFSDTVAQLRPQGVTGLSVLNLTGGKSS 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
                +   ++ +  +              +E   K    S+R    + E     L  T+
Sbjct: 120 VSLTQRN--KQGELVIPYQPSIFSRLEGGLSETMVKFSRISNRLDMLLSEKNIATLDNTL 177

Query: 181 ANIETISTVLANNISHIDKMMHTTQVT-PHSSDSKNTFNTITDLITSLDKMIKAIDLQKV 239
            NI T+STVLA +   I   +   + T  +++++  + N++      L            
Sbjct: 178 QNINTLSTVLAEHKDDISAAIIAGRTTLQNTAEASQSANSLIKQSQRLIARFDKSIQGLK 237

Query: 240 NQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSA 299
           + +    + ++     S   +  +       T   Q+    +D LL+      ++     
Sbjct: 238 STLTAANEAANKVSAASESTLTMSKTGNETLTNFNQQTLPVLDGLLTQLQETSRALTQLV 297

Query: 300 FLENIADST 308
              N   S 
Sbjct: 298 NEINENPSQ 306



 Score = 55.7 bits (131), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 32/164 (19%), Positives = 61/164 (37%), Gaps = 5/164 (3%)

Query: 281 IDHLLSDFSSKMKSKETSAFLENIADSTSNMRSSISAIREITDQRQKIISTINTIENITS 340
           +   +  FS      +     +NIA   + +++  +    + + +  I + I        
Sbjct: 147 LSETMVKFSRISNRLDMLLSEKNIATLDNTLQNINTLSTVLAEHKDDISAAIIAGRTTLQ 206

Query: 341 NLNDSSQKFAELMSKINNISA-----LKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGN 395
           N  ++SQ    L+ +   + A     ++   S    A  A +     SE       +   
Sbjct: 207 NTAEASQSANSLIKQSQRLIARFDKSIQGLKSTLTAANEAANKVSAASESTLTMSKTGNE 266

Query: 396 NLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFERNPQDIVWG 439
            L NF+Q  L  +  L+ +LQET       +N    NP  I++G
Sbjct: 267 TLTNFNQQTLPVLDGLLTQLQETSRALTQLVNEINENPSQILYG 310


>gi|152992946|ref|YP_001358667.1| ABC transporter, substrate-binding protein [Sulfurovum sp. NBC37-1]
 gi|151424807|dbj|BAF72310.1| ABC transporter, substrate-binding protein [Sulfurovum sp. NBC37-1]
          Length = 303

 Score =  116 bits (290), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 46/295 (15%), Positives = 97/295 (32%), Gaps = 5/295 (1%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M S+  YT VG+FV+          +WL++            +++  SV GLS DS+VR 
Sbjct: 1   MYSRVNYTIVGIFVLLFGAGLVAFTFWLAKYG-IKNEYNLYKLQMTESVSGLSKDSTVRL 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G+ VGR+  + ++ +          IR D P+    TA     G+ G+  IE+     +
Sbjct: 60  RGVDVGRVSEIRINPDNIEQIEVFLKIRSDVPIKEDMTAHTEMLGITGLLAIEIDGGTNK 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
            K +     E  +  +I  TPS  +       + ++ ++D     +K++ +       +I
Sbjct: 120 SKLLKS---ENGEIPVIKTTPSWFDKTSKGIGSMAENLTDLLEKAEKLLSDENIETFDSI 176

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
                  T    +                     +  ++ +     +            N
Sbjct: 177 LENTDKMTARVVDTLDEFNTTMQV-YRDAVVKLNDDIHSASSNFARITDNTLPALKALQN 235

Query: 241 QILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSK 295
                 + +       +    N     +        + +++  L  +      + 
Sbjct: 236 ATKNFNRFTMEAEKSLNRGDYNIKETFQPMLVDIGILTEQLTDLTRELQQSPSNV 290


>gi|52842262|ref|YP_096061.1| ABC transport system periplasmic substrate binding protein
           [Legionella pneumophila subsp. pneumophila str.
           Philadelphia 1]
 gi|52629373|gb|AAU28114.1| ABC transport system periplasmic substrate binding protein
           [Legionella pneumophila subsp. pneumophila str.
           Philadelphia 1]
          Length = 307

 Score =  116 bits (290), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 48/293 (16%), Positives = 98/293 (33%), Gaps = 1/293 (0%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           MESK  YT VGL V+ +      +  WLS             + +  SV GLS +S V+F
Sbjct: 1   MESKTNYTIVGLIVLILTAGLLSAGLWLS-VGFNQKEYTSYTVYLKESVSGLSVESPVKF 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NG+ VG +  + L++  P        I   TP+  ST+AT+ TQG+ G+TY+ LS    E
Sbjct: 60  NGVQVGYVKEIKLNKNDPRQVELLLNIEKSTPITTSTSATLITQGITGVTYVGLSAGSSE 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
              + ++  E         +       +      +         +    EN +    +  
Sbjct: 120 LTPLRKMPGEPYPVIPSKPSLLNQLDAVLKEVAENVGAVSEKAQLIFNEENADNVRKSLA 179

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
                   +     +    + +      + +++   F  +   + +     K++      
Sbjct: 180 NLERITEIIADKGQTIDSSLNNLDVFVANMANASKQFPQLIKDLKTGISKFKSLADNMSA 239

Query: 241 QILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMK 293
              +  +                +       +    +   ++ + ++      
Sbjct: 240 AGKDVSKTMIAGKNTIDQISQQAIPPAVILLRRLNAISANLEKVSNEMRQNPS 292



 Score = 44.5 bits (102), Expect = 0.034,   Method: Composition-based stats.
 Identities = 23/172 (13%), Positives = 67/172 (38%), Gaps = 9/172 (5%)

Query: 274 FQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNMRSSISAIREITDQRQKIISTIN 333
             ++   +  +  +  +  +  +     EN  +   ++ +       I D+ Q I S++N
Sbjct: 141 LNQLDAVLKEVAENVGAVSEKAQLIFNEENADNVRKSLANLERITEIIADKGQTIDSSLN 200

Query: 334 TIENITSNLNDSSQKFAELMSKINNISALKENNSLFKDAQRAMHTFRDTSEKINRYIPSI 393
            ++   +N+ ++S++F +L+          +  +     +          + +++ + + 
Sbjct: 201 NLDVFVANMANASKQFPQLIK---------DLKTGISKFKSLADNMSAAGKDVSKTMIAG 251

Query: 394 GNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFERNPQDIVWGREKGSV 445
            N +   SQ  +     L+R+L     + +   N   +NP  I+ G +   +
Sbjct: 252 KNTIDQISQQAIPPAVILLRRLNAISANLEKVSNEMRQNPSVIIRGTKAPKL 303


>gi|260425554|ref|ZP_05779534.1| ABC transporter substrate-binding protein [Citreicella sp. SE45]
 gi|260423494|gb|EEX16744.1| ABC transporter substrate-binding protein [Citreicella sp. SE45]
          Length = 301

 Score =  116 bits (290), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 59/290 (20%), Positives = 116/290 (40%), Gaps = 5/290 (1%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++  Y  VG+F +  L        WL++  Q D   A+  I    SV GL   S+VR+
Sbjct: 1   METRARYLLVGVFTIVGLVAVMGFTLWLAKV-QIDRTYAQYDIVF-DSVAGLGQASTVRY 58

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NG+ VG+++ + LD++ P     +  I   TP+   T AT+ +QG+ G++++ L+  R +
Sbjct: 59  NGVEVGKVLSIALDRDDPALVRVRIEIYASTPVREDTLATLSSQGVTGVSFVALAGGRAD 118

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
            + I           +I + PS     +++A +   +     R I+           T I
Sbjct: 119 AEPI--GVVPPADVPLIPSEPSAFQNLLTDAPDVLAEAILLMRDIRSFTTPENGAAITAI 176

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
                 +T   + ++   + +  +     ++    T   +  LI S D ++        +
Sbjct: 177 LRNVETATARIDAMATRTESVMASAEVTMANACA-TLVDLQALIASADGVLVDDLPAITD 235

Query: 241 QILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSS 290
           Q+   +     +         N +          + +   I+ L S  +S
Sbjct: 236 QLGAAVDRLGRSAAGFETFANNGLPQFSALATEARAMVAHINALTSRIAS 285


>gi|217978938|ref|YP_002363085.1| Mammalian cell entry related domain protein [Methylocella
           silvestris BL2]
 gi|217504314|gb|ACK51723.1| Mammalian cell entry related domain protein [Methylocella
           silvestris BL2]
          Length = 357

 Score =  116 bits (290), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 68/346 (19%), Positives = 128/346 (36%), Gaps = 7/346 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++  Y  +G F ++++  +F  + W S   +  G      +   GSV GL   ++V F
Sbjct: 1   METRANYALIGGFTLAVVAAAFAFVLWFSGGEKAGGQHV-YRVVFTGSVSGLLRGAAVLF 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NG+ VG +  +    + P    A   I    P+   T A + T GL G+  + LS   ++
Sbjct: 60  NGVRVGGVTKIDFVPDSPGKVYALIEIDARVPIRVDTKARLETTGLTGVANVALSGGSED 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
            KT+            I A  S     I +A   + + ++      K+++     +T ++
Sbjct: 120 AKTLEPGP--DGAPPTIIAERSDFQDLIESARKIAGQATEFLDRTNKVLDENSGSITASV 177

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
            NIE  S  LA N   +   +    +       K     +  L  + + +IKA+D  +V 
Sbjct: 178 KNIEKFSDALAANSDGLKDFL--GSMADVGRAIKPLTAQLETLADNANNVIKAVDPAQVK 235

Query: 241 QILENIQVSSNNFVKSSDQVINTVHDVRE--TTQTFQEVGQKIDHLLSDFSSKMKSKETS 298
            I+ +    S     ++D+V + + ++     T   + V  +I                 
Sbjct: 236 TIVSDFAQMSGKLNSAADKVDSVLTNLNGFLATGDNKGVFDEIAAAARSIRKLADDVNAR 295

Query: 299 AFLENIADSTSNMRSSISAIREITDQRQKIISTINTIENITSNLND 344
                   +  +           TD R+ +      I +I  N   
Sbjct: 296 WKDIGGNLARFSGSGLRQYEALATDGRKTLDLLNQAIRSIEQNPQQ 341



 Score = 93.8 bits (230), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 29/196 (14%), Positives = 76/196 (38%), Gaps = 1/196 (0%)

Query: 253 FVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNMR 312
             +++  +      +  + +  ++    +          + S            +     
Sbjct: 159 LDRTNKVLDENSGSITASVKNIEKFSDALAANSDGLKDFLGSMADVGRAIKPLTAQLETL 218

Query: 313 SSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNISALKENNSLFKDA 372
           +  +          ++ + ++    ++  LN ++ K   +++ +N   A  +N  +F + 
Sbjct: 219 ADNANNVIKAVDPAQVKTIVSDFAQMSGKLNSAADKVDSVLTNLNGFLATGDNKGVFDEI 278

Query: 373 QRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFERN 432
             A  + R  ++ +N     IG NL  FS SGL   + L    ++T++  +  + + E+N
Sbjct: 279 AAAARSIRKLADDVNARWKDIGGNLARFSGSGLRQYEALATDGRKTLDLLNQAIRSIEQN 338

Query: 433 PQDIVWGREKGSVKIY 448
           PQ  ++G+ K  +  Y
Sbjct: 339 PQQFIFGK-KQQIPDY 353


>gi|170743043|ref|YP_001771698.1| hypothetical protein M446_4935 [Methylobacterium sp. 4-46]
 gi|168197317|gb|ACA19264.1| Mammalian cell entry related domain protein [Methylobacterium sp.
           4-46]
          Length = 359

 Score =  116 bits (289), Expect = 7e-24,   Method: Composition-based stats.
 Identities = 80/448 (17%), Positives = 151/448 (33%), Gaps = 92/448 (20%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++     +G F ++++   F   +W+      DG M  + I   G V GL+  S V F
Sbjct: 1   METRANNVLIGTFTLAVIAAGFLFAFWMRGPVSNDGRM-PLRIVFSGGVGGLAKGSVVTF 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NGI VG    + L  + P   +A   +   TPL   T A +    L G+  I L     +
Sbjct: 60  NGIRVGEATEVELLPQDPRRVMALVEVERSTPLRADTRARLDMTMLTGVASIALVGGSAD 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
              +   A E ++ A I A  S I   + +A   +++  D  + + +++   E  +  T+
Sbjct: 120 APPLK--APEGDRMATIFADSSDIQDLMQSARTIAQRADDMLQRLDRVVAGNEGAINRTL 177

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
           AN+E  S  L ++   +D ++                              KA+D +K+ 
Sbjct: 178 ANVEQFSKALNDSAPALDALV------------------------------KAVDGRKLG 207

Query: 241 QILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAF 300
            +++N    S     ++  + + +HD R           ++D +L      + S      
Sbjct: 208 SLIDNADRFSAALAAAAPDIQDGLHDARLLAAKLNASADRVDAVLKGAEGFLGS------ 261

Query: 301 LENIADSTSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNIS 360
                          ++         +I     +I          S+   +  + I    
Sbjct: 262 ---------------ASGEAGKSTFGEIREAAISIREAGRAFRTMSENLDKRTATI---- 302

Query: 361 ALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVN 420
                                 +    R   +    +QN S  G   +           N
Sbjct: 303 ----------------------TTSFGRLSGAGRREVQNLSTEGQRTL-----------N 329

Query: 421 HFDDCLNNFERNPQDIVWGREKGSVKIY 448
             +      ER+P  +++G  K S+  Y
Sbjct: 330 SLNSAARTIERDPSQVIFGG-KPSLPEY 356


>gi|27381174|ref|NP_772703.1| ABC transporter substrate-binding protein [Bradyrhizobium japonicum
           USDA 110]
 gi|30179810|sp|P29285|Y6063_BRAJA RecName: Full=Uncharacterized protein bll6063
 gi|27354341|dbj|BAC51328.1| ABC transporter substrate-binding protein [Bradyrhizobium japonicum
           USDA 110]
          Length = 367

 Score =  116 bits (289), Expect = 7e-24,   Method: Composition-based stats.
 Identities = 36/118 (30%), Positives = 54/118 (45%), Gaps = 1/118 (0%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++  Y  +G FV++ +   F  IYWL+ +    GP     ++  G V GL   + V F
Sbjct: 1   METRAPYVLIGTFVLAAILAVFGFIYWLNNTGGI-GPRTNYHVQFQGPVPGLLVGAGVLF 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLR 118
           NGI VG +  L L  + P    A   +   TP+   T   +  QGL G+  + L    
Sbjct: 60  NGIRVGEVAQLGLAPDNPRFVNATISVASATPVRADTRVGLDFQGLTGVPVVTLEGGM 117


>gi|206575547|ref|YP_002235753.1| putative ABC transporter, periplasmic substrate-binding protein
           [Klebsiella pneumoniae 342]
 gi|206570391|gb|ACI12037.1| putative ABC transporter, periplasmic substrate-binding protein
           [Klebsiella pneumoniae 342]
          Length = 312

 Score =  116 bits (289), Expect = 7e-24,   Method: Composition-based stats.
 Identities = 61/308 (19%), Positives = 128/308 (41%), Gaps = 11/308 (3%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++ ++  +GLF + I         WLS++++ D       I    +V GLS  S+V F
Sbjct: 1   METRAHHVLIGLFTLIIFTAVLLFSLWLSKADR-DRQFHTYDIVFSEAVSGLSQGSTVNF 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           +GI VG ++ L LD+E P    A+  +   TP+   T A +   G+ G + I+LS   + 
Sbjct: 60  SGIRVGEVIQLRLDRENPGKVWARIRVEASTPVRQDTQARLAMAGITGTSIIQLSGGSET 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDS-SRHIQKIIENIEKPLTTT 179
              +  +    ++  +I ATPS +N  ++N E+    +++   R  Q +    ++ +  T
Sbjct: 120 SPVLEGV---NDRIPVIIATPSPLNQLLTNGEDVMTNVNEVLLRLNQILTTENQQRIVKT 176

Query: 180 IANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKV 239
           + N+E I+  +A+    I  ++         +      N        L +    +   K 
Sbjct: 177 LDNLEKITGTVADQREDISTILQQL------AVVTKQSNETLAQTNRLMRNANLLLDGKG 230

Query: 240 NQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSA 299
             ++ N   +     K++  +   V D + +     +   ++   L++    + +   + 
Sbjct: 231 KDLVNNAANTLALLQKTTSLLNQIVIDNQHSLNNGIQGFNELGPALAELRKTLATLRGAI 290

Query: 300 FLENIADS 307
                  +
Sbjct: 291 NSLEANPA 298



 Score = 65.7 bits (157), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 30/182 (16%), Positives = 75/182 (41%), Gaps = 4/182 (2%)

Query: 269 ETTQTFQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNMRSSISAIREITDQRQKI 328
            T     ++    + ++++ +  +         EN       + +       + DQR+ I
Sbjct: 135 ATPSPLNQLLTNGEDVMTNVNEVLLRLNQILTTENQQRIVKTLDNLEKITGTVADQREDI 194

Query: 329 ISTINTIENITSNLNDSSQKFAELMSKINNISALKENNSLFKDAQRAMHTFRDTSEKINR 388
            + +  +  +T   N++  +   LM   N +    +   L  +A   +   + T+  +N+
Sbjct: 195 STILQQLAVVTKQSNETLAQTNRLMRNAN-LLLDGKGKDLVNNAANTLALLQKTTSLLNQ 253

Query: 389 YIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFERNPQDIVWGREKGSVKIY 448
            +    ++L N    G N++   + +L++T+      +N+ E NP  ++ G E+  +K +
Sbjct: 254 IVIDNQHSLNN-GIQGFNELGPALAELRKTLATLRGAINSLEANPAALLRGPER--MKEF 310

Query: 449 KP 450
            P
Sbjct: 311 TP 312


>gi|238759497|ref|ZP_04620660.1| hypothetical protein yaldo0001_13610 [Yersinia aldovae ATCC 35236]
 gi|238702272|gb|EEP94826.1| hypothetical protein yaldo0001_13610 [Yersinia aldovae ATCC 35236]
          Length = 312

 Score =  116 bits (289), Expect = 7e-24,   Method: Composition-based stats.
 Identities = 51/293 (17%), Positives = 132/293 (45%), Gaps = 6/293 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++ ++  +GLF + ++  +     WL+ +   +   +   I    +V GLS  S+V++
Sbjct: 1   METRAHHVIIGLFTLIVVSAALLFCLWLTNAGS-NRQFSLYDIVFNEAVSGLSQGSTVQY 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           +GI VG ++ L LD++ P+   A+  +   TP+   T A +   G+ G++ I+ S+  ++
Sbjct: 60  SGIRVGEVIQLRLDKDNPSKVWARVRVSASTPIRQDTQARLTVAGITGMSNIQFSSGSQD 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPL-TTT 179
              +     E ++  +I ATPS ++  ++N EN     ++    + +++    +     T
Sbjct: 120 SPLLEG---EDDEIPVIVATPSPMSQLLANGENFMSNANEVLVRLNQLLAPDNQQRLIKT 176

Query: 180 IANIETISTVLANNISHIDKMMHTTQV-TPHSSDSKNTFNTITDLITSLDKMIKAIDLQK 238
           + N+E ++  +A+    +  M+      +  ++D+    + +      L +      +  
Sbjct: 177 LENLELVTQTVADQREDLRTMLQQLAQASKQANDTLAQTDRLLRNANGLMEGQGKQLVSD 236

Query: 239 VNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSK 291
             + + ++Q +S    K  ++   ++++  +          ++   L+   + 
Sbjct: 237 AAKTMVSLQNTSVILNKLVNENKTSLNNGMQGMNELGPAVDELRRTLATLRAA 289



 Score = 72.7 bits (175), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 31/182 (17%), Positives = 75/182 (41%), Gaps = 4/182 (2%)

Query: 269 ETTQTFQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNMRSSISAIREITDQRQKI 328
            T     ++    ++ +S+ +  +         +N       + +     + + DQR+ +
Sbjct: 135 ATPSPMSQLLANGENFMSNANEVLVRLNQLLAPDNQQRLIKTLENLELVTQTVADQREDL 194

Query: 329 ISTINTIENITSNLNDSSQKFAELMSKINNISALKENNSLFKDAQRAMHTFRDTSEKINR 388
            + +  +   +   ND+  +   L+   N +    +   L  DA + M + ++TS  +N+
Sbjct: 195 RTMLQQLAQASKQANDTLAQTDRLLRNANGLM-EGQGKQLVSDAAKTMVSLQNTSVILNK 253

Query: 389 YIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFERNPQDIVWGREKGSVKIY 448
            +     +L N    G+N++   V +L+ T+      +   E NP  ++ GRE+   + +
Sbjct: 254 LVNENKTSLNN-GMQGMNELGPAVDELRRTLATLRAAVTRLEENPAALLRGRERT--QEF 310

Query: 449 KP 450
            P
Sbjct: 311 TP 312


>gi|190572712|ref|YP_001970557.1| hypothetical protein Smlt0660 [Stenotrophomonas maltophilia K279a]
 gi|190010634|emb|CAQ44243.1| conserved hypothetical protein [Stenotrophomonas maltophilia K279a]
          Length = 308

 Score =  116 bits (289), Expect = 8e-24,   Method: Composition-based stats.
 Identities = 34/134 (25%), Positives = 57/134 (42%), Gaps = 1/134 (0%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K  Y  +G F +           W ++ +  D    E  +    +V GLS  S V++
Sbjct: 1   METKANYVLIGAFTLITGLALLAFGLWAAKYSS-DRTWQEYRVVFREAVTGLSVGSPVQY 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NGI VG I+ L L  + P   +A+  +   TP+   T A +    L G + I+LS    +
Sbjct: 60  NGIAVGSIIELNLVPDDPRQVVARIRLNSTTPVKTDTRAKLAITSLTGPSIIQLSGGTPQ 119

Query: 121 KKTIFQIATERNQR 134
              +  +  +    
Sbjct: 120 SPALTTVNKDPAPI 133



 Score = 79.6 bits (193), Expect = 9e-13,   Method: Composition-based stats.
 Identities = 18/200 (9%), Positives = 68/200 (34%), Gaps = 3/200 (1%)

Query: 252 NFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNM 311
                + Q        ++           + ++    +  ++  +      N+A   + +
Sbjct: 112 QLSGGTPQSPALTTVNKDPAPIIPTTPSALQNITDVANRIVERMDQILSDRNVASINATL 171

Query: 312 RSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNISALKENNSLFKD 371
            +  +    + D+ Q   + + +  +   +L+ + +     + +++    +++   +   
Sbjct: 172 ANLETISGGLADRDQGTQALLLSARDAARSLDTTLKTTNGTIERLDRNL-VQQLPGIIDK 230

Query: 372 AQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFER 431
               +      +   +  +      + +F+  GL  +   + +L+  +       +  E 
Sbjct: 231 LDGTLAKLDSAAGNADSILGENRAAINSFANDGLGQLGPTLTELRGLIRDLRRVSDRLEN 290

Query: 432 NPQDIVWGREKGSVKIYKPK 451
           NP   + GR+    K ++PK
Sbjct: 291 NPARYLLGRDAP--KEFEPK 308


>gi|254292868|ref|YP_003058891.1| hypothetical protein Hbal_0492 [Hirschia baltica ATCC 49814]
 gi|254041399|gb|ACT58194.1| Mammalian cell entry related domain protein [Hirschia baltica ATCC
           49814]
          Length = 314

 Score =  116 bits (288), Expect = 8e-24,   Method: Composition-based stats.
 Identities = 50/300 (16%), Positives = 120/300 (40%), Gaps = 12/300 (4%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++  Y  +G FV+  +        W+S+  Q+    +   +   G+V+GLS    VRF
Sbjct: 1   METRANYGLIGAFVLMAMVAFVLFAVWISKV-QFSKEFSVFDVVFEGAVNGLSEGGEVRF 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NGI VG +  L LD + PN+ +A+  +  +TP+   + A +   G+ G+T+I++     +
Sbjct: 60  NGIKVGEVTDLGLDAQDPNNVIARIRVDANTPVKSDSRAELGLLGITGMTFIQIKAGSPD 119

Query: 121 KKTIF-----QIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKP 175
           +  +           +  +  +    SG    I ++ +   ++S   R       +    
Sbjct: 120 EPLLNKGIRPYPPRIKTDKTQLDKIFSGGEGLIESSTDALDRVSRMFRDENVTRISNILA 179

Query: 176 L-TTTIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAI 234
                       + + A+    I  +         ++ + +  +   D   +L      +
Sbjct: 180 NIEDLTDVANGQNGIAADAQRAIQALEGAGIAMNDAAVAVDAASVQFDANVALMTKDTML 239

Query: 235 DLQKVNQILENIQVSSNN-----FVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFS 289
            L+ +  ++++   +  +       + +      + ++  T Q  Q + Q++D ++++  
Sbjct: 240 LLKDMQNVVKSADHAVGSVEGVVMDELAPSAEEVMSELSTTLQDVQLLVQRLDGVVAELE 299


>gi|86748500|ref|YP_484996.1| hypothetical protein RPB_1375 [Rhodopseudomonas palustris HaA2]
 gi|86571528|gb|ABD06085.1| Mammalian cell entry related [Rhodopseudomonas palustris HaA2]
          Length = 390

 Score =  116 bits (288), Expect = 9e-24,   Method: Composition-based stats.
 Identities = 33/119 (27%), Positives = 55/119 (46%), Gaps = 1/119 (0%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++  +  VG FV++ +   F  ++WL  ++          I+    V GL   ++V F
Sbjct: 1   METRAPFVVVGAFVLAAILAVFGFVFWLHNTSGIGART-SYHIQFRDPVPGLLVGAAVLF 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRK 119
           NGI VG +  L L  + P    A   +  +TP+ P T   +  QGL G+  + L   + 
Sbjct: 60  NGIRVGEVTELGLASDDPRRVNATIAVATNTPVRPDTKVGLDFQGLTGVPVVALEGGKD 118


>gi|229587673|ref|YP_002869792.1| hypothetical protein PFLU0096 [Pseudomonas fluorescens SBW25]
 gi|229359539|emb|CAY46380.1| conserved hypothetical membrane protein [Pseudomonas fluorescens
           SBW25]
          Length = 312

 Score =  116 bits (288), Expect = 9e-24,   Method: Composition-based stats.
 Identities = 59/294 (20%), Positives = 121/294 (41%), Gaps = 7/294 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++ ++  +GLF V ++  +     WL++S+  D    +  +    +V GLS  SSV++
Sbjct: 1   METRAHHVMIGLFSVIVVVGAMLFGLWLAKSS-VDSAFQDYEVIFNEAVSGLSQGSSVQY 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           +GI VG ++ L LD + P   LA+  +  +TP+   T A +   G+ G + I+LS    +
Sbjct: 60  SGIKVGDVISLRLDPKDPRRVLARIRLAGETPIKEDTQAKLALTGITGTSIIQLSGGTPQ 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPL-TTT 179
              +     +      I A+PS I   ++N+ +    I+    +   +         + T
Sbjct: 120 SPELKG---KDGNLPEIIASPSPIARLLNNSNDLMTSINLLLHNANDLFSRENVERLSNT 176

Query: 180 IANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKV 239
           + N++  + V+A+    I  +M        S  +       T L+ + + ++     Q  
Sbjct: 177 LDNLQKTTGVIADQRGDIKVVMQQL--MQVSKQASAALEQTTVLMRNANGLLNEQGKQAF 234

Query: 240 NQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMK 293
               + ++   ++    +  + N    V    Q   E+   +  L     S   
Sbjct: 235 GSAEQAMKSLEHSTATINTLLTNNKDSVNSGMQGLNELAPAVRELRETLGSLRA 288



 Score = 72.3 bits (174), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 32/178 (17%), Positives = 74/178 (41%), Gaps = 4/178 (2%)

Query: 273 TFQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNMRSSISAIREITDQRQKIISTI 332
               +    + L++  +  + +       EN+   ++ + +       I DQR  I   +
Sbjct: 139 PIARLLNNSNDLMTSINLLLHNANDLFSRENVERLSNTLDNLQKTTGVIADQRGDIKVVM 198

Query: 333 NTIENITSNLNDSSQKFAELMSKINNISALKENNSLFKDAQRAMHTFRDTSEKINRYIPS 392
             +  ++   + + ++   LM   N +   ++    F  A++AM +   ++  IN  + +
Sbjct: 199 QQLMQVSKQASAALEQTTVLMRNANGLLN-EQGKQAFGSAEQAMKSLEHSTATINTLLTN 257

Query: 393 IGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFERNPQDIVWGREKGSVKIYKP 450
             +++ +    GLN++   VR+L+ET+          E NP   + G +K   K + P
Sbjct: 258 NKDSVNS-GMQGLNELAPAVRELRETLGSLRAISRRLEANPSGYLLGSDKN--KEFTP 312


>gi|194364300|ref|YP_002026910.1| Mammalian cell entry related domain-containing protein
           [Stenotrophomonas maltophilia R551-3]
 gi|194347104|gb|ACF50227.1| Mammalian cell entry related domain protein [Stenotrophomonas
           maltophilia R551-3]
          Length = 308

 Score =  116 bits (288), Expect = 9e-24,   Method: Composition-based stats.
 Identities = 34/134 (25%), Positives = 57/134 (42%), Gaps = 1/134 (0%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K  Y  +G F +           W ++ +  D    E  +    +V GLS  S V++
Sbjct: 1   METKANYVLIGAFTLITGLALLAFGLWAAKYSS-DRTWQEYRVVFREAVTGLSVGSPVQY 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NGI VG I+ L L  + P   +A+  +   TP+   T A +    L G + I+LS    +
Sbjct: 60  NGIAVGSIIELNLVPDDPRQVVARIRLNSTTPVKTDTRAKLAITSLTGPSIIQLSGGTPQ 119

Query: 121 KKTIFQIATERNQR 134
              +  +  +    
Sbjct: 120 SPALTTVNKDPAPI 133



 Score = 77.7 bits (188), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 17/200 (8%), Positives = 68/200 (34%), Gaps = 3/200 (1%)

Query: 252 NFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNM 311
                + Q        ++           + ++    +  ++  +      N+A   + +
Sbjct: 112 QLSGGTPQSPALTTVNKDPAPIIPTTPSALQNITDVANRIVERMDQILSDRNVASINATL 171

Query: 312 RSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNISALKENNSLFKD 371
            +  +    + D+ Q   + + +  +   +L+ + +     + +++    +++   +   
Sbjct: 172 ANLETISGGLADRDQGTQALLLSARDAARSLDTTLKTTNGTIERLDKNL-VQQLPGIIDK 230

Query: 372 AQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFER 431
               +      +   +  +      + +F+  GL  +   + +L+  +       +  E 
Sbjct: 231 LDGTLVKLDSAAGNADSILGENRAAINSFANDGLGQLGPTLTELRGLIRDLRRVSDRLEN 290

Query: 432 NPQDIVWGREKGSVKIYKPK 451
           NP   + GR+    K ++P+
Sbjct: 291 NPARYLLGRDAP--KEFEPQ 308


>gi|103485972|ref|YP_615533.1| hypothetical protein Sala_0479 [Sphingopyxis alaskensis RB2256]
 gi|98976049|gb|ABF52200.1| Mammalian cell entry related [Sphingopyxis alaskensis RB2256]
          Length = 313

 Score =  116 bits (288), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 45/300 (15%), Positives = 103/300 (34%), Gaps = 5/300 (1%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+++    VG FV+       F + WL+  +   G   E  I    SVDGL+  + V+F
Sbjct: 1   METRSNNILVGAFVLLFTAALAFFVVWLANDS--GGAKREYDIFFKQSVDGLNKGAQVQF 58

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           +G+P G++  + L  + P     +  +    P+   TTA +   G  G++         +
Sbjct: 59  SGVPSGQVREIALWPDDPQFVRVRIEVNEGVPVLQGTTAALEGVGFTGVS-QISLDGAVK 117

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
                       +  + T          +  +   +  + + R  +   +  +  +   +
Sbjct: 118 GAPPITDKGPAGKPVIPTRVGGLGEILNTAPQLLQRLSTLTERLAELADDENQASIRGIL 177

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSS--DSKNTFNTITDLITSLDKMIKAIDLQK 238
            N+E  + +LA N   I++ +  T++    +   ++   N       ++D+ +       
Sbjct: 178 NNVEASTAILARNGPAIERALADTRIAIQQTGIAAEQIGNLAAAAQGTIDRNVDPAMANL 237

Query: 239 VNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETS 298
            + +              +D           T      + + +    +  SS     +  
Sbjct: 238 RDTLKSANASMKTLEGAIADARPGLKTFSETTIPEANALIRDLRRTSASLSSLTDKLDQQ 297



 Score = 64.6 bits (154), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 23/179 (12%), Positives = 57/179 (31%), Gaps = 3/179 (1%)

Query: 271 TQTFQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNMRSSISAIREITDQRQKIIS 330
                E+      LL   S+  +     A  EN A     + +  ++   +      I  
Sbjct: 137 VGGLGEILNTAPQLLQRLSTLTERLAELADDENQASIRGILNNVEASTAILARNGPAIER 196

Query: 331 TINTIENITSNLNDSSQKFAELMSKINNISALKENNSLFKDAQRAMHTFRDTSEKINRYI 390
            +            ++++   L +        +  +    + +  + +   + + +   I
Sbjct: 197 ALADTRIAIQQTGIAAEQIGNLAAAAQGTI-DRNVDPAMANLRDTLKSANASMKTLEGAI 255

Query: 391 PSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFERNPQDIVWGREKGSVKIYK 449
                 L+ FS++ + +   L+R L+ T        +  ++     V G  K  +  YK
Sbjct: 256 ADARPGLKTFSETTIPEANALIRDLRRTSASLSSLTDKLDQQGAGAVLGGSK--LPDYK 312


>gi|238796786|ref|ZP_04640291.1| hypothetical protein ymoll0001_25880 [Yersinia mollaretii ATCC
           43969]
 gi|238719274|gb|EEQ11085.1| hypothetical protein ymoll0001_25880 [Yersinia mollaretii ATCC
           43969]
          Length = 313

 Score =  116 bits (288), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 54/293 (18%), Positives = 123/293 (41%), Gaps = 6/293 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++ ++  +GLF + ++  +     WL+ +   +       I     V GLS  S+V++
Sbjct: 1   METRAHHVVIGLFTLIVVSAALLFCLWLTNAGS-NRQFKLYDIVFNEPVSGLSQGSTVQY 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           +GI VG ++ L LD E PN   A+  +   TP+   T A +   G+ G + I+ S+  + 
Sbjct: 60  SGIRVGEVIQLRLDNEDPNKVWARIRVSASTPIRQDTQARLTVAGITGTSNIQFSSSSQS 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPL-TTT 179
              +     +  +  +I ATPS ++  ++N EN     ++    + +++E   +     T
Sbjct: 120 SPLLEG---KDGEIPIIIATPSPMSQLLANGENFMSNANEVLVRLNQLLEPDNQQRLIRT 176

Query: 180 IANIETISTVLANNISHIDKMMHTTQV-TPHSSDSKNTFNTITDLITSLDKMIKAIDLQK 238
           + N+  I+  +A+    I  M+      +  ++++    N +      L        +  
Sbjct: 177 LDNLALITQTVADQRGDISTMLQQLAQASKQANETLAQTNRLLRNANGLMDGQGKQLVSD 236

Query: 239 VNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSK 291
             + + ++Q +S    K   +   ++ +  +          ++   L+   + 
Sbjct: 237 AAKTMASLQNTSTILNKLVSENKTSLSNGMQGMNELGPAVDELRRTLATLRAA 289



 Score = 76.5 bits (185), Expect = 9e-12,   Method: Composition-based stats.
 Identities = 31/183 (16%), Positives = 76/183 (41%), Gaps = 4/183 (2%)

Query: 269 ETTQTFQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNMRSSISAIREITDQRQKI 328
            T     ++    ++ +S+ +  +         +N       + +     + + DQR  I
Sbjct: 135 ATPSPMSQLLANGENFMSNANEVLVRLNQLLEPDNQQRLIRTLDNLALITQTVADQRGDI 194

Query: 329 ISTINTIENITSNLNDSSQKFAELMSKINNISALKENNSLFKDAQRAMHTFRDTSEKINR 388
            + +  +   +   N++  +   L+   N +    +   L  DA + M + ++TS  +N+
Sbjct: 195 STMLQQLAQASKQANETLAQTNRLLRNANGLM-DGQGKQLVSDAAKTMASLQNTSTILNK 253

Query: 389 YIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFERNPQDIVWGREKGSVKIY 448
            +     +L N    G+N++   V +L+ T+      ++  E NP  ++ GRE+   + +
Sbjct: 254 LVSENKTSLSN-GMQGMNELGPAVDELRRTLATLRAAVSRLEENPSALLRGRERT--QEF 310

Query: 449 KPK 451
            P+
Sbjct: 311 TPR 313


>gi|157415868|ref|YP_001483124.1| ABC transporter, periplasmic substrate-binding protein, putative
           [Campylobacter jejuni subsp. jejuni 81116]
 gi|157386832|gb|ABV53147.1| ABC transporter, periplasmic substrate-binding protein, putative
           [Campylobacter jejuni subsp. jejuni 81116]
 gi|307748505|gb|ADN91775.1| ABC transporter, periplasmic substrate-binding protein, putative
           [Campylobacter jejuni subsp. jejuni M1]
 gi|315931383|gb|EFV10352.1| mce related family protein [Campylobacter jejuni subsp. jejuni 327]
          Length = 296

 Score =  115 bits (287), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 42/288 (14%), Positives = 102/288 (35%), Gaps = 6/288 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++  Y  VGLFV  + F S   I WL   ++ +       I    SV GL   + VR 
Sbjct: 1   MENRANYFFVGLFVFGVFFASLGFILWLGGYSK-EESFKYYEIHTQESVAGLGIKAPVRL 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G+ VG +  + +  +       +  ++ +TP+   T AT++ QG+ G+ +I+L    K 
Sbjct: 60  LGVEVGSVEEISIYNQDELGVNIRIKVKNNTPIKEDTFATLQLQGITGLKFIQLQGGSKN 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
            K +        +  +I    S +      +E+    +  +    ++++          +
Sbjct: 120 SKDLVS---IHGKLPVIPFKESFLATIDRQSEHIFSLVKTADDKSKELLSEKNLKNLEIL 176

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
              + ++ + AN  ++   +                  +++    +            + 
Sbjct: 177 L--QNLAELSANLNANSKNLSLNLSNASLKIGKMADNISLSAQNFNSSLKNIKESTMILK 234

Query: 241 QILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDF 288
             ++      N +      ++  +   +        + + + +  +D 
Sbjct: 235 NFIKKADEKLNTYDDIKASLMQNLELFKRVLIESNILIENLQNSPADL 282


>gi|148925787|ref|ZP_01809475.1| possible ABC transport system periplasmic substrate-binding protein
           [Campylobacter jejuni subsp. jejuni CG8486]
 gi|145845797|gb|EDK22888.1| possible ABC transport system periplasmic substrate-binding protein
           [Campylobacter jejuni subsp. jejuni CG8486]
          Length = 296

 Score =  115 bits (287), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 42/288 (14%), Positives = 102/288 (35%), Gaps = 6/288 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++  Y  VGLFV  + F S   I WL   ++ +       I    SV GL   + VR 
Sbjct: 1   MENRANYFFVGLFVFGVFFASLGFILWLGGYSK-EESFKYYEIHTQESVAGLGVKAPVRL 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G+ VG +  + +  +       +  ++ +TP+   T AT++ QG+ G+ +++L    K 
Sbjct: 60  LGVEVGSVEEIGIYNQDELGVNIRIKVKNNTPIKEDTFATLQLQGITGLKFVQLQGGSKN 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
            K +        +  +I    S +      +E+    +  +    ++++          +
Sbjct: 120 SKDLVS---IHGKLPVIPFKESFLATIDRQSEHIFSLVKTADDKSKELLSEKNLKNLEIL 176

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
              + ++ + AN  ++   +                  +++    +            + 
Sbjct: 177 L--QNLAELSANLNTNSKNLSLNLSNASLKIGKMADNISLSAQNFNSSLKDIKESTMILK 234

Query: 241 QILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDF 288
             ++      N +      +I  +   +        + + + +  +D 
Sbjct: 235 NFIKKADEKLNTYDDIKASLIQNLELFKRVLIESNILIENLQNSPADL 282


>gi|313683001|ref|YP_004060739.1| mammalian cell entry related domain protein [Sulfuricurvum kujiense
           DSM 16994]
 gi|313155861|gb|ADR34539.1| Mammalian cell entry related domain protein [Sulfuricurvum kujiense
           DSM 16994]
          Length = 322

 Score =  115 bits (287), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 49/305 (16%), Positives = 117/305 (38%), Gaps = 13/305 (4%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           MES+  YT++G+FV+          +WL + +Q +       + +  SV GLS +++V+F
Sbjct: 1   MESRVNYTAIGVFVILFTVAVVAFGFWLGKYSQDERLYRRYKVYMTESVSGLSPEAAVKF 60

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G+ VG++  + ++            I+ +TP+   + A ++  G+ G+ +IE++   + 
Sbjct: 61  QGVDVGKVESIQINPHNSEEVELTLKIKKETPIKTDSNAMLKFYGITGLAFIEIAGGSRH 120

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
              +      ++    I ++PS I     +  N + K+S +     KI  +         
Sbjct: 121 APLLSDG---KDTVLTIPSSPSLITRLDESLSNVAAKLSLTLDRANKIFSDKNIDNVAQS 177

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNT------ITDLITSLDKMIKAI 234
                  T   +      K +    +    + SK+          +     + + +I+  
Sbjct: 178 LENLRSLTAQIDGYQIQIKSLLAQSIALEHNASKSFVAMGEAAGSVKTASGNFNTLIQTK 237

Query: 235 DLQKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQT----FQEVGQKIDHLLSDFSS 290
               +  +    + S     K    + +  +D+R            + ++   L ++  +
Sbjct: 238 MASTLESLDATSKESHKLIQKLEASLDHGDYDMRAIAAPASGELTTLLEQTRTLSNEMET 297

Query: 291 KMKSK 295
            ++S 
Sbjct: 298 TLRSL 302



 Score = 46.9 bits (108), Expect = 0.008,   Method: Composition-based stats.
 Identities = 20/246 (8%), Positives = 72/246 (29%), Gaps = 8/246 (3%)

Query: 193 NISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVNQILENIQVSSNN 252
           N  + +++  T ++   +    ++   +     +    I+     +   +L + + +   
Sbjct: 74  NPHNSEEVELTLKIKKETPIKTDSNAMLKFYGITGLAFIEIAGGSRHAPLLSDGKDTVLT 133

Query: 253 FVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNMR 312
              S   +      +            + + + SD +    ++         A       
Sbjct: 134 IPSSPSLITRLDESLSNVAAKLSLTLDRANKIFSDKNIDNVAQSLENLRSLTAQIDGYQI 193

Query: 313 SSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNISALKENNSLFKDA 372
              S + +          +   +     ++  +S  F  L+          +  S  +  
Sbjct: 194 QIKSLLAQSIALEHNASKSFVAMGEAAGSVKTASGNFNTLIQT--------KMASTLESL 245

Query: 373 QRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFERN 432
                      +K+   +     +++  +     ++  L+ + +   N  +  L +   N
Sbjct: 246 DATSKESHKLIQKLEASLDHGDYDMRAIAAPASGELTTLLEQTRTLSNEMETTLRSLREN 305

Query: 433 PQDIVW 438
           P D+++
Sbjct: 306 PSDLLF 311


>gi|205355660|ref|ZP_03222430.1| possible ABC transport system periplasmic substrate binding protein
           [Campylobacter jejuni subsp. jejuni CG8421]
 gi|205346437|gb|EDZ33070.1| possible ABC transport system periplasmic substrate binding protein
           [Campylobacter jejuni subsp. jejuni CG8421]
          Length = 296

 Score =  115 bits (287), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 42/288 (14%), Positives = 102/288 (35%), Gaps = 6/288 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++  Y  VGLFV  + F S   I WL   ++ +       I    SV GL   + VR 
Sbjct: 1   MENRANYFFVGLFVFGVFFASLGFILWLGGYSK-EESFKYYEIHTQESVAGLGVKAPVRL 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G+ VG +  + +  +       +  ++ +TP+   T AT++ QG+ G+ +++L    K 
Sbjct: 60  LGVEVGSVEEIGIYNQDELGVNIRIKVKNNTPIKEDTFATLQLQGITGLKFVQLQGGSKN 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
            K +        +  +I    S +      +E+    +  +    ++++          +
Sbjct: 120 SKDLVS---IHGKLPVIPFKESFLATIDRQSEHIFSLVKTADDKSKELLSEKNLKNLEIL 176

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
              + ++ + AN  ++   +                  +++    +            + 
Sbjct: 177 L--QNLAELSANLNANSKNLSLNLSNASLKIGKMADNISLSAQNFNSSLKDIKESTMILK 234

Query: 241 QILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDF 288
             ++      N +      +I  +   +        + + + +  +D 
Sbjct: 235 NFIKKADEKLNTYDDIKASLIQNLELFKRVLIESNILIENLQNSPADL 282


>gi|57238659|ref|YP_179790.1| ABC transporter, periplasmic substrate-binding protein, putative
           [Campylobacter jejuni RM1221]
 gi|86153127|ref|ZP_01071332.1| ABC transporter, periplasmic substrate-binding protein, putative
           [Campylobacter jejuni subsp. jejuni HB93-13]
 gi|57167463|gb|AAW36242.1| ABC transporter, periplasmic substrate-binding protein, putative
           [Campylobacter jejuni RM1221]
 gi|85844012|gb|EAQ61222.1| ABC transporter, periplasmic substrate-binding protein, putative
           [Campylobacter jejuni subsp. jejuni HB93-13]
 gi|315059098|gb|ADT73427.1| Possible ABC transport system periplasmic substrate-binding protein
           [Campylobacter jejuni subsp. jejuni S3]
          Length = 296

 Score =  115 bits (287), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 41/288 (14%), Positives = 103/288 (35%), Gaps = 6/288 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++  Y  VGLFV  + F S   I WL   ++ +       I    SV GL   + VR 
Sbjct: 1   MENRANYFFVGLFVFGVFFASLGFILWLGGYSK-EESFKYYEIHTQESVAGLGIKAPVRL 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G+ VG +  + +  +       +  ++ +TP+   T AT++ QG+ G+ +++L    K 
Sbjct: 60  LGVEVGSVEEISIYNQDELGVNIRIKVKNNTPIKEDTFATLQLQGITGLKFVQLQGGSKN 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
            K +      + +  +I    S +      +E+    +  +    ++++          +
Sbjct: 120 SKDLVS---IQGKLPVIPFKESFLATIDRQSEHIFSLVKTADDKSKELLSEKNLKNLEIL 176

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
              + ++ + AN  ++   +                  +++    +            + 
Sbjct: 177 L--QNLAELSANLNANSKNLSLNLSNASLKIGKMADNISLSAQNFNSSLKDIKESTMILK 234

Query: 241 QILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDF 288
             ++      N +      ++  +   +        + + + +  +D 
Sbjct: 235 NFIKKADEKLNTYDDIKASLMQNLELFKRVLIESNILIENLQNSPADL 282


>gi|153951405|ref|YP_001398925.1| ABC transporter periplasmic substrate-binding protein
           [Campylobacter jejuni subsp. doylei 269.97]
 gi|152938851|gb|ABS43592.1| putative ABC transporter, periplasmic substrate-binding protein
           [Campylobacter jejuni subsp. doylei 269.97]
          Length = 296

 Score =  115 bits (287), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 43/288 (14%), Positives = 102/288 (35%), Gaps = 6/288 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++  Y  VGLFV  + F S   I+WL   ++ +       I    SV GL   + VR 
Sbjct: 1   MENRANYFFVGLFVFGVFFASLGFIFWLGGYSK-EESFKYYEIHTQESVAGLGIKAPVRL 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G+ VG +  + +  +       +  ++ +TP+   T AT++ QG+ G+ +++L    K 
Sbjct: 60  LGVEVGSVEEISIYNQDELGVNIRIKVKNNTPIKEDTFATLQLQGITGLKFVQLQGGSKN 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
            K +  I  +        +  + I+      ++        +   +      EK L    
Sbjct: 120 SKDLVSIHGKLPVIPFKESFLATIDR-----QSEHIFSLVKTADDKSKELLSEKNLKNLE 174

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
             ++ ++ + AN  +    +                  +++    +            + 
Sbjct: 175 IFLQNLAELSANLNADSKNLSLNLSNASLKIGKMADNISLSAQNFNSSLKDIKESTMILK 234

Query: 241 QILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDF 288
             ++      N +      ++  +   ++       + + + +  +D 
Sbjct: 235 NFIKKADEKLNTYDDIKASLMQNLELFKQVLIESNILIENLQNSPADL 282


>gi|307610776|emb|CBX00388.1| hypothetical protein LPW_21091 [Legionella pneumophila 130b]
          Length = 307

 Score =  115 bits (287), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 47/293 (16%), Positives = 97/293 (33%), Gaps = 1/293 (0%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           MESK  YT VGL V+ +      +  WLS             + +  SV GLS +S V+F
Sbjct: 1   MESKTNYTIVGLAVLILTAGLLSAGLWLS-VGFNQKEYTSYTVYLKESVSGLSIESPVKF 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NG+ VG +  + L++  P        I   TP+  ST+AT+ +QG+ G+TY+ LS    E
Sbjct: 60  NGVQVGYVKEIKLNKNDPRQVELLLNIEKSTPITTSTSATLISQGITGVTYVGLSAGSSE 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
              + ++  E         +       +      +         +    EN +    +  
Sbjct: 120 LTPLRKMPGEPYPVIPSKPSLLNQLDAVLKEVAENVGAVSEKAQLIFNEENADNVRKSLA 179

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
                   +     +    + +      + + +   F  +   + +     K++      
Sbjct: 180 NIERITEIIADKGQTIDSSLNNLDVFVANMAKASKQFPQLIKDLKTGISKFKSLADNMSA 239

Query: 241 QILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMK 293
              +  +                +       +    +   ++ + ++      
Sbjct: 240 AGKDVSKTMIAGKNTIDQISQQAIPPAVILLRRLNAISANLEKVSNEMRQNPS 292



 Score = 44.5 bits (102), Expect = 0.036,   Method: Composition-based stats.
 Identities = 23/172 (13%), Positives = 66/172 (38%), Gaps = 9/172 (5%)

Query: 274 FQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNMRSSISAIREITDQRQKIISTIN 333
             ++   +  +  +  +  +  +     EN  +   ++ +       I D+ Q I S++N
Sbjct: 141 LNQLDAVLKEVAENVGAVSEKAQLIFNEENADNVRKSLANIERITEIIADKGQTIDSSLN 200

Query: 334 TIENITSNLNDSSQKFAELMSKINNISALKENNSLFKDAQRAMHTFRDTSEKINRYIPSI 393
            ++   +N+  +S++F +L+          +  +     +          + +++ + + 
Sbjct: 201 NLDVFVANMAKASKQFPQLIK---------DLKTGISKFKSLADNMSAAGKDVSKTMIAG 251

Query: 394 GNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFERNPQDIVWGREKGSV 445
            N +   SQ  +     L+R+L     + +   N   +NP  I+ G +   +
Sbjct: 252 KNTIDQISQQAIPPAVILLRRLNAISANLEKVSNEMRQNPSVIIRGTKAPKL 303


>gi|121612777|ref|YP_001001291.1| ABC transporter, periplasmic substrate-binding protein, putative
           [Campylobacter jejuni subsp. jejuni 81-176]
 gi|167006185|ref|ZP_02271943.1| ABC transporter, periplasmic substrate-binding protein, putative
           [Campylobacter jejuni subsp. jejuni 81-176]
 gi|87249981|gb|EAQ72940.1| ABC transporter, periplasmic substrate-binding protein, putative
           [Campylobacter jejuni subsp. jejuni 81-176]
          Length = 296

 Score =  115 bits (287), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 45/288 (15%), Positives = 106/288 (36%), Gaps = 6/288 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++  Y  VGLFV  + F S   I WL   ++ +       I    SV GL   + VR 
Sbjct: 1   MENRANYFFVGLFVFGVFFASLGFILWLGGYSK-EESFKYYEIHTQESVAGLGIKAPVRL 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G+ VG +  + +  +       +  ++ +TP+   T AT++ QG+ G+ +++L    K 
Sbjct: 60  LGVEVGSVEEISIYNQDELGVNIRIKVKNNTPIKEDTFATLQLQGITGLKFVQLQGGSKN 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
            K +      + +  +I    S +      +E+    +  +    ++++          +
Sbjct: 120 SKDLVS---IQGKLPVIPFKESFLATIDRQSEHIFSLVKTADDKSKELLSEKNLKNLEIL 176

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
                  +   N  S    +  +         + N   +  +  +SL  + ++  + K  
Sbjct: 177 LQNLAELSANLNANSKNLSLNLSNASLKIGKMANNISLSAQNFNSSLKDIKESTMILKKF 236

Query: 241 QILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDF 288
             ++      N +      ++  +   +        + + + +  +D 
Sbjct: 237 --IKKADEKLNTYDDIKASLMQNLELFKRVLIESNILIENLQNSPADL 282


>gi|83858856|ref|ZP_00952378.1| ABC transporter, periplasmic substrate-binding protein, putative
           [Oceanicaulis alexandrii HTCC2633]
 gi|83853679|gb|EAP91531.1| ABC transporter, periplasmic substrate-binding protein, putative
           [Oceanicaulis alexandrii HTCC2633]
          Length = 318

 Score =  115 bits (287), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 59/322 (18%), Positives = 110/322 (34%), Gaps = 4/322 (1%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K ++  VG FVV +         WLS ++  D    E  +   G+V GL   S VRF
Sbjct: 1   METKAHHAIVGFFVVFLTVSGVMLTLWLSGAS-LDKEFREYDVVFDGAVRGLRPASEVRF 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NGI VG +  L L+ + P   +A+  +  +TP+   + A +  QGL G++YI++S    +
Sbjct: 60  NGIQVGEVTELGLNPDNPGQVIARIRVNVETPVKSDSEAQLEPQGLTGLSYIQISAGSPD 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
              +     +R  R   T            +   S ++S          EN+E    T  
Sbjct: 120 AARLESRQGDRAPRIYATQAQIDQLVEGGESLLESAQLSFVRVSRLLSDENLESLTNTLN 179

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
                   +    +   +       +     D     + +       ++ +         
Sbjct: 180 HIETITGNLAERELLMSEARAALHSIRQAGDDVSVAASAMQQFAEVTERYVVNDLTPATL 239

Query: 241 QILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAF 300
                 Q       ++ D +      V E ++   +   ++   L D  S + + E  A 
Sbjct: 240 DTAAAAQEVDRTAQETYDALTAIRPGVEEFSE---DGLTQLTATLRDLRSLVAALERVAL 296

Query: 301 LENIADSTSNMRSSISAIREIT 322
                 +        + +    
Sbjct: 297 ELEADPAGFIAEPEGAEVEVPR 318


>gi|283957034|ref|ZP_06374506.1| ABC transporter, periplasmic substrate-binding protein, putative
           [Campylobacter jejuni subsp. jejuni 1336]
 gi|283791535|gb|EFC30332.1| ABC transporter, periplasmic substrate-binding protein, putative
           [Campylobacter jejuni subsp. jejuni 1336]
          Length = 296

 Score =  115 bits (286), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 42/288 (14%), Positives = 104/288 (36%), Gaps = 6/288 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++  Y  VGLFV  + F S   I WL   ++ +       I    SV GL   + VR 
Sbjct: 1   MENRANYFFVGLFVFGVFFASLGFILWLGGYSK-EESFKYYEIHTQESVAGLGIKAPVRL 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G+ VG +  + +  +       +  ++ +TP+   T AT++ QG+ G+ +++L    K 
Sbjct: 60  LGVEVGSVEEISIYNQDELGVNIRIKVKNNTPIKEDTFATLQLQGITGLKFVQLQGGSKN 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
            K +      + +  +I    S +      +E+    +  +    ++++           
Sbjct: 120 SKDLVS---IQGKLPVIPFKESFLATIDRQSEHIFSLVKTADDKSKELLSEKNLKNLEI- 175

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
             ++ ++ + AN  ++   +      T           +++    +            + 
Sbjct: 176 -FLQNLAELSANLNANSKNLSLNLSNTSLKIGKMADNISLSAQNFNSSLKDIKESTMILK 234

Query: 241 QILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDF 288
             ++      N +      ++  +   +        + + + +  +D 
Sbjct: 235 NFIKKADEKLNTYDDIKASLMQNLELFKRILIESNILIENLQNSPADL 282


>gi|54294944|ref|YP_127359.1| hypothetical protein lpl2023 [Legionella pneumophila str. Lens]
 gi|53754776|emb|CAH16263.1| hypothetical protein lpl2023 [Legionella pneumophila str. Lens]
          Length = 307

 Score =  115 bits (286), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 47/293 (16%), Positives = 97/293 (33%), Gaps = 1/293 (0%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           MESK  YT VGL V+ +      +  WLS             + +  SV GLS +S V+F
Sbjct: 1   MESKTNYTIVGLAVLILTAGLLSAGLWLS-VGFNQKEYTSYTVYLKESVSGLSIESPVKF 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NG+ VG +  + L++  P        I   TP+  ST+AT+ +QG+ G+TY+ LS    E
Sbjct: 60  NGVQVGYVKEIKLNKNDPRQVELLLNIEKSTPITTSTSATLISQGITGVTYVGLSAGSSE 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
              + ++  E         +       +      +         +    EN +    +  
Sbjct: 120 LTPLRKMPGEPYPVIPSKPSLLNQLDAVLKEVAENVGAVSEKAQLIFNEENADNVRKSLA 179

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
                   +     +    + +      + + +   F  +   + +     K++      
Sbjct: 180 NIERITEIIADKGQTIDSSLNNLDVFVANMAKASKQFPQLIKDLKTGISKFKSLADNMSA 239

Query: 241 QILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMK 293
              +  +                +       +    +   ++ + ++      
Sbjct: 240 AGKDVSKTMIAGKNTIDQISQQAIPPAVILLRRLNAISANLEKISNEMRQNPS 292



 Score = 44.2 bits (101), Expect = 0.040,   Method: Composition-based stats.
 Identities = 23/172 (13%), Positives = 66/172 (38%), Gaps = 9/172 (5%)

Query: 274 FQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNMRSSISAIREITDQRQKIISTIN 333
             ++   +  +  +  +  +  +     EN  +   ++ +       I D+ Q I S++N
Sbjct: 141 LNQLDAVLKEVAENVGAVSEKAQLIFNEENADNVRKSLANIERITEIIADKGQTIDSSLN 200

Query: 334 TIENITSNLNDSSQKFAELMSKINNISALKENNSLFKDAQRAMHTFRDTSEKINRYIPSI 393
            ++   +N+  +S++F +L+          +  +     +          + +++ + + 
Sbjct: 201 NLDVFVANMAKASKQFPQLIK---------DLKTGISKFKSLADNMSAAGKDVSKTMIAG 251

Query: 394 GNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFERNPQDIVWGREKGSV 445
            N +   SQ  +     L+R+L     + +   N   +NP  I+ G +   +
Sbjct: 252 KNTIDQISQQAIPPAVILLRRLNAISANLEKISNEMRQNPSVIIRGTKAPKL 303


>gi|300114237|ref|YP_003760812.1| mammalian cell entry related domain-containing protein
           [Nitrosococcus watsonii C-113]
 gi|299540174|gb|ADJ28491.1| Mammalian cell entry related domain protein [Nitrosococcus watsonii
           C-113]
          Length = 295

 Score =  115 bits (286), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 53/288 (18%), Positives = 109/288 (37%), Gaps = 7/288 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME + ++  +GLF +  L        WL +S+  +       IR   +V GL+  ++V +
Sbjct: 1   MEPRAHHVLIGLFALLTLGGILLFSLWLGKSSA-ERDYDYYEIRFDQAVSGLAVGNAVLY 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NGI VG ++ L+LD E P+   A   +  D P+   T A++    + G   I+L     +
Sbjct: 60  NGIKVGDVMDLYLDPEDPSQVRALIRVYSDVPVKQDTRASLMLANITGGMSIQLHGGTLQ 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQK-IIENIEKPLTTT 179
              +     + NQ A+I A PS +  F++  E     +        + +       +   
Sbjct: 120 SPRLIS---DPNQPAVIVAEPSPLRSFLAGGETLMVSLDRLLNSTNRLLSPENLGRIERI 176

Query: 180 IANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKV 239
           + +IE I+T LA     + + M         ++            ++   M         
Sbjct: 177 LVDIEQITTTLAAQRDELAQAMTNFNRAGQQANVLLEQQGSKAFNSAQHAMAALERSSSQ 236

Query: 240 NQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSD 287
            + L     +  +  +   Q+   + ++           ++++   S+
Sbjct: 237 IESLLAANAA--SVNRGLGQLGPALSELNSVLNNLNRFTRRLEENPSE 282


>gi|86152242|ref|ZP_01070453.1| ABC transporter, periplasmic substrate-binding protein, putative
           [Campylobacter jejuni subsp. jejuni 260.94]
 gi|85840731|gb|EAQ57982.1| ABC transporter, periplasmic substrate-binding protein, putative
           [Campylobacter jejuni subsp. jejuni 260.94]
          Length = 296

 Score =  115 bits (286), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 44/288 (15%), Positives = 106/288 (36%), Gaps = 6/288 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++  Y  VGLFV  + F S   I WL   ++ +       I    SV GL   + VR 
Sbjct: 1   MENRANYFFVGLFVFGVFFASLGFILWLGGYSK-EESFKYYEIHTQESVAGLGIKAPVRL 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G+ VG +  + +  +       +  ++ +TP+   T AT++ QG+ G+ +++L    K 
Sbjct: 60  LGVEVGSVEEISIYNQDELGVNIRIKVKNNTPIKEDTFATLQLQGIIGLKFVQLQGGSKN 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
            K +      + +  +I    S +      +E+    +  +    ++++          +
Sbjct: 120 SKDLVS---IQGKLPVIPFKESFLATIDRQSEHIFSLVKTADDKSKELLSEKNLKNLEIL 176

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
                  +   N  S    +  +         + N   +  +  ++L  + ++  + K  
Sbjct: 177 LQNLAELSANLNANSKNLSLNLSNASLKIGKMADNISLSAQNFNSNLKDIKESTMILKKF 236

Query: 241 QILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDF 288
             ++      N +      ++  +   +        + + + +  +D 
Sbjct: 237 --IKKADEKLNTYDDIKASLMQNLELFKRVLIESNILIENLQNSPADL 282


>gi|312958196|ref|ZP_07772719.1| ABC transport system substrate-binding protein [Pseudomonas
           fluorescens WH6]
 gi|311287627|gb|EFQ66185.1| ABC transport system substrate-binding protein [Pseudomonas
           fluorescens WH6]
          Length = 312

 Score =  115 bits (286), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 55/294 (18%), Positives = 120/294 (40%), Gaps = 7/294 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++ ++  +GLF V ++  +     WL++S+  D    +  +    +V GLS  SSV++
Sbjct: 1   METRAHHVMIGLFSVIVVVGAMLFGLWLAKSS-VDSAFQDYEVIFNEAVSGLSQGSSVQY 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           +GI VG ++ L LD + P   LA+  +   TP+   T A +   G+ G + I+LS    +
Sbjct: 60  SGIKVGDVISLSLDPKDPRRVLARIRLAGQTPVKEDTQAKLALTGITGTSIIQLSGGTPQ 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQ-KIIENIEKPLTTT 179
              +     +      I A+PS I   ++++ +    I+    +            ++ T
Sbjct: 120 SPALKG---KDGNLPQIIASPSPIARLLNDSNDLMTGINLLLHNANAMFSSENVDRISKT 176

Query: 180 IANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKV 239
           + N++  +  +A+    I  +M         + +     T+  L+ + + ++     Q  
Sbjct: 177 LDNLQQTTGAIADQRGDIKVVMQQLMQVSKQASAALEQTTL--LMRNANGLLNDQGKQAF 234

Query: 240 NQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMK 293
               + ++   ++    +  + +    V    Q   E+   +  L     S   
Sbjct: 235 GSAEQAMKSLEHSTATLNTLLTDNKDSVNSGLQGLNELAPAVRELRETLGSLRA 288



 Score = 73.4 bits (177), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 31/178 (17%), Positives = 71/178 (39%), Gaps = 4/178 (2%)

Query: 273 TFQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNMRSSISAIREITDQRQKIISTI 332
               +    + L++  +  + +       EN+   +  + +       I DQR  I   +
Sbjct: 139 PIARLLNDSNDLMTGINLLLHNANAMFSSENVDRISKTLDNLQQTTGAIADQRGDIKVVM 198

Query: 333 NTIENITSNLNDSSQKFAELMSKINNISALKENNSLFKDAQRAMHTFRDTSEKINRYIPS 392
             +  ++   + + ++   LM   N +    +    F  A++AM +   ++  +N  +  
Sbjct: 199 QQLMQVSKQASAALEQTTLLMRNANGLLN-DQGKQAFGSAEQAMKSLEHSTATLNTLLTD 257

Query: 393 IGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFERNPQDIVWGREKGSVKIYKP 450
             +++ +    GLN++   VR+L+ET+          E NP   + G +K   K + P
Sbjct: 258 NKDSVNS-GLQGLNELAPAVRELRETLGSLRAISRRLEANPSGYLLGSDKN--KEFTP 312


>gi|283953734|ref|ZP_06371265.1| ABC transporter, periplasmic substrate-binding protein, putative
           [Campylobacter jejuni subsp. jejuni 414]
 gi|283794775|gb|EFC33513.1| ABC transporter, periplasmic substrate-binding protein, putative
           [Campylobacter jejuni subsp. jejuni 414]
          Length = 296

 Score =  115 bits (286), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 34/124 (27%), Positives = 59/124 (47%), Gaps = 1/124 (0%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++  Y  VGLFV  + F S   I WL   ++ +       I    SV GL   + VR 
Sbjct: 1   MENRANYFFVGLFVFGVFFASLGFILWLGGYSKKESFKY-YEIHTQESVAGLGIKAPVRL 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G+ VG +  + +  +       +  ++ +TP+   T AT++ QG+ G+ +++L    K 
Sbjct: 60  LGVEVGSVEEISIYNQDELGVNIRIKVKNNTPIKEDTFATLQLQGITGLKFVQLQGGSKN 119

Query: 121 KKTI 124
            K +
Sbjct: 120 SKDL 123


>gi|220924821|ref|YP_002500123.1| Mammalian cell entry related domain-containing protein
           [Methylobacterium nodulans ORS 2060]
 gi|219949428|gb|ACL59820.1| Mammalian cell entry related domain protein [Methylobacterium
           nodulans ORS 2060]
          Length = 359

 Score =  115 bits (285), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 78/448 (17%), Positives = 150/448 (33%), Gaps = 92/448 (20%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++     +G F ++++   F   YW+   +  +     + I   G V GL+  S V F
Sbjct: 1   METRANNVLIGTFTLAVIAAGFLFAYWMRG-SVSNEGRMPLRIVFSGGVGGLAKGSIVTF 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NGI VG    + L  + P    A   +   TPL   T A +    L G+  I L     +
Sbjct: 60  NGIRVGEATDVQLLPQDPRRVTALVEVERTTPLRADTRARLDMTMLTGVASIALVGGSAD 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
              +   A E  + A I A  S I   + +A   +++  D  + + +++   E  +  T+
Sbjct: 120 APPLK--APEGERMATIFADSSEIQDLMQSARTIAQRADDMLQRLDRVVAGNEGAINRTL 177

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
           AN+E  S  L ++   +D ++                              KA+D +K+ 
Sbjct: 178 ANVEQFSKTLNDSAPALDALV------------------------------KAVDGRKLG 207

Query: 241 QILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAF 300
            +++N    S     ++  +   +HD R+          ++D +L      + S      
Sbjct: 208 SLIDNADRFSAALAAAAPDIAAGLHDARQLAAKLNASADRVDAVLKGAEGFLGS------ 261

Query: 301 LENIADSTSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNIS 360
                          ++  E      +I     +I          S+   +  + I    
Sbjct: 262 ---------------ASGEEGRSTFGEIREAAISIREAGRAFRTMSENLDKRTATI---- 302

Query: 361 ALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVN 420
                                 +    R   +    +QN S  G   +           N
Sbjct: 303 ----------------------TTSFGRLSGAGRREVQNLSTEGQRTL-----------N 329

Query: 421 HFDDCLNNFERNPQDIVWGREKGSVKIY 448
             +    + ER+P  +++G  K ++  Y
Sbjct: 330 SLNSAARSLERDPSQVIFGG-KPTLPEY 356


>gi|220903811|ref|YP_002479123.1| Mammalian cell entry related domain protein [Desulfovibrio
           desulfuricans subsp. desulfuricans str. ATCC 27774]
 gi|219868110|gb|ACL48445.1| Mammalian cell entry related domain protein [Desulfovibrio
           desulfuricans subsp. desulfuricans str. ATCC 27774]
          Length = 150

 Score =  115 bits (285), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 32/134 (23%), Positives = 57/134 (42%), Gaps = 3/134 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M +    T+VGLFV+  L    +    L +         E+      SV GL   + V  
Sbjct: 1   MST-VRETAVGLFVLIGLLCVAYLTIKLGKMEVLSNKGYELTANF-DSVSGLRVGADVEM 58

Query: 61  NGIPVGRIVGLFLDQE-YPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRK 119
           +G+PVG+++ + LD +   N ++ +  +  D  L   + A+I T GL G  Y+ +S    
Sbjct: 59  SGVPVGKVISISLDPDPMRNQAVVRLRLDKDLHLSDDSIASILTSGLIGDKYVSISRGGS 118

Query: 120 EKKTIFQIATERNQ 133
           +       +    +
Sbjct: 119 DHMLAPGDSITETE 132


>gi|86149271|ref|ZP_01067502.1| ABC transporter, periplasmic substrate-binding protein, putative
           [Campylobacter jejuni subsp. jejuni CF93-6]
 gi|88596269|ref|ZP_01099506.1| ABC transporter, periplasmic substrate-binding protein, putative
           [Campylobacter jejuni subsp. jejuni 84-25]
 gi|218563237|ref|YP_002345017.1| putative ABC transporter periplasmic substrate-binding protein
           [Campylobacter jejuni subsp. jejuni NCTC 11168]
 gi|85840053|gb|EAQ57311.1| ABC transporter, periplasmic substrate-binding protein, putative
           [Campylobacter jejuni subsp. jejuni CF93-6]
 gi|88191110|gb|EAQ95082.1| ABC transporter, periplasmic substrate-binding protein, putative
           [Campylobacter jejuni subsp. jejuni 84-25]
 gi|112360944|emb|CAL35745.1| putative ABC transport system periplasmic substrate-binding protein
           [Campylobacter jejuni subsp. jejuni NCTC 11168]
 gi|284926842|gb|ADC29194.1| putative ABC transport system periplasmic substrate-binding protein
           [Campylobacter jejuni subsp. jejuni IA3902]
 gi|315927601|gb|EFV06932.1| mce related family protein [Campylobacter jejuni subsp. jejuni
           DFVF1099]
 gi|315929478|gb|EFV08674.1| mce related family protein [Campylobacter jejuni subsp. jejuni 305]
          Length = 296

 Score =  115 bits (285), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 42/288 (14%), Positives = 104/288 (36%), Gaps = 6/288 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++  Y  VGLFV  + F S   I WL   ++ +       I    SV GL   + VR 
Sbjct: 1   MENRANYFFVGLFVFGVFFASLGFILWLGGYSK-EESFKYYEIHTQESVAGLGIKAPVRL 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G+ VG +  + +  +       +  ++ +TP+   T AT++ QG+ G+ +I+L    K 
Sbjct: 60  LGVEVGSVEEISIYNQDELGVNIRIKVKNNTPIKEDTFATLQLQGITGLKFIQLQGGSKN 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
            K +  +   + +  +I    S +      +E+    +  +    ++++          +
Sbjct: 120 SKDLVSM---QGKLPVIPFKESFLATIDRQSEHIFSLVKTADDKSKELLSEKNLKNLEIL 176

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
              + ++ + AN  ++   +                  +++    +            + 
Sbjct: 177 L--QNLAELSANLNANSKNLSLNLSNASLKIGKMADNISLSAQNFNSSLKNIKESTMILK 234

Query: 241 QILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDF 288
             ++      N +      ++  +   +        + + + +  +D 
Sbjct: 235 NFIKKADEKLNTYDDIKASLMQNLELFKRVLIESNILIENLQNSPADL 282


>gi|148263114|ref|YP_001229820.1| hypothetical protein Gura_1041 [Geobacter uraniireducens Rf4]
 gi|146396614|gb|ABQ25247.1| Mammalian cell entry related domain protein [Geobacter
           uraniireducens Rf4]
          Length = 150

 Score =  115 bits (285), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 31/133 (23%), Positives = 56/133 (42%), Gaps = 1/133 (0%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M+     T VG+FV+  +    +    L +   + G    V      SV GL + +SV  
Sbjct: 1   MKKAGLETIVGIFVLIGILCLAYLSIKLGKMELFGGDYYTVTANF-DSVSGLKSGASVEI 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G+ VGR+  + LD +  + +     IR    ++    A +RT+G+ G  +I+L+    +
Sbjct: 60  AGVEVGRVERIILDPKGNDRAKVYLRIRSGVKMFDDVIAAVRTRGIIGDKFIQLNPGGSD 119

Query: 121 KKTIFQIATERNQ 133
           K           +
Sbjct: 120 KIIANGGRIRETE 132


>gi|268678742|ref|YP_003303173.1| hypothetical protein Sdel_0100 [Sulfurospirillum deleyianum DSM
           6946]
 gi|268616773|gb|ACZ11138.1| Mammalian cell entry related domain protein [Sulfurospirillum
           deleyianum DSM 6946]
          Length = 316

 Score =  115 bits (285), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 47/293 (16%), Positives = 96/293 (32%), Gaps = 2/293 (0%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++  Y  VG FV  +L  S  SI WL R +          +    SV GL+  + V+ 
Sbjct: 1   MENRLSYILVGAFVFVLLIGSVVSIVWLGRYSDEGSFKF-YQVATKESVSGLNEKAPVKL 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           +G+ +G +  + ++ +     L    ++ D P+  ST A I  QG+ G++YI+L      
Sbjct: 60  HGVQIGEVRDININPKNAEEVLVTIRVQEDAPIKESTYAIIEAQGITGLSYIQLQGSINH 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
            K +    T + +  +I + PS  +       + S K        + I+ +        I
Sbjct: 120 SKELKTGDT-KEEYGIIYSRPSTFSRLDKTITSLSTKAEQIFERAENIMSDKNLKNFEAI 178

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
                  +   +      +  +           +          +    +         N
Sbjct: 179 LENSAKVSESTSKTMANLEAQNKEINQLLKESIEAAKGIQAMSHSFTSAIDNTGIDTMDN 238

Query: 241 QILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMK 293
                  V++     +      +        +    + Q ++ L    +    
Sbjct: 239 VREAAKSVNTVMNGLNQKLEKGSFDMDLLVKENLLPLQQTLEELHLVLNETKD 291


>gi|292490601|ref|YP_003526040.1| hypothetical protein Nhal_0467 [Nitrosococcus halophilus Nc4]
 gi|291579196|gb|ADE13653.1| Mammalian cell entry related domain protein [Nitrosococcus
           halophilus Nc4]
          Length = 334

 Score =  114 bits (284), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 52/324 (16%), Positives = 119/324 (36%), Gaps = 4/324 (1%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M++K  Y  VGLF + +       I+WLS +          +  +  SV GL+ +++V++
Sbjct: 1   MDTKVNYILVGLFTILLATALTAIIFWLS-AAPATKNYQTYLAYMRESVAGLNMNAAVKY 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G+ VG++  + LD++ P        I   TP+   T A + + GL GI Y+EL+   ++
Sbjct: 60  RGVDVGQVEAIELDKQNPERVRLTLAIEQGTPIKEDTIAILASNGLTGIAYVELTGGTQD 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
             T+   A +     +I   PS +    +       +++  +  + +I +++   L    
Sbjct: 120 SPTLQ--AEKGQSHPVIQTGPSLLMRLDTALTKLLTELTGVAGDLSRIAQSVNTVLIEQN 177

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
                 +      +S +   +   Q    +               +         ++ + 
Sbjct: 178 QQALAETLRNTERLSKVLADLAANQENQQALRKTLHNTEHLTARLAGHGSQLETAVEDLV 237

Query: 241 QILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAF 300
            ILE    +S       +Q   ++  + +T +  + + +  +       ++         
Sbjct: 238 TILEAGAKASKQLPILVEQASRSLRPIEKTAEGLETLLRDGEQGF-RLFTQSTLPRIDQL 296

Query: 301 LENIADSTSNMRSSISAIREITDQ 324
           L +    T N+      + +    
Sbjct: 297 LNDFDRVTRNLERFSQQVEQNPRT 320



 Score = 55.7 bits (131), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 23/196 (11%), Positives = 64/196 (32%), Gaps = 1/196 (0%)

Query: 245 NIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAFLENI 304
                         ++   +  +            +I   ++    +   +  +  L N 
Sbjct: 129 QSHPVIQTGPSLLMRLDTALTKLLTELTGVAGDLSRIAQSVNTVLIEQNQQALAETLRNT 188

Query: 305 ADSTSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKIN-NISALK 363
              +  +    +        R+ + +T +    +  + +       +L++ +     A K
Sbjct: 189 ERLSKVLADLAANQENQQALRKTLHNTEHLTARLAGHGSQLETAVEDLVTILEAGAKASK 248

Query: 364 ENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFD 423
           +   L + A R++     T+E +   +       + F+QS L  I  L+        + +
Sbjct: 249 QLPILVEQASRSLRPIEKTAEGLETLLRDGEQGFRLFTQSTLPRIDQLLNDFDRVTRNLE 308

Query: 424 DCLNNFERNPQDIVWG 439
                 E+NP+ +++G
Sbjct: 309 RFSQQVEQNPRTLLFG 324


>gi|82702737|ref|YP_412303.1| hypothetical protein Nmul_A1610 [Nitrosospira multiformis ATCC
           25196]
 gi|82410802|gb|ABB74911.1| Mammalian cell entry related protein [Nitrosospira multiformis ATCC
           25196]
          Length = 313

 Score =  114 bits (284), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 47/288 (16%), Positives = 105/288 (36%), Gaps = 1/288 (0%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME + ++  +G F V  +  +     WLS++           +    +V GLS  S V++
Sbjct: 1   MEPRAHHVLIGFFTVMTVTAALLFTLWLSKAPGDSVQRY-YTVVFNEAVRGLSIGSPVQY 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           +GI VG +V L LD + P + +A+  ++  TP+   T A +   G+ G + IE S    +
Sbjct: 60  SGITVGDVVNLALDPQDPRNVIARVRVQGSTPIKEDTQARLALTGITGNSVIEFSGGSPD 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
              +      ++   + T +P       S+                   EN ++   T  
Sbjct: 120 SPDLVAKDDHKDPVIVATPSPIAKLLEHSDNMMADVTQLVMRAKEILSQENAKRLSRTLE 179

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
              +T + + + N S    +      +  ++ +      +     +L        L  ++
Sbjct: 180 NLEQTTAVIASQNDSVRGIVGELATASAQANSALREATQLMAATNTLVSEKGVPTLGNLD 239

Query: 241 QILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDF 288
           +   ++   S +  +   +    +    +         Q++ + +S  
Sbjct: 240 RATASLAKVSASVDQLLLENRAALSGGMQGMNELGPALQELRNTMSAL 287



 Score = 65.7 bits (157), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 30/254 (11%), Positives = 88/254 (34%), Gaps = 4/254 (1%)

Query: 197 IDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVNQILENIQVSSNNFVKS 256
           +  +++         +               D   +          +      S +    
Sbjct: 64  VGDVVNLALDPQDPRNVIARVRVQGSTPIKEDTQARLALTGITGNSVIEFSGGSPDSPDL 123

Query: 257 SDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNMRSSIS 316
             +  +    +  T     ++ +  D++++D +  +   +     EN    +  + +   
Sbjct: 124 VAKDDHKDPVIVATPSPIAKLLEHSDNMMADVTQLVMRAKEILSQENAKRLSRTLENLEQ 183

Query: 317 AIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNISALKENNSLFKDAQRAM 376
               I  Q   +   +  +   ++  N + ++  +LM+  N + + K   +L  +  RA 
Sbjct: 184 TTAVIASQNDSVRGIVGELATASAQANSALREATQLMAATNTLVSEKGVPTL-GNLDRAT 242

Query: 377 HTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFERNPQDI 436
            +    S  +++ +      L      G+N++   +++L+ T++     +   + NP   
Sbjct: 243 ASLAKVSASVDQLLLENRAALSG-GMQGMNELGPALQELRNTMSALARTVRRLDENPAAY 301

Query: 437 VWGREKGSVKIYKP 450
           + GREK  ++  +P
Sbjct: 302 LTGREK--IEELEP 313


>gi|298530714|ref|ZP_07018116.1| Mammalian cell entry related domain protein [Desulfonatronospira
           thiodismutans ASO3-1]
 gi|298510088|gb|EFI33992.1| Mammalian cell entry related domain protein [Desulfonatronospira
           thiodismutans ASO3-1]
          Length = 505

 Score =  114 bits (284), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 51/373 (13%), Positives = 121/373 (32%), Gaps = 8/373 (2%)

Query: 2   ESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRFN 61
           ++ +    VG+FV+  +    +    L+R         E+      +V GL T+S V   
Sbjct: 3   KTASVEIKVGIFVLIAIVLLGYLTTVLTRDRIITRDTYEIHAYF-DNVTGLRTNSPVEIA 61

Query: 62  GIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKEK 121
           GI VG +  + L +     +     IRPD  ++  + ATIRT+G+ G  ++E++     +
Sbjct: 62  GIDVGTVKDITLHEN---RARVTMAIRPDIDVHADSQATIRTRGVLGDKFVEVNPGSATE 118

Query: 122 KTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTIA 181
            T+                           + +    S S+       E   +     + 
Sbjct: 119 PTLEDGGVVSRGVQPTDLDQVMARIGDIADDISEVSRSVSNVFGGPEGEQDMREFFDNLR 178

Query: 182 ----NIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQ 237
               ++  I    A  I  I   +        +    N       +        +     
Sbjct: 179 EAAVHMNQIVQTNARGIEKIVANLQDFSGDLKTISETNKEGITHIVDNFSQASSQLNVSL 238

Query: 238 KVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKET 297
           +    + +        V +  +      D+R T  + + + +K+D         +   +T
Sbjct: 239 EQLGEIMDTAQHGEGPVATLLEDRQMSEDMRRTAASLESLTRKLDEGEGTLGKLISEDDT 298

Query: 298 SAFLENIADSTSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKIN 357
              +++  D  +         + + D R + +++   +++        ++    ++S I+
Sbjct: 299 GRKIDDALDGINEFLDRYDRFQTVVDFRSEYMASTGDMKSYLDLTLQPAEDRFYMLSLID 358

Query: 358 NISALKENNSLFK 370
           +           +
Sbjct: 359 DPKGRTRTTETVE 371


>gi|114320359|ref|YP_742042.1| hypothetical protein Mlg_1203 [Alkalilimnicola ehrlichii MLHE-1]
 gi|114226753|gb|ABI56552.1| Mammalian cell entry related domain protein [Alkalilimnicola
           ehrlichii MLHE-1]
          Length = 310

 Score =  114 bits (284), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 52/297 (17%), Positives = 107/297 (36%), Gaps = 5/297 (1%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++  Y  VGLFV+ +      +  +L    +   P  +  + +  SV GL+  + VR+
Sbjct: 1   METRVSYALVGLFVILLTLAIIGAGLYLGGDIRT-QPHTDYAVYMDESVAGLNVSAPVRY 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G+ VGR+  + L+  +P+       +    P+   T AT+R+QGL GI++IELS     
Sbjct: 60  RGVDVGRVQAITLNPRHPDEVRIVISVEERVPIGRETVATLRSQGLTGISFIELSG--ST 117

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRH-IQKIIENIEKPLTTT 179
              +       +    +   PS  +      +     +   +      + E   + +   
Sbjct: 118 TDPVTPQPRAGDDLPALRTVPSFGSRLEQTVDEALGVMRVVADEVRDLLREENRERVARL 177

Query: 180 IANIETISTVLANNISHIDKMMHTTQVTPHS-SDSKNTFNTITDLITSLDKMIKAIDLQK 238
           + N   +   LA     +D+ M          +++        D +         +    
Sbjct: 178 LQNANVLVANLAEGSEDLDQTMVRFNQLLDQGNEAAARLPESMDRLDDTLARWARLADDL 237

Query: 239 VNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSK 295
                    ++S       D     + ++       + + Q ++  L DFS + +  
Sbjct: 238 GRTGDTLDALASRGETTLIDVNQTLIPELGTLMYEMRRLSQDLERTLEDFSDEPQML 294



 Score = 56.5 bits (133), Expect = 9e-06,   Method: Composition-based stats.
 Identities = 21/174 (12%), Positives = 61/174 (35%), Gaps = 9/174 (5%)

Query: 268 RETTQTFQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNMRSSISAIREITDQRQK 327
           R        + Q +D  L                EN       ++++   +  + +  + 
Sbjct: 135 RTVPSFGSRLEQTVDEALGVMRVVADEVRDLLREENRERVARLLQNANVLVANLAEGSED 194

Query: 328 IISTINTIENITSNLNDSSQKFAELMSKINNISALKENNSLFKDAQRAMHTFRDTSEKIN 387
           +  T+     +    N+++ +  E M ++++               R       T + ++
Sbjct: 195 LDQTMVRFNQLLDQGNEAAARLPESMDRLDD---------TLARWARLADDLGRTGDTLD 245

Query: 388 RYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFERNPQDIVWGRE 441
                    L + +Q+ + ++  L+ +++      +  L +F   PQ +++GR+
Sbjct: 246 ALASRGETTLIDVNQTLIPELGTLMYEMRRLSQDLERTLEDFSDEPQMLIYGRQ 299


>gi|197105493|ref|YP_002130870.1| ABC transporter, periplasmic substrate-binding protein
           [Phenylobacterium zucineum HLK1]
 gi|196478913|gb|ACG78441.1| ABC transporter, periplasmic substrate-binding protein
           [Phenylobacterium zucineum HLK1]
          Length = 323

 Score =  114 bits (283), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 40/134 (29%), Positives = 65/134 (48%), Gaps = 1/134 (0%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME    Y  VGL  + ++      I WL+R  Q+        I   G V GLS    V+F
Sbjct: 1   MEKNANYALVGLSTLILVAALAIFIVWLARF-QFAQANDTYDILFQGPVRGLSEGGEVQF 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NGI VG +  + LD+  P+  +A+  +  D P+   + AT+  QG+ G+ YI+++     
Sbjct: 60  NGIKVGEVTKIALDRTNPSRVIARVQVTSDVPIRVDSYATLEPQGITGVNYIQITAGTPS 119

Query: 121 KKTIFQIATERNQR 134
           +  +   A +R +R
Sbjct: 120 RPLLKDEAQKRCER 133


>gi|238784664|ref|ZP_04628669.1| hypothetical protein yberc0001_28080 [Yersinia bercovieri ATCC
           43970]
 gi|238714436|gb|EEQ06443.1| hypothetical protein yberc0001_28080 [Yersinia bercovieri ATCC
           43970]
          Length = 313

 Score =  114 bits (283), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 53/293 (18%), Positives = 122/293 (41%), Gaps = 6/293 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++ ++  +GLF + ++  +     WL+ +   +       I     V GLS  S+V++
Sbjct: 1   METRAHHVVIGLFTLIVVSAALLFCLWLTNAGA-NRQFKLYDIVFNEPVSGLSQGSTVQY 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           +GI VG ++ L LD E PN   A+  +   TP+   T A +   G+ G + I+ S+  + 
Sbjct: 60  SGIRVGEVIQLRLDSENPNKVWARIRVSASTPIRQDTQARLTVAGITGTSNIQFSSSNQS 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPL-TTT 179
              +        +  +I ATPS ++  ++N EN     ++    + +++E   +     T
Sbjct: 120 SPLLEGQ---DGEIPIIIATPSPMSQLLANGENFMSNANEVLVRLNQLLEPDNQQRLIRT 176

Query: 180 IANIETISTVLANNISHIDKMMHTTQV-TPHSSDSKNTFNTITDLITSLDKMIKAIDLQK 238
           + N+  I+  +A+    I  M+      +  ++++    N +      L        +  
Sbjct: 177 LDNLALITQTVADQRGDIRTMLQQLAQASKQANETLAQTNRLLRNANGLMDGQGKQLVSD 236

Query: 239 VNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSK 291
             + + ++Q +S    +   +   ++ +  +          ++   L+   + 
Sbjct: 237 AAKTMASLQKTSTILNQLVSENKTSLSNGMQGMSELGPAVDELRRTLATLRAA 289



 Score = 76.1 bits (184), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 30/183 (16%), Positives = 75/183 (40%), Gaps = 4/183 (2%)

Query: 269 ETTQTFQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNMRSSISAIREITDQRQKI 328
            T     ++    ++ +S+ +  +         +N       + +     + + DQR  I
Sbjct: 135 ATPSPMSQLLANGENFMSNANEVLVRLNQLLEPDNQQRLIRTLDNLALITQTVADQRGDI 194

Query: 329 ISTINTIENITSNLNDSSQKFAELMSKINNISALKENNSLFKDAQRAMHTFRDTSEKINR 388
            + +  +   +   N++  +   L+   N +    +   L  DA + M + + TS  +N+
Sbjct: 195 RTMLQQLAQASKQANETLAQTNRLLRNANGLM-DGQGKQLVSDAAKTMASLQKTSTILNQ 253

Query: 389 YIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFERNPQDIVWGREKGSVKIY 448
            +     +L N    G++++   V +L+ T+      ++  E NP  ++ GRE+   + +
Sbjct: 254 LVSENKTSLSN-GMQGMSELGPAVDELRRTLATLRAAVSRLEENPAALLRGRERT--QEF 310

Query: 449 KPK 451
            P+
Sbjct: 311 TPR 313


>gi|195953213|ref|YP_002121503.1| virulence factor Mce family protein [Hydrogenobaculum sp. Y04AAS1]
 gi|195932825|gb|ACG57525.1| virulence factor Mce family protein [Hydrogenobaculum sp. Y04AAS1]
          Length = 523

 Score =  113 bits (282), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 74/456 (16%), Positives = 156/456 (34%), Gaps = 56/456 (12%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M+SK  Y  +GLF++       F     S    +          +  +V GLS  + VR 
Sbjct: 1   MKSK--YFKLGLFLLLSAIAFAFMAISFSSIRYFFEKSNTYEALL-DNVHGLSVGAEVRV 57

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NG+  GR+  +          L    ++ D P+Y     +I T GL G  Y+ +      
Sbjct: 58  NGVKAGRVEKISF---RNGKVLVVFSVKKDIPIYKDAEVSIGTLGLMGDKYVSVEEGHSI 114

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
              +   +   N   + + T S I    + A+N S   S+ +  I +  + I+  +    
Sbjct: 115 YGELPPNSMIEN-IGVSSDTESLIKNLNNTAKNFSVVASNLASIISQNRDQIQGIIQNLD 173

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
           +  + ++T++A N   + + +    +                           +  Q   
Sbjct: 174 SLTKNLNTMVAQNQDALRQTISNLDM---------------------------LTYQLNL 206

Query: 241 QILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAF 300
            + + I          +        D+R   +  + +   +              +T   
Sbjct: 207 TLPQTIADIDRTAKNLAQITGQNKEDIRTLVENLKVLSSTLKD------------QTPVL 254

Query: 301 LENIADSTSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKIN--- 357
           + N+   + N+ + +   +           +I     ++ +L  SS +  ++++KIN   
Sbjct: 255 MANLNTLSQNLNNLVVENQNGVHT------SIKNFAELSKSLKQSSDELNQILAKINTGQ 308

Query: 358 -NISALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQ 416
             +  L  + SL+ +A  A+ TF    + +NR    IG   + F       I +L  +  
Sbjct: 309 GTLGKLVNDKSLYANANDALSTFSHFGKIVNRSNLYIGGRFELFRAGQSKGILSLKFQPN 368

Query: 417 ETVNHFDDCLNNFERNPQDIVWGREKGSVKIYKPKH 452
               +  + + N               ++  YKP++
Sbjct: 369 NHEYYLFEIVGNSMGRVTTQYINNNPQTIYEYKPEY 404


>gi|15837902|ref|NP_298590.1| hypothetical protein XF1301 [Xylella fastidiosa 9a5c]
 gi|9106292|gb|AAF84110.1|AE003963_7 conserved hypothetical protein [Xylella fastidiosa 9a5c]
          Length = 308

 Score =  113 bits (282), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 49/309 (15%), Positives = 98/309 (31%), Gaps = 3/309 (0%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K  Y  +G F +           W ++ +  D       +    +V GLS  S V++
Sbjct: 1   METKANYVLIGSFTILTGLALLIFGLWAAKYSS-DRTWQNYRVVFREAVTGLSVGSPVQY 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NGI +G I  L L    P   +A   +   TP+   T A +    L G + I+LS    E
Sbjct: 60  NGIAIGSITQLTLAPNDPRQVIAHIRVNSTTPVKKDTRAKLAITSLTGPSIIQLSGGTPE 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
             ++   +  ++   +I  TPS +      A +  +++ D          +        I
Sbjct: 120 SPSL--TSIYKDDAPIIQTTPSALQNITDTANDIVERLYDVLSDKNVAAISTILQNMQKI 177

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
           +   + S      +               ++ +        +L+  L  ++  ++     
Sbjct: 178 SGQVSDSDTGLKALLTSAHDATRQLNAALATTNGTVQQLDNNLVKQLPVILNKLEATLTK 237

Query: 241 QILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAF 300
                   +S      +         + +   T  E+   I  L    +    + +    
Sbjct: 238 IDATASNANSILDNNQAAINSFASEGLSQFAPTMSELRNLIRDLRQISNKLEDNPKRYLL 297

Query: 301 LENIADSTS 309
             N      
Sbjct: 298 GRNAPKEFD 306



 Score = 80.0 bits (194), Expect = 7e-13,   Method: Composition-based stats.
 Identities = 24/200 (12%), Positives = 74/200 (37%), Gaps = 3/200 (1%)

Query: 252 NFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNM 311
                + +  +     ++     Q     + ++    +  ++        +N+A  ++ +
Sbjct: 112 QLSGGTPESPSLTSIYKDDAPIIQTTPSALQNITDTANDIVERLYDVLSDKNVAAISTIL 171

Query: 312 RSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNISALKENNSLFKD 371
           ++      +++D    + + + +  + T  LN +       + +++N   +K+   +   
Sbjct: 172 QNMQKISGQVSDSDTGLKALLTSAHDATRQLNAALATTNGTVQQLDNNL-VKQLPVILNK 230

Query: 372 AQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFER 431
            +  +     T+   N  + +    + +F+  GL+     + +L+  +       N  E 
Sbjct: 231 LEATLTKIDATASNANSILDNNQAAINSFASEGLSQFAPTMSELRNLIRDLRQISNKLED 290

Query: 432 NPQDIVWGREKGSVKIYKPK 451
           NP+  + GR     K + PK
Sbjct: 291 NPKRYLLGRNAP--KEFDPK 308


>gi|299131821|ref|ZP_07025016.1| Mammalian cell entry related domain protein [Afipia sp. 1NLS2]
 gi|298591958|gb|EFI52158.1| Mammalian cell entry related domain protein [Afipia sp. 1NLS2]
          Length = 289

 Score =  113 bits (282), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 40/201 (19%), Positives = 79/201 (39%), Gaps = 6/201 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++  Y  +G F ++++  +F  ++W             + I   G+  GL T  +V F
Sbjct: 1   METRANYLLIGAFTLAVIAAAFGFVFWFQNLGSVAQRS-PIRIVFEGAASGLRTGGNVNF 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NGI +G +  + LD   P   +  A +    P+   T   +   GL G++ + L      
Sbjct: 60  NGIKIGEVTSIKLD--DPKRVVVIASVDKSAPIRADTLVGLEFAGLTGVSAVSLKGGS-- 115

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
                 I    +    +TA P+ I         T + ++      Q  + +  + L T  
Sbjct: 116 -LEAGGIPVADDGVPTLTADPNAIMDIGEAVRATLQNVNKLVTDNQAALHDSMENLKTFS 174

Query: 181 ANIETISTVLANNISHIDKMM 201
             +   S+ + + +  +D +M
Sbjct: 175 KALADNSSRIDSIMVGVDSLM 195



 Score = 59.6 bits (141), Expect = 9e-07,   Method: Composition-based stats.
 Identities = 21/128 (16%), Positives = 61/128 (47%), Gaps = 13/128 (10%)

Query: 312 RSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNISALKENNSLFKD 371
            +  +  + +TD +  +  ++  ++  +  L D+S +   +M  ++++   K+      +
Sbjct: 147 ATLQNVNKLVTDNQAALHDSMENLKTFSKALADNSSRIDSIMVGVDSLMGGKDGEG--GE 204

Query: 372 AQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFER 431
            Q+A  +FR+ ++ +++   ++            +D + L+   + T+      +NNF+R
Sbjct: 205 LQKAARSFRELADNLDKRTAALT-----------SDGRALISDSRRTLGDISRAVNNFDR 253

Query: 432 NPQDIVWG 439
           NP  +++G
Sbjct: 254 NPTRVLFG 261


>gi|46203119|ref|ZP_00052045.2| COG1463: ABC-type transport system involved in resistance to
          organic solvents, periplasmic component
          [Magnetospirillum magnetotacticum MS-1]
          Length = 144

 Score =  113 bits (282), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 30/97 (30%), Positives = 48/97 (49%), Gaps = 1/97 (1%)

Query: 1  MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
          ME++  Y  +G F +  +  +F  ++WL   ++       + I   GSV GL+  S+V F
Sbjct: 1  METRANYALIGAFTIGAVIAAFGFVFWLQGGSR-GQATQALRIVFSGSVGGLAKGSTVSF 59

Query: 61 NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPST 97
          NGI VG  + + L  + P   +A   + P TPL   T
Sbjct: 60 NGIKVGEALDVRLLPQDPRRVVAVVQVDPSTPLRADT 96


>gi|299132340|ref|ZP_07025535.1| protein of unknown function DUF330 [Afipia sp. 1NLS2]
 gi|298592477|gb|EFI52677.1| protein of unknown function DUF330 [Afipia sp. 1NLS2]
          Length = 370

 Score =  113 bits (282), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 38/108 (35%), Positives = 51/108 (47%), Gaps = 1/108 (0%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++  Y  VGLFV+SI    F  +YWL+ +           +R    V GL   + V F
Sbjct: 1   METRAPYIIVGLFVLSIAAAIFGFVYWLNNAGGLGARSV-YQVRFDEPVPGLLVGAGVLF 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAG 108
           NGI VG +  L LD + P    A   +  DTP+   T   +  QGL G
Sbjct: 60  NGIRVGEVTRLALDPQSPRRVNASVSVLTDTPVRADTKVGLEFQGLTG 107


>gi|238764191|ref|ZP_04625144.1| hypothetical protein ykris0001_6570 [Yersinia kristensenii ATCC
           33638]
 gi|238697604|gb|EEP90368.1| hypothetical protein ykris0001_6570 [Yersinia kristensenii ATCC
           33638]
          Length = 313

 Score =  113 bits (282), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 51/293 (17%), Positives = 120/293 (40%), Gaps = 6/293 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++ ++  +GLF + ++  +     WL+ +   +       I     V GLS  S+V++
Sbjct: 1   METRAHHVVIGLFTLIVVSAALLFCLWLTNAGS-NRQFKLYDIVFNEPVSGLSQGSTVQY 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           +GI VG ++ L LD E PN   A+  +   TP+   T A +   G+ G +          
Sbjct: 60  SGIRVGEVIQLRLDSEDPNKVWARIRVSASTPIREDTQARLTVAGITGTS---NIQFSSS 116

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPL-TTT 179
             +   +  +  +  +I ATPS ++  ++N EN     ++    + +++    +    TT
Sbjct: 117 TPSSPLLEGKDGEIPIIIATPSPMSQLLANGENFMSNANEVLMRLNQLLAPDNQQRLITT 176

Query: 180 IANIETISTVLANNISHIDKMMHTTQV-TPHSSDSKNTFNTITDLITSLDKMIKAIDLQK 238
           + N+  ++  +A+    I  M+      +  ++++    N +      L        +  
Sbjct: 177 LDNLALVTQTVADQRQDIRTMLQQLAQASKQANETLAQTNRLLRSANGLMDGQGKQLVND 236

Query: 239 VNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSK 291
             + + ++Q +S    K   +   ++++  +          ++   L+   + 
Sbjct: 237 AAKTMASLQNTSIILNKLVSENQTSLNNGMQGMNELGPAVDELRRTLATLRAA 289



 Score = 74.2 bits (179), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 32/183 (17%), Positives = 78/183 (42%), Gaps = 4/183 (2%)

Query: 269 ETTQTFQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNMRSSISAIREITDQRQKI 328
            T     ++    ++ +S+ +  +         +N     + + +     + + DQRQ I
Sbjct: 135 ATPSPMSQLLANGENFMSNANEVLMRLNQLLAPDNQQRLITTLDNLALVTQTVADQRQDI 194

Query: 329 ISTINTIENITSNLNDSSQKFAELMSKINNISALKENNSLFKDAQRAMHTFRDTSEKINR 388
            + +  +   +   N++  +   L+   N +    +   L  DA + M + ++TS  +N+
Sbjct: 195 RTMLQQLAQASKQANETLAQTNRLLRSANGLM-DGQGKQLVNDAAKTMASLQNTSIILNK 253

Query: 389 YIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFERNPQDIVWGREKGSVKIY 448
            +     +L N    G+N++   V +L+ T+      ++  E NP  ++ GRE+   + +
Sbjct: 254 LVSENQTSLNN-GMQGMNELGPAVDELRRTLATLRAAVSRLEENPAALLRGRERT--QEF 310

Query: 449 KPK 451
            P+
Sbjct: 311 TPR 313


>gi|28198462|ref|NP_778776.1| ABC transporter permease [Xylella fastidiosa Temecula1]
 gi|182681135|ref|YP_001829295.1| hypothetical protein XfasM23_0577 [Xylella fastidiosa M23]
 gi|28056546|gb|AAO28425.1| ABC transporter permease [Xylella fastidiosa Temecula1]
 gi|182631245|gb|ACB92021.1| Mammalian cell entry related domain protein [Xylella fastidiosa
           M23]
 gi|307579583|gb|ADN63552.1| hypothetical protein XFLM_08240 [Xylella fastidiosa subsp.
           fastidiosa GB514]
          Length = 308

 Score =  113 bits (281), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 49/309 (15%), Positives = 100/309 (32%), Gaps = 3/309 (0%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K  Y  +G F +           W ++ +  D       +    +V GLS  S V++
Sbjct: 1   METKANYVLIGSFTILTGLALLIFGLWAAKYSS-DRTWQNYRVVFREAVTGLSVGSPVQY 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NGI +G I  L L    P   +A   +   TP+   T A +    L G + I+LS    E
Sbjct: 60  NGIAIGSITQLTLAPNDPRQVVAHIRVNSTTPVKKDTRAKLAITSLTGPSIIQLSGGTPE 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
             ++   +  ++   +I  TPS +      A +  +++ D          +        I
Sbjct: 120 SPSL--TSIYKDDAPIIQTTPSALQNITDTANDIVERLYDVLSDKNVAAISTILQNMQKI 177

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
           +   + S      +    +       T  ++ +        +L+  L  ++  ++     
Sbjct: 178 SGQVSDSDTGLEALLTSARDATRQLNTTLTTANGTVQQLDNNLVKQLPIILNKLEATLTK 237

Query: 241 QILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAF 300
                   +S      +         + +   T  E+   I  L    +    + +    
Sbjct: 238 IDATASNANSILDNNQAAINSFANEGLSQFAPTMSELSNLIRDLRQISNKLEGNPKRYLL 297

Query: 301 LENIADSTS 309
             +      
Sbjct: 298 GRDAPKEFD 306



 Score = 77.7 bits (188), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 24/200 (12%), Positives = 74/200 (37%), Gaps = 3/200 (1%)

Query: 252 NFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNM 311
                + +  +     ++     Q     + ++    +  ++        +N+A  ++ +
Sbjct: 112 QLSGGTPESPSLTSIYKDDAPIIQTTPSALQNITDTANDIVERLYDVLSDKNVAAISTIL 171

Query: 312 RSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNISALKENNSLFKD 371
           ++      +++D    + + + +  + T  LN +       + +++N   +K+   +   
Sbjct: 172 QNMQKISGQVSDSDTGLEALLTSARDATRQLNTTLTTANGTVQQLDNNL-VKQLPIILNK 230

Query: 372 AQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFER 431
            +  +     T+   N  + +    + +F+  GL+     + +L   +       N  E 
Sbjct: 231 LEATLTKIDATASNANSILDNNQAAINSFANEGLSQFAPTMSELSNLIRDLRQISNKLEG 290

Query: 432 NPQDIVWGREKGSVKIYKPK 451
           NP+  + GR+    K + PK
Sbjct: 291 NPKRYLLGRDAP--KEFDPK 308


>gi|71274909|ref|ZP_00651197.1| Mce4/Rv3499c/MTV023.06c protein [Xylella fastidiosa Dixon]
 gi|71898797|ref|ZP_00680965.1| Mce4/Rv3499c/MTV023.06c protein [Xylella fastidiosa Ann-1]
 gi|71901851|ref|ZP_00683914.1| Mce4/Rv3499c/MTV023.06c protein [Xylella fastidiosa Ann-1]
 gi|170729827|ref|YP_001775260.1| ABC transporter permease [Xylella fastidiosa M12]
 gi|71164641|gb|EAO14355.1| Mce4/Rv3499c/MTV023.06c protein [Xylella fastidiosa Dixon]
 gi|71728379|gb|EAO30547.1| Mce4/Rv3499c/MTV023.06c protein [Xylella fastidiosa Ann-1]
 gi|71731383|gb|EAO33446.1| Mce4/Rv3499c/MTV023.06c protein [Xylella fastidiosa Ann-1]
 gi|167964620|gb|ACA11630.1| ABC transporter permease [Xylella fastidiosa M12]
          Length = 308

 Score =  113 bits (281), Expect = 7e-23,   Method: Composition-based stats.
 Identities = 49/309 (15%), Positives = 100/309 (32%), Gaps = 3/309 (0%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K  Y  +G F +           W ++ +  D       +    +V GLS  S V++
Sbjct: 1   METKANYVLIGSFTILTGLALLIFGLWAAKYSS-DRTWQNYRVVFREAVTGLSVGSPVQY 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NGI +G I  L L    P   +A   +   TP+   T A +    L G + I+LS    E
Sbjct: 60  NGIAIGSITQLTLAPNDPRQVVAHIRVNSTTPVKKDTRAKLAITSLTGPSIIQLSGGTPE 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
             ++   +  ++   +I  TPS +      A +  +++ D          +        I
Sbjct: 120 SPSL--TSIYKDDAPIIQTTPSALQNITDTANDIVERLYDVLSDKNVAAISTILQNMQKI 177

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
           +   + S      +    +       T  ++ +        +L+  L  ++  ++     
Sbjct: 178 SGQVSDSDTGLEALLTSARDATRQLNTTLTTANGTVQQLDNNLVKQLPVILNKLEATLTK 237

Query: 241 QILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAF 300
                   +S      +         + +   T  E+   I  L    +    + +    
Sbjct: 238 IDATASNANSILDNNQAAINSFANEGLSQFAPTMSELRNLIRDLRQISNKLEGNPKRYLL 297

Query: 301 LENIADSTS 309
             +      
Sbjct: 298 GRDAPKEFD 306



 Score = 78.8 bits (191), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 24/200 (12%), Positives = 75/200 (37%), Gaps = 3/200 (1%)

Query: 252 NFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNM 311
                + +  +     ++     Q     + ++    +  ++        +N+A  ++ +
Sbjct: 112 QLSGGTPESPSLTSIYKDDAPIIQTTPSALQNITDTANDIVERLYDVLSDKNVAAISTIL 171

Query: 312 RSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNISALKENNSLFKD 371
           ++      +++D    + + + +  + T  LN +       + +++N   +K+   +   
Sbjct: 172 QNMQKISGQVSDSDTGLEALLTSARDATRQLNTTLTTANGTVQQLDNNL-VKQLPVILNK 230

Query: 372 AQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFER 431
            +  +     T+   N  + +    + +F+  GL+     + +L+  +       N  E 
Sbjct: 231 LEATLTKIDATASNANSILDNNQAAINSFANEGLSQFAPTMSELRNLIRDLRQISNKLEG 290

Query: 432 NPQDIVWGREKGSVKIYKPK 451
           NP+  + GR+    K + PK
Sbjct: 291 NPKRYLLGRDAP--KEFDPK 308


>gi|123441586|ref|YP_001005572.1| hypothetical protein YE1249 [Yersinia enterocolitica subsp.
           enterocolitica 8081]
 gi|332162488|ref|YP_004299065.1| hypothetical protein YE105_C2866 [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|122088547|emb|CAL11341.1| putative exported protein [Yersinia enterocolitica subsp.
           enterocolitica 8081]
 gi|318606568|emb|CBY28066.1| ABC-type transport system involved in resistance to organic
           solvents, periplasmic component USSDB6C [Yersinia
           enterocolitica subsp. palearctica Y11]
 gi|325666718|gb|ADZ43362.1| hypothetical protein YE105_C2866 [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|330861184|emb|CBX71441.1| hypothetical protein YEW_CA08660 [Yersinia enterocolitica W22703]
          Length = 313

 Score =  113 bits (280), Expect = 8e-23,   Method: Composition-based stats.
 Identities = 51/293 (17%), Positives = 118/293 (40%), Gaps = 6/293 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++ ++  +GLF + ++  +     WL+ +   +       I     V GLS  S V++
Sbjct: 1   METRAHHVVIGLFTLIVVSAALLFCLWLTNAGS-NRQFKLYDIVFNEPVSGLSQGSIVQY 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           +GI VG +  L LD E PN   A+  +   TP+   T A +   G+ G +          
Sbjct: 60  SGIRVGEVTQLRLDSENPNKVWARIRVSASTPIRQDTQARLTVAGITGTS---NIQFSSS 116

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPL-TTT 179
             +   +  +  +  +I ATPS ++  ++N EN     ++    + +++    +    TT
Sbjct: 117 TPSSPLLEGKDGEIPIIIATPSPMSQLLANGENFMSNANEVLMRLNQLLAPDNQQRLITT 176

Query: 180 IANIETISTVLANNISHIDKMMHTTQV-TPHSSDSKNTFNTITDLITSLDKMIKAIDLQK 238
           + N+  ++  +A+    I  M+      +  ++++    N +      L        +  
Sbjct: 177 LDNLALVTQTVADQRQDIRTMLQQLAQASKQANETLAQTNRLLRNANGLMDGQGKQLVND 236

Query: 239 VNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSK 291
             + + ++Q +S    K   +   ++++  +          ++   L+   + 
Sbjct: 237 AAKTMASLQNTSIILNKLVSENQTSLNNGMQGMNELGPAVDELRRTLATLRAA 289



 Score = 74.2 bits (179), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 32/183 (17%), Positives = 78/183 (42%), Gaps = 4/183 (2%)

Query: 269 ETTQTFQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNMRSSISAIREITDQRQKI 328
            T     ++    ++ +S+ +  +         +N     + + +     + + DQRQ I
Sbjct: 135 ATPSPMSQLLANGENFMSNANEVLMRLNQLLAPDNQQRLITTLDNLALVTQTVADQRQDI 194

Query: 329 ISTINTIENITSNLNDSSQKFAELMSKINNISALKENNSLFKDAQRAMHTFRDTSEKINR 388
            + +  +   +   N++  +   L+   N +    +   L  DA + M + ++TS  +N+
Sbjct: 195 RTMLQQLAQASKQANETLAQTNRLLRNANGLM-DGQGKQLVNDAAKTMASLQNTSIILNK 253

Query: 389 YIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFERNPQDIVWGREKGSVKIY 448
            +     +L N    G+N++   V +L+ T+      ++  E NP  ++ GRE+   + +
Sbjct: 254 LVSENQTSLNN-GMQGMNELGPAVDELRRTLATLRAAVSRLEENPAALLRGRERT--QEF 310

Query: 449 KPK 451
            P+
Sbjct: 311 TPR 313


>gi|167647528|ref|YP_001685191.1| hypothetical protein Caul_3566 [Caulobacter sp. K31]
 gi|167349958|gb|ABZ72693.1| Mammalian cell entry related domain protein [Caulobacter sp. K31]
          Length = 312

 Score =  113 bits (280), Expect = 8e-23,   Method: Composition-based stats.
 Identities = 47/310 (15%), Positives = 111/310 (35%), Gaps = 6/310 (1%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME    Y  VG   + +         WL++ + ++       +   G V GLS    V F
Sbjct: 1   MERNANYALVGAMTLVLFMGLLVFAVWLAKLS-FNQEYDLYDVLFVGPVRGLSDGGEVHF 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NGI VG +  + LD+  PN  +A+  +  D P+   + AT+  QG+ G+ Y++++     
Sbjct: 60  NGIKVGEVTKIALDKSDPNRVIARVRVTSDVPIKTDSYATLEPQGITGVNYVQITAGAPA 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
           K  +     +     + +   +  +         ++ I    R  + + ++  K ++  I
Sbjct: 120 KPLLKSTVKKDQVPVIRSQRSALSDLLEGGGTVLTRTIEALDRVNRVLSDDNVKTVSAAI 179

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNT-----ITDLITSLDKMIKAID 235
           +++++++  L      I       Q    +S      +      +        K +    
Sbjct: 180 SDVQSVTAELRERKEIIADAQKALQSIEATSTRIGELSDSANGLVNGDAKRTLKNLGDAA 239

Query: 236 LQKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSK 295
            +      +   +       ++D     +  +     T Q   + +D L+ +     ++ 
Sbjct: 240 DELKATAKDVRGMVGKLEGPTTDFATTGLPQLSAAVVTLQSAAESLDRLVGEVEQNPRAL 299

Query: 296 ETSAFLENIA 305
            +    + + 
Sbjct: 300 VSKPPAKELE 309


>gi|218886598|ref|YP_002435919.1| hypothetical protein DvMF_1503 [Desulfovibrio vulgaris str.
           'Miyazaki F']
 gi|218757552|gb|ACL08451.1| Mammalian cell entry related domain protein [Desulfovibrio vulgaris
           str. 'Miyazaki F']
          Length = 307

 Score =  112 bits (279), Expect = 9e-23,   Method: Composition-based stats.
 Identities = 40/292 (13%), Positives = 93/292 (31%), Gaps = 4/292 (1%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME +  Y  VG+F +  +  +   I W +        + +  I   G V GLS  + V F
Sbjct: 1   MEIRASYVLVGVFTLMAVVGALAFILWTAGRGS-GVDLVQYDINFTGHVSGLSVANDVLF 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NG+ VG +  + +    P     +  +  +TP+   + A++  +G+ G+T +++S     
Sbjct: 60  NGVKVGSVKAITISPTDPGRVKVRVEMAANTPVREDSMASLEARGITGVTVVQISGGTAT 119

Query: 121 KKTIFQIATERNQRAMIT--ATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTT 178
              +     E             +      +   ++   I   +                
Sbjct: 120 SPLLKPHPGEEVAVIPAQLSRLEALFAGLPAVVSDSRDLIQRIAGMADDENRRALAQTLQ 179

Query: 179 TIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQK 238
           ++  +       A+ +  I   +        ++ S        D+   L   ++      
Sbjct: 180 SLDVLTARLAARADAMDRIIGNLD-VTTRRLANASAGLEGATGDMRDYLRTDLRESTRAV 238

Query: 239 VNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSS 290
            +       + +      +      + D+R      +++   +D L     S
Sbjct: 239 GDMARRMDGMVARAEPGVAKFSGEGLEDMRRLLAEARQLVGTLDRLAHKVES 290



 Score = 68.4 bits (164), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 24/186 (12%), Positives = 68/186 (36%), Gaps = 4/186 (2%)

Query: 263 TVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNMRSSISAIREIT 322
                 E          +++ L +   + +                 N R+    ++ + 
Sbjct: 123 LKPHPGEEVAVIPAQLSRLEALFAGLPAVVSDSRDLIQRIAGMADDENRRALAQTLQSLD 182

Query: 323 DQRQKIISTINTIENITSNLNDSSQKFAELMSKINNISALKENNSLFKDAQRAMHTFRDT 382
               ++ +  + ++ I  NL+ ++++ A   + +   +    +  L  D + +     D 
Sbjct: 183 VLTARLAARADAMDRIIGNLDVTTRRLANASAGLEGATGDMRDY-LRTDLRESTRAVGDM 241

Query: 383 SEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFERNPQDIVWGREK 442
           + +++  +      +  FS  GL D++ L+ + ++ V   D   +  E +P+  ++G   
Sbjct: 242 ARRMDGMVARAEPGVAKFSGEGLEDMRRLLAEARQLVGTLDRLAHKVESDPRRFLFG--- 298

Query: 443 GSVKIY 448
             V  Y
Sbjct: 299 NPVPEY 304


>gi|209885949|ref|YP_002289806.1| putative ABC transporter [Oligotropha carboxidovorans OM5]
 gi|209874145|gb|ACI93941.1| putative ABC transporter [Oligotropha carboxidovorans OM5]
          Length = 371

 Score =  112 bits (279), Expect = 9e-23,   Method: Composition-based stats.
 Identities = 37/108 (34%), Positives = 51/108 (47%), Gaps = 1/108 (0%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++  Y  VGLFV+SI    F  +YWL+ +           ++    V GL   + V F
Sbjct: 1   METRAPYIIVGLFVLSIAAAVFGFVYWLNNAGGLGARSI-YQVQFDEPVPGLLVGAGVLF 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAG 108
           NGI VG +  L LD + P    A   +  DTP+   T   +  QGL G
Sbjct: 60  NGIRVGEVTRLALDPQSPRRVNASVSVLTDTPVRADTKVGLEFQGLTG 107


>gi|157736377|ref|YP_001489060.1| ABC transporter, periplasmic substrate-binding protein, putative
           [Arcobacter butzleri RM4018]
 gi|157698231|gb|ABV66391.1| ABC transporter, periplasmic substrate-binding protein, putative
           [Arcobacter butzleri RM4018]
          Length = 302

 Score =  112 bits (279), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 33/124 (26%), Positives = 54/124 (43%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M++K  +  +GLFV S+       I+WL +    D    +  I    SV GL+  SS++F
Sbjct: 1   MDTKINFFKIGLFVSSLFTLLVIFIFWLGKYGLEDKKYDDYSIFFSESVSGLNIGSSIKF 60

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G  VG +  + ++            I+  TP+     A +   G+ G+ YIEL      
Sbjct: 61  MGFEVGTVKDIKINPYNSEEIQIDIQIQKGTPIKEDNFAILGNLGITGLKYIELKGGSNN 120

Query: 121 KKTI 124
            K +
Sbjct: 121 SKLL 124


>gi|315635509|ref|ZP_07890775.1| ABC superfamily ATP binding cassette transporter, substrate-binding
           protein [Arcobacter butzleri JV22]
 gi|315480267|gb|EFU70934.1| ABC superfamily ATP binding cassette transporter, substrate-binding
           protein [Arcobacter butzleri JV22]
          Length = 302

 Score =  112 bits (278), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 33/124 (26%), Positives = 54/124 (43%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M++K  +  +GLFV S+       I+WL +    D    +  I    SV GL+  SS++F
Sbjct: 1   MDTKINFFKIGLFVSSLFTLLVIFIFWLGKYGLEDKKYDDYSIFFSESVSGLNIGSSIKF 60

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G  VG +  + ++            I+  TP+     A +   G+ G+ YIEL      
Sbjct: 61  MGFEVGTVKDIKINPYNSEEIQIDIQIQKGTPIKEDNFAILGNLGITGLKYIELKGGSNN 120

Query: 121 KKTI 124
            K +
Sbjct: 121 SKLL 124


>gi|303327743|ref|ZP_07358183.1| toluene tolerance ABC transporter, periplasmic substrate-binding
           protein [Desulfovibrio sp. 3_1_syn3]
 gi|302862104|gb|EFL85038.1| toluene tolerance ABC transporter, periplasmic substrate-binding
           protein [Desulfovibrio sp. 3_1_syn3]
          Length = 149

 Score =  112 bits (278), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 36/134 (26%), Positives = 56/134 (41%), Gaps = 3/134 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M S    T+VG+FV+  L    +    L R   +     E+  R   S  GL   + V  
Sbjct: 1   MNS-VRETAVGIFVLLGLICVAYLAIKLGRMEFFANQGFELSARF-DSASGLRVGADVEL 58

Query: 61  NGIPVGRIVGLFLDQEY-PNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRK 119
            G+PVGR+V + LD +     ++    +  +  L   + A+I+T GL G  Y+ LS    
Sbjct: 59  AGVPVGRVVAISLDPDPLRTQAVVHLRLDKNLRLSDDSIASIKTSGLIGDKYVSLSRGGS 118

Query: 120 EKKTIFQIATERNQ 133
           EK           +
Sbjct: 119 EKTIPPGGTITETE 132


>gi|126666399|ref|ZP_01737378.1| hypothetical protein MELB17_12461 [Marinobacter sp. ELB17]
 gi|126629200|gb|EAZ99818.1| hypothetical protein MELB17_12461 [Marinobacter sp. ELB17]
          Length = 312

 Score =  111 bits (277), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 40/289 (13%), Positives = 101/289 (34%), Gaps = 2/289 (0%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME + ++  +G+F +S    +     WL +++  +   A   +    +V GLS  + V +
Sbjct: 1   MEPRAHHFLIGMFTISTAAAALVFALWLGKTSN-EREWAWYEVAFDYTVGGLSEGNPVLY 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NG+ VG +V L L +E P        +    P++  T A++    + G       +   +
Sbjct: 60  NGVDVGDVVSLRLVRENPGEVRVLVRVDETIPMHEDTRASLVLANITGS-MSIEFSGGSQ 118

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
              +   + E         +        S            + +     +NIE+      
Sbjct: 119 NSPLLIGSRENPPIIDAQRSALSGLLDNSQILMNKADQLLRNANQLFSNDNIEQVSAILS 178

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
              E   T++  + +  +   +  Q + ++S +      ++    +L +      L+ ++
Sbjct: 179 NTREASETLVRKSAALDELFANLNQASANASQAAAQIAEVSGTADALLRNEGRSALRSMD 238

Query: 241 QILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFS 289
           + L N           +      +    +         +++ + L++ +
Sbjct: 239 RALGNFDAVMQRLNTLTSDNAGALDAGLQGMGELAPALRELRNTLNNLN 287



 Score = 62.6 bits (149), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 24/174 (13%), Positives = 69/174 (39%), Gaps = 4/174 (2%)

Query: 274 FQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNMRSSISAIREITDQRQKIISTIN 333
              +      L++     +++       +NI   ++ + ++  A   +  +   +     
Sbjct: 140 LSGLLDNSQILMNKADQLLRNANQLFSNDNIEQVSAILSNTREASETLVRKSAALDELFA 199

Query: 334 TIENITSNLNDSSQKFAELMSKINNISALKENNSLFKDAQRAMHTFRDTSEKINRYIPSI 393
            +   ++N + ++ + AE+    + +    E  S  +   RA+  F    +++N      
Sbjct: 200 NLNQASANASQAAAQIAEVSGTADALLRN-EGRSALRSMDRALGNFDAVMQRLNTLTSDN 258

Query: 394 GNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFERNPQDIVWGREKGSVKI 447
              L +    G+ ++   +R+L+ T+N+ +      + NP   +WG +  ++K 
Sbjct: 259 AGAL-DAGLQGMGELAPALRELRNTLNNLNRFTRRLDENPAGTLWGVD--TIKE 309


>gi|313109006|ref|ZP_07794980.1| hypothetical protein PA39016_001650019 [Pseudomonas aeruginosa
           39016]
 gi|310881482|gb|EFQ40076.1| hypothetical protein PA39016_001650019 [Pseudomonas aeruginosa
           39016]
          Length = 309

 Score =  111 bits (276), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 46/291 (15%), Positives = 103/291 (35%), Gaps = 5/291 (1%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME + ++  +GLFVV +         WLS +   D       I     V GL+  S V++
Sbjct: 1   MEPRAHHVFIGLFVVLLGAIGIGFALWLSDTRS-DHDYQYYRIMFDEPVTGLTPGSQVQY 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           +GI +G +V L L    P  ++A+  I    P+   T A +   G+ G   IELS     
Sbjct: 60  SGITIGEVVALSLSPRDPRRAIARVRINATIPVRQDTRAELVITGITGNAVIELSDGGPN 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
              + +   E  +  ++    +  +       + +       R  + + +     +  ++
Sbjct: 120 VPLLDRR--EDEEPLILAPRSAMASLVSGEGNSMTTLNGILLRTQELLSKENLALVHRSL 177

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
            N+E  +  +A+  + I  ++        S +S          +   + ++     Q + 
Sbjct: 178 VNLEQTTGAVADQRAEIATLISNLT--EASRESTAAVRQANSTLRDANLLLNNDGKQIMV 235

Query: 241 QILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSK 291
              +          +    + N    + +          ++   L++ ++ 
Sbjct: 236 NTRDATASLERAAFRVETLLQNNQESLNQGLAATGPAMHELQQALANLNTV 286



 Score = 59.6 bits (141), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 23/168 (13%), Positives = 66/168 (39%), Gaps = 7/168 (4%)

Query: 283 HLLSDFSSKMKSKETSAFLENIADSTSNMRSSISAIREITDQRQKIISTINTIENITSNL 342
           + ++  +  +   +     EN+A    ++ +       + DQR +I + I+ +   +   
Sbjct: 149 NSMTTLNGILLRTQELLSKENLALVHRSLVNLEQTTGAVADQRAEIATLISNLTEASRES 208

Query: 343 NDSSQKFAELMSKINNISALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQ 402
             + ++    +   N +    +   +  + + A  +    + ++   + +   +L     
Sbjct: 209 TAAVRQANSTLRDANLLLNN-DGKQIMVNTRDATASLERAAFRVETLLQNNQESL----N 263

Query: 403 SGLNDIQNLVRKLQETVNHFDDCLNNFERNPQDIVWGREKGSVKIYKP 450
            GL      + +LQ+ + + +  L   +RNP   + G E  +++  KP
Sbjct: 264 QGLAATGPAMHELQQALANLNTVLRRLDRNPAQYLLGGE--NIEETKP 309


>gi|226942632|ref|YP_002797705.1| MCE domain-containing protein [Azotobacter vinelandii DJ]
 gi|226717559|gb|ACO76730.1| MCE domain protein [Azotobacter vinelandii DJ]
          Length = 312

 Score =  111 bits (276), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 49/291 (16%), Positives = 104/291 (35%), Gaps = 9/291 (3%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++ ++  +GLF V     +   +      +  D       +    SV GL+  S V +
Sbjct: 1   METRAHHVLIGLFTVVA-VIAALLLALWLSKSSLDREFDHYEVLFNHSVSGLAVGSPVEY 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           +GI VG +  L+LD + P  + A   I   TP+   T   +    + G   I+L     +
Sbjct: 60  SGIRVGDVEQLWLDPQDPRMARALIRIDSGTPIKQDTRVRLLLANITGARSIQLFGGTPQ 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
              + +   E  +  +I A PS +N  +   E+    I+        +           I
Sbjct: 120 SPRLER---EGGKPPLIVADPSPLNTLLDEGEDVMSSINSILTGASLLFSADNVGRLGHI 176

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
                 +T          +     Q     +       T+ + IT L +    +      
Sbjct: 177 LEHLEQATGAIAA-----QRNELGQTVRQLNQLGRQTGTLLEEITRLARNANGLLDGDGR 231

Query: 241 QILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSK 291
           ++L + Q S +   +S+ ++   + + ++      +   ++   +S+  + 
Sbjct: 232 KLLASAQRSMSALERSTSRLDRLLEENQQALHNGMDGIAELGPAISELRTT 282



 Score = 69.6 bits (167), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 28/178 (15%), Positives = 66/178 (37%), Gaps = 4/178 (2%)

Query: 273 TFQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNMRSSISAIREITDQRQKIISTI 332
               +  + + ++S  +S +         +N+      +     A   I  QR ++  T+
Sbjct: 139 PLNTLLDEGEDVMSSINSILTGASLLFSADNVGRLGHILEHLEQATGAIAAQRNELGQTV 198

Query: 333 NTIENITSNLNDSSQKFAELMSKINNISALKENNSLFKDAQRAMHTFRDTSEKINRYIPS 392
             +  +        ++   L    N +    +   L   AQR+M     ++ +++R +  
Sbjct: 199 RQLNQLGRQTGTLLEEITRLARNANGLL-DGDGRKLLASAQRSMSALERSTSRLDRLLEE 257

Query: 393 IGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFERNPQDIVWGREKGSVKIYKP 450
               L N    G+ ++   + +L+ T+        + E +P     GREK  ++ + P
Sbjct: 258 NQQALHN-GMDGIAELGPAISELRTTLGGLRRVTRHLEDDPSGFFLGREK--MQEFAP 312


>gi|319788027|ref|YP_004147502.1| hypothetical protein Psesu_2439 [Pseudoxanthomonas suwonensis 11-1]
 gi|317466539|gb|ADV28271.1| Mammalian cell entry related domain protein [Pseudoxanthomonas
           suwonensis 11-1]
          Length = 308

 Score =  111 bits (276), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 45/298 (15%), Positives = 95/298 (31%), Gaps = 13/298 (4%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++  Y  +G F + +         W ++ +  +      +I    +V GLS  S+V++
Sbjct: 1   METRANYVLIGAFTIVVSVALLLFGLWAAKYSS-ERSWQRYMIVFDEAVTGLSAGSTVQY 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NGI +G I  L LD + P   +A        P+   T A +    L G   I+LS     
Sbjct: 60  NGISIGSIDKLSLDPQDPRRVVAIIRADASVPVKTDTRAKLAITSLTGPAIIQLSGGSPG 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKII----------E 170
              +   A +      I   PS +      A    +++                      
Sbjct: 120 APLL--TAVDTRDTPQIQTAPSALQNIADTANRIVERLDQVLSDQNVAHIGRTLENIEQI 177

Query: 171 NIEKPLTTTIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKM 230
           +               +   A     +        V     +       +   + S    
Sbjct: 178 SASLAAKDEGMQDLLATARDAARSLDVTLQNTNATVQRVDQNLVQELPALISRLDSTLAR 237

Query: 231 IKAIDLQKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDF 288
           + +        + EN    ++       Q+  T+ ++R   +  +++  ++++  + F
Sbjct: 238 LDSAAGNADAILGENRAAINSFANDGLAQLGPTLTELRGLIRDLRQISDRLENNPARF 295



 Score = 77.3 bits (187), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 21/181 (11%), Positives = 65/181 (35%), Gaps = 3/181 (1%)

Query: 271 TQTFQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNMRSSISAIREITDQRQKIIS 330
           T   Q     + ++    +  ++  +     +N+A     + +       +  + + +  
Sbjct: 131 TPQIQTAPSALQNIADTANRIVERLDQVLSDQNVAHIGRTLENIEQISASLAAKDEGMQD 190

Query: 331 TINTIENITSNLNDSSQKFAELMSKINNISALKENNSLFKDAQRAMHTFRDTSEKINRYI 390
            + T  +   +L+ + Q     + +++    ++E  +L       +      +   +  +
Sbjct: 191 LLATARDAARSLDVTLQNTNATVQRVDQNL-VQELPALISRLDSTLARLDSAAGNADAIL 249

Query: 391 PSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFERNPQDIVWGREKGSVKIYKP 450
                 + +F+  GL  +   + +L+  +       +  E NP   + GR+    K ++P
Sbjct: 250 GENRAAINSFANDGLAQLGPTLTELRGLIRDLRQISDRLENNPARFLLGRDG--AKEFEP 307

Query: 451 K 451
           K
Sbjct: 308 K 308


>gi|209884493|ref|YP_002288350.1| putative ABC transporter [Oligotropha carboxidovorans OM5]
 gi|209872689|gb|ACI92485.1| putative ABC transporter [Oligotropha carboxidovorans OM5]
          Length = 288

 Score =  111 bits (275), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 37/201 (18%), Positives = 76/201 (37%), Gaps = 6/201 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++  Y  +G F ++++  +F  ++W             + I   G+  GL T  +V F
Sbjct: 1   METRANYLLIGAFTIAVIAAAFGFVFWFQNLGAV-AQRTPIRIIFEGAASGLRTGGNVNF 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NGI +G +  + LD   P   +  A +    P+   T   +   GL G++ + L      
Sbjct: 60  NGIKIGEVTSIKLD--DPKRVVVIAAVDKSAPIRADTLVGLEFAGLTGVSSVSLKGGS-- 115

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
                 I    +    + A P+ I         T + ++      +  + +    L    
Sbjct: 116 -LDAGGIPVADDGVPTLNADPNAIMDIGEAVRATLQNVNKLVTDNKDALHDSMANLKAFS 174

Query: 181 ANIETISTVLANNISHIDKMM 201
             +   S  + N ++ ++ +M
Sbjct: 175 KALADNSGRIDNIMAGVESLM 195



 Score = 62.3 bits (148), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 25/134 (18%), Positives = 61/134 (45%), Gaps = 13/134 (9%)

Query: 312 RSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNISALKENNSLFKD 371
            +  +  + +TD +  +  ++  ++  +  L D+S +   +M+ + ++   KE      D
Sbjct: 147 ATLQNVNKLVTDNKDALHDSMANLKAFSKALADNSGRIDNIMAGVESLMGNKEGQE--GD 204

Query: 372 AQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFER 431
            Q+A  +FR+ ++ +++                L+D + L+   + T+      +NNF+R
Sbjct: 205 LQQAARSFRELADNLDKRTA-----------VLLSDGRALITDSRRTLADISRAVNNFDR 253

Query: 432 NPQDIVWGREKGSV 445
           NP  +++G     V
Sbjct: 254 NPTRVLFGASNADV 267


>gi|239813316|ref|YP_002942226.1| hypothetical protein Vapar_0297 [Variovorax paradoxus S110]
 gi|239799893|gb|ACS16960.1| Mammalian cell entry related domain protein [Variovorax paradoxus
           S110]
          Length = 323

 Score =  111 bits (275), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 28/140 (20%), Positives = 58/140 (41%), Gaps = 3/140 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K +  + G FV+ ++      + W +R +          +     V GL   + VR+
Sbjct: 1   MENKAHAIAAGAFVLGLIAVLVGLVVWFTRDSTVRN---TYELSTRDPVSGLQPQAMVRY 57

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            GI VG++  +  D +   +   +  +    PL  S+ AT+  QG+ G+ +I L    + 
Sbjct: 58  RGIAVGKVTSIDFDPKTKGNVRVRITVDQRVPLTTSSFATLSYQGVTGLAFIALDDKGES 117

Query: 121 KKTIFQIATERNQRAMITAT 140
              +     +  +  +  + 
Sbjct: 118 NVALAPNNEDPPRIPLKPSM 137



 Score = 50.3 bits (117), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 18/191 (9%), Positives = 58/191 (30%), Gaps = 19/191 (9%)

Query: 250 SNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTS 309
                     +               E  ++ + LLSD + K  +          A + +
Sbjct: 128 PPRIPLKPSMLAQLQDRGEAIVNQVDEATKRANQLLSDDNQKRAADALENIAAASASANT 187

Query: 310 NMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNISALKENNSLF 369
            ++   + ++        +   +  + N  S++  ++   + + +  N            
Sbjct: 188 LLKQLDNTVKT------GLNPALAALPNTLSSVKTAAGDVSRVANNFNTTVGRLNAPDGP 241

Query: 370 KDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNF 429
                         E+++    ++  ++ +F+ + L  +  +       V       ++ 
Sbjct: 242 -------------IERLSEGTKALAQSVDSFNAATLPRVNRVADDTSRAVRRLGRAADSI 288

Query: 430 ERNPQDIVWGR 440
             NPQ +++G 
Sbjct: 289 NDNPQSLLFGN 299


>gi|297538917|ref|YP_003674686.1| Mammalian cell entry related domain-containing protein
           [Methylotenera sp. 301]
 gi|297258264|gb|ADI30109.1| Mammalian cell entry related domain protein [Methylotenera sp. 301]
          Length = 322

 Score =  111 bits (275), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 51/288 (17%), Positives = 95/288 (32%)

Query: 2   ESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRFN 61
           E+K  Y  VG FV+ +       I W++            +     SV GLST++ V++N
Sbjct: 8   ENKVNYALVGAFVLILGTILIAGILWIASGGINKQKYDTYLAIENESVAGLSTNALVKYN 67

Query: 62  GIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKEK 121
           G+ VGR+  + LD   P     + LI   T +   T AT++TQGL GI YIELS      
Sbjct: 68  GVDVGRVSNISLDPINPQRVRLELLIVRGTLIKQDTLATLKTQGLTGIAYIELSGGNTHS 127

Query: 122 KTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTIA 181
             +     E         + S     + ++     +    S       EN++   +    
Sbjct: 128 PLLVASEGEPYPEIKTIPSLSTRLESLLSSVAAKLEHLSGSFDGINSPENVKAFSSALSD 187

Query: 182 NIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVNQ 241
                 T+     S    M        ++  +     ++   +    K ++ +       
Sbjct: 188 IAAVSHTIAQRKDSLDAGMKSAASTFANTDQASKKLESLIVNVEKSAKAVQLMANDTAGA 247

Query: 242 ILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFS 289
             +    +      +   +  T  ++         +   +        
Sbjct: 248 SRDVGSAAKTLGGDTHQFITETTPEIHNLIAELNVLSASLRRFSEQAE 295



 Score = 36.8 bits (82), Expect = 7.3,   Method: Composition-based stats.
 Identities = 20/177 (11%), Positives = 54/177 (30%), Gaps = 16/177 (9%)

Query: 281 IDHLLSDFSSKMKSKETSAFLENIADSTSNMRSSISAIREITDQRQKIISTINTIENITS 340
           +  + +       S +     EN+   +S +    +    I  ++  + + + +  +  +
Sbjct: 155 LSSVAAKLEHLSGSFDGINSPENVKAFSSALSDIAAVSHTIAQRKDSLDAGMKSAASTFA 214

Query: 341 NLNDSSQKFAELMSKINNISALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNF 400
           N + +S+K   L+  +   +   +   +  D   A       ++ +              
Sbjct: 215 NTDQASKKLESLIVNVEKSAKAVQL--MANDTAGASRDVGSAAKTLGGDTHQFITETTPE 272

Query: 401 SQSGLNDIQNLVRKLQETVNHFDDCLNNFERNPQDIVWGRE-------KGSVKIYKP 450
             + + ++  L                  ERNP   + G         + S+K   P
Sbjct: 273 IHNLIAELNVLS-------ASLRRFSEQAERNPAGFIAGPSPVPEGPGESSIKEQNP 322


>gi|163782389|ref|ZP_02177387.1| hypothetical protein HG1285_06365 [Hydrogenivirga sp. 128-5-R1-1]
 gi|159882422|gb|EDP75928.1| hypothetical protein HG1285_06365 [Hydrogenivirga sp. 128-5-R1-1]
          Length = 523

 Score =  111 bits (275), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 54/452 (11%), Positives = 134/452 (29%), Gaps = 55/452 (12%)

Query: 5   NYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRFNGIP 64
                +G FV+       F I                ++     V GLS  + VR +GI 
Sbjct: 4   TTEIKLGAFVLFTAVSFAFLILTFGEIPFLRPDTKRYVVYFSD-VGGLSKGAEVRVSGIR 62

Query: 65  VGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKEKKTI 124
            G++  + L+    +       +     L+   +ATI T GL G  Y+ ++        +
Sbjct: 63  AGKVEEITLE---DSRVKVVFNVERRIRLFKDASATIGTLGLMGDKYLAVNPGTPSAGEL 119

Query: 125 FQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTIANIE 184
                   +        +  +  I     T++     + ++ +I+E   + L  T+ N+ 
Sbjct: 120 A-----EGESLKTAEGVADTDRLIRELTRTAEGFKLVAENLNRILEENRRNLRETLENLN 174

Query: 185 TISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVNQILE 244
            ++  L        + +                             +  +     + + E
Sbjct: 175 ALTQTLRRMAEENQQNLKVVL-----------------------AEMAQLTESLNSTLPE 211

Query: 245 NIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAFLENI 304
            I        + +        D+R      + +  ++   L      M +          
Sbjct: 212 AISSIDRLADELTGIASENREDIRVLVANLKSISDELRGELPQLVENMNTL--------- 262

Query: 305 ADSTSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNISALKE 364
                    S +    + + R+ + + I  +  +T+ L  SS +   +++KI +      
Sbjct: 263 ---------SKNLNEVVKENRRDLRTAIQNLSEMTARLRRSSNRLDNILAKIESGEGTIG 313

Query: 365 NNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNL----QNFSQSGLNDIQNLVRKLQETVN 420
                 +   ++        +    I      +    + ++        +L  +      
Sbjct: 314 KLVTDDELYESVSKGAKLFGEAGEVITKTKIYVGFGGEAYTGGDSKGYMSLRIEPDRKTY 373

Query: 421 HFDDCLNNFE-RNPQDIVWGREKGSVKIYKPK 451
           +  + + +   R   + + G  +   K +KP+
Sbjct: 374 YLLEVVGDSRGRVYTEQIVGGNEIVKKEFKPE 405


>gi|255020160|ref|ZP_05292229.1| Uncharacterized ABC transporter, periplasmic component YrbD
           [Acidithiobacillus caldus ATCC 51756]
 gi|254970302|gb|EET27795.1| Uncharacterized ABC transporter, periplasmic component YrbD
           [Acidithiobacillus caldus ATCC 51756]
          Length = 171

 Score =  111 bits (275), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 33/152 (21%), Positives = 57/152 (37%), Gaps = 2/152 (1%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M ++     VG+FV+  +       + +   + +      V+     +V  L   S V+ 
Sbjct: 1   MRNRAVDWWVGIFVLLGIAALAVLAFRVGNLSGFQYGEGYVLHADFNNVGSLKVRSPVKL 60

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G+ VG + G+ +D +    +     I P   L   T A+I TQGL G  YI L      
Sbjct: 61  GGVTVGEVTGIRIDPKTF-QAEVSMRIEPQLKLPVDTGASIYTQGLLGEQYIALQPG-GM 118

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAE 152
            + +    T    ++ +           S AE
Sbjct: 119 PQDLKPGGTITLTQSAVNIDQLIGQMVFSKAE 150


>gi|283853086|ref|ZP_06370342.1| Mammalian cell entry related domain protein [Desulfovibrio sp.
           FW1012B]
 gi|283571553|gb|EFC19557.1| Mammalian cell entry related domain protein [Desulfovibrio sp.
           FW1012B]
          Length = 149

 Score =  110 bits (274), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 30/133 (22%), Positives = 59/133 (44%), Gaps = 2/133 (1%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M+     T+VG+FV++ L    +    L + + + G    ++ R    V GL + + V  
Sbjct: 1   MKKYAMETTVGVFVLAGLLCVAYLTVKLGKLDVFGGDSYPLVARFKD-VTGLKSGAYVEM 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G+ +GR+  + LD +  N +L    I+    L   + A+I+T GL G  ++++S    +
Sbjct: 60  AGVRIGRVSAVALDPKD-NMALVTLEIQNGVRLTDDSIASIKTSGLIGDKFVKVSPGGSD 118

Query: 121 KKTIFQIATERNQ 133
                       +
Sbjct: 119 DVLKPGGTIVETE 131


>gi|294056024|ref|YP_003549682.1| Mammalian cell entry related domain protein [Coraliomargarita
           akajimensis DSM 45221]
 gi|293615357|gb|ADE55512.1| Mammalian cell entry related domain protein [Coraliomargarita
           akajimensis DSM 45221]
          Length = 152

 Score =  110 bits (274), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 30/117 (25%), Positives = 49/117 (41%), Gaps = 3/117 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M ++N    VG FV+  L    +    +  +  + G   ++      S  G+S  S V  
Sbjct: 1   MNNRNIELLVGCFVLLGLAAVLYLALQIGGARVFGGDTYQLNAEFS-SAAGVSEGSRVEI 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTL 117
            G+PVG +  + L      +++    +     L   T A+I+T GL G  YI LS  
Sbjct: 60  AGVPVGTVKQIQL--NDDFYAVVTLELPKSLELDDDTIASIKTSGLIGDRYIRLSPG 114


>gi|305432466|ref|ZP_07401628.1| ABC superfamily ATP binding cassette transporter, periplasmic
           substrate-binding protein [Campylobacter coli JV20]
 gi|304444505|gb|EFM37156.1| ABC superfamily ATP binding cassette transporter, periplasmic
           substrate-binding protein [Campylobacter coli JV20]
          Length = 298

 Score =  110 bits (274), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 33/125 (26%), Positives = 56/125 (44%), Gaps = 1/125 (0%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K  Y  VGLFV  + F S   + WL   ++ +       I    SV GL   + VR 
Sbjct: 1   MENKANYFFVGLFVFGVFFASIGFMLWLGGYSK-EESFEYYEIHTQESVAGLGIKAPVRL 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G+ +G +  + +  +          I+  TP+   T AT++ QG+ G+ +++L    K 
Sbjct: 60  LGVEIGNVENISIYDKENLGVNILIKIKKGTPIKEDTFATLQFQGITGLKFVQLQGGSKN 119

Query: 121 KKTIF 125
              + 
Sbjct: 120 SPKLQ 124


>gi|325982945|ref|YP_004295347.1| Mammalian cell entry related domain-containing protein
           [Nitrosomonas sp. AL212]
 gi|325532464|gb|ADZ27185.1| Mammalian cell entry related domain protein [Nitrosomonas sp.
           AL212]
          Length = 298

 Score =  110 bits (274), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 42/281 (14%), Positives = 102/281 (36%), Gaps = 7/281 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++ +    G+FV+ +         W S ++       + ++    SV GL+  S+V +
Sbjct: 1   MENRAHALIAGIFVILLSISVALVAMWFSGNS---TKRTDYLVVTKESVSGLNPQSAVHY 57

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G+ +G++  +  D + P+  L +  +  +  L  S  A +  QG+ G+ YI+L+     
Sbjct: 58  RGVNIGKVEKIQFDPDNPHQILIQIAVNENVTLRKSVYAQLGYQGVTGLAYIQLNDDGVN 117

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
            + +        +  +   T SG +       N +K +      + +  +N    +   I
Sbjct: 118 NEILSDERIPMRRSLLDEVTGSGQD----LLSNVNKLVLKMHHLLNEQNQNHISQILQNI 173

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
                    +A ++  +        +   +   +         +T      K      ++
Sbjct: 174 DKATKNFDGIAGHLQPVLNSFTELTIESGTLVKRLDQLLGELNLTVAKANQKEGIFDSLS 233

Query: 241 QILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKI 281
           Q  + +  +     K S  ++    ++ +     +E  Q +
Sbjct: 234 QSSQELATTIPELRKLSHSLLRNSSNLDKVLYQLEENPQSL 274



 Score = 47.2 bits (109), Expect = 0.005,   Method: Composition-based stats.
 Identities = 22/172 (12%), Positives = 62/172 (36%), Gaps = 12/172 (6%)

Query: 282 DHLLSDFSSKMKSKETSAFLENIADSTSNMRSSISAIREITDQRQKIISTINTIENITSN 341
           D + ++  S  +     + L+ +  S  ++ S+++ +              N I  I  N
Sbjct: 114 DGVNNEILSDERIPMRRSLLDEVTGSGQDLLSNVNKLVLKMH-HLLNEQNQNHISQILQN 172

Query: 342 LNDSSQKFAELMSKINNISALKENNSLFKDAQRAMHTFRDTSEKINRYIPSI--GNNLQN 399
           ++ +++ F  +   +  +        L  ++   +        ++N  +        + +
Sbjct: 173 IDKATKNFDGIAGHLQPVLNS--FTELTIESGTLVKRLDQLLGELNLTVAKANQKEGIFD 230

Query: 400 FSQSGLNDIQNLVRKLQETV-------NHFDDCLNNFERNPQDIVWGREKGS 444
                  ++   + +L++         ++ D  L   E NPQ +++GR   S
Sbjct: 231 SLSQSSQELATTIPELRKLSHSLLRNSSNLDKVLYQLEENPQSLIFGRSPSS 282


>gi|328954407|ref|YP_004371741.1| Mammalian cell entry related domain protein [Desulfobacca
           acetoxidans DSM 11109]
 gi|328454731|gb|AEB10560.1| Mammalian cell entry related domain protein [Desulfobacca
           acetoxidans DSM 11109]
          Length = 302

 Score =  110 bits (274), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 48/288 (16%), Positives = 98/288 (34%), Gaps = 2/288 (0%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M  K     VGLFV+  +  + F+I W+  +  Y    A  +  +  SV GL  DS V+F
Sbjct: 1   MARKTSSFLVGLFVIIGVALTVFAIIWVGVTG-YFQQGATYVTYVDESVQGLQKDSVVKF 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G+ VGR+  + +  +          I     L  +  A + + G+ GI +I+L   R  
Sbjct: 60  RGVDVGRVEHIRIAPDN-KLVAIIMKINLPGDLTENIVAQLTSSGITGIMFIDLDYRRPG 118

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
              +       ++  +I + PS     IS   +   +++                  T +
Sbjct: 119 APDLSPKIDFPSEYPIIPSKPSEYTRIISGINDVISRLNQIDIEGISTQLKDAIREITLL 178

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
              + + ++LA        +   T      +        I +   ++ +  K +      
Sbjct: 179 LKGDKVQSILAKTEKTAANLEALTGKANTLAGEVKLTEVIRETTATISEARKFVVDLNRQ 238

Query: 241 QILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDF 288
                +  +         +      ++  TT++ +    +I     D 
Sbjct: 239 LYDLKLPETMGKTRNLLREAQAIGENLHRTTESLEMFADRIYERPPDL 286


>gi|217969577|ref|YP_002354811.1| hypothetical protein Tmz1t_1156 [Thauera sp. MZ1T]
 gi|217506904|gb|ACK53915.1| Mammalian cell entry related domain protein [Thauera sp. MZ1T]
          Length = 313

 Score =  110 bits (274), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 46/289 (15%), Positives = 91/289 (31%), Gaps = 1/289 (0%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++ ++  +GLF V ++  +     WL + +  D       I    +V GLS   +V F
Sbjct: 1   METRAHHVLIGLFTVLVVGAALMFALWLGK-SDADRQFEVYDIVFQEAVSGLSKGGTVEF 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NGI +G +V L LD       +A+  +    P+   T A +   G+ G+T I L++    
Sbjct: 60  NGIKIGDVVSLRLDPADARRVIARVRVDSAAPVRSDTRARLVPAGITGLTMIRLTSGEDP 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
             T      +   R +   +P            T+              +N+     T  
Sbjct: 120 ASTPLVSKGDEVARIIAAPSPLSRLLADGEDAITNVNDLLVQARELLSADNVASFGRTLG 179

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
                   + A        +   TQ +  +S +      +      L ++     L    
Sbjct: 180 NLELATGALAAQREDLNAALREVTQASRDASTALAEAARMLGSANRLVEVQGTQTLDSAR 239

Query: 241 QILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFS 289
             +   + +     +        +               ++   L+   
Sbjct: 240 DAMRAFERAMGTVDRLIADNRAPLDGGMRGLAEIGPAVAELRTTLASLR 288



 Score = 58.4 bits (138), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 28/178 (15%), Positives = 65/178 (36%), Gaps = 4/178 (2%)

Query: 273 TFQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNMRSSISAIREITDQRQKIISTI 332
               +    +  +++ +  +         +N+A     + +   A   +  QR+ + + +
Sbjct: 140 PLSRLLADGEDAITNVNDLLVQARELLSADNVASFGRTLGNLELATGALAAQREDLNAAL 199

Query: 333 NTIENITSNLNDSSQKFAELMSKINNISALKENNSLFKDAQRAMHTFRDTSEKINRYIPS 392
             +   + + + +  + A ++   N +  ++   +L   A+ AM  F      ++R I  
Sbjct: 200 REVTQASRDASTALAEAARMLGSANRLVEVQGTQTL-DSARDAMRAFERAMGTVDRLIAD 258

Query: 393 IGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFERNPQDIVWGREKGSVKIYKP 450
               L      GL +I   V +L+ T+          E  P D + G E    K + P
Sbjct: 259 NRAPLDG-GMRGLAEIGPAVAELRTTLASLRIITRQLESRPADYLLGLEPT--KEFTP 313


>gi|29654063|ref|NP_819755.1| ABC transporter periplasmic substrate-binding protein [Coxiella
           burnetii RSA 493]
 gi|153209294|ref|ZP_01947329.1| ABC transporter, periplasmic substrate-binding protein [Coxiella
           burnetii 'MSU Goat Q177']
 gi|154706397|ref|YP_001424138.1| hypothetical protein CBUD_0743 [Coxiella burnetii Dugway 5J108-111]
 gi|161830138|ref|YP_001596959.1| ABC transporter, periplasmic substrate-binding protein [Coxiella
           burnetii RSA 331]
 gi|165924019|ref|ZP_02219851.1| ABC transporter, periplasmic substrate-binding protein [Coxiella
           burnetii RSA 334]
 gi|212219046|ref|YP_002305833.1| hypothetical protein CbuK_1526 [Coxiella burnetii CbuK_Q154]
 gi|29541329|gb|AAO90269.1| hypothetical exported protein [Coxiella burnetii RSA 493]
 gi|120575410|gb|EAX32034.1| ABC transporter, periplasmic substrate-binding protein [Coxiella
           burnetii 'MSU Goat Q177']
 gi|154355683|gb|ABS77145.1| hypothetical exported protein [Coxiella burnetii Dugway 5J108-111]
 gi|161762005|gb|ABX77647.1| ABC transporter, periplasmic substrate-binding protein [Coxiella
           burnetii RSA 331]
 gi|165916542|gb|EDR35146.1| ABC transporter, periplasmic substrate-binding protein [Coxiella
           burnetii RSA 334]
 gi|212013308|gb|ACJ20688.1| hypothetical exported protein [Coxiella burnetii CbuK_Q154]
          Length = 308

 Score =  110 bits (273), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 56/291 (19%), Positives = 124/291 (42%), Gaps = 5/291 (1%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M++K  YT VG F++ +   S     W S           + + +   V G+ST + VRF
Sbjct: 1   MDTKVNYTLVGFFIILLGAASIVIFLWFSTFRHRQTFDTYL-VYMHEEVSGISTQTPVRF 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NG+ VG +  + ++   P   +    I+ +TP+  ST AT+R++G+ G  Y+ L  L   
Sbjct: 60  NGVKVGYVQKIEINPADPQQVVLTLKIKHETPITTSTVATLRSEGIMGTDYVALKALTAT 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIEN-IEKPLTTT 179
              +  IA    +  +I + PS +    +  +  +K I + S ++ K+ +    + ++ +
Sbjct: 120 APPL--IAKPGEKYPVIPSEPSLLMKLSTALQEVTKTIKELSDNVGKVFDEKNRRAISAS 177

Query: 180 IANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKV 239
           + NI+ ++  L++N  +ID  +H+ +    +S   +                  I  ++ 
Sbjct: 178 LVNIQKVTKTLSDNSENIDATLHSMKQLMKNSAKASEQLPTIMHQLQDTLANIKITARQF 237

Query: 240 NQILENIQVSSNNFVKSSDQV-INTVHDVRETTQTFQEVGQKIDHLLSDFS 289
           ++    I+++  +   +   +    +  V++           +  L  +  
Sbjct: 238 DRAGHGIELTVGDAHTAMQSMSTQILPTVQQLLTKLNATAAHLQQLSIELQ 288



 Score = 49.2 bits (114), Expect = 0.001,   Method: Composition-based stats.
 Identities = 22/167 (13%), Positives = 60/167 (35%), Gaps = 9/167 (5%)

Query: 274 FQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNMRSSISAIREITDQRQKIISTIN 333
             ++   +  +         +       +N    ++++ +     + ++D  + I +T++
Sbjct: 141 LMKLSTALQEVTKTIKELSDNVGKVFDEKNRRAISASLVNIQKVTKTLSDNSENIDATLH 200

Query: 334 TIENITSNLNDSSQKFAELMSKINNISALKENNSLFKDAQRAMHTFRDTSEKINRYIPSI 393
           +++ +  N   +S++   +M ++              + +     F      I   +   
Sbjct: 201 SMKQLMKNSAKASEQLPTIMHQL---------QDTLANIKITARQFDRAGHGIELTVGDA 251

Query: 394 GNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFERNPQDIVWGR 440
              +Q+ S   L  +Q L+ KL  T  H        + NP  +V G+
Sbjct: 252 HTAMQSMSTQILPTVQQLLTKLNATAAHLQQLSIELQHNPSMLVRGK 298


>gi|92116873|ref|YP_576602.1| hypothetical protein Nham_1317 [Nitrobacter hamburgensis X14]
 gi|91799767|gb|ABE62142.1| Mammalian cell entry related protein [Nitrobacter hamburgensis X14]
          Length = 293

 Score =  110 bits (273), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 47/288 (16%), Positives = 106/288 (36%), Gaps = 18/288 (6%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++  +  +G F ++++  +F  + W    +      + + I   GS  GL    SV F
Sbjct: 1   METRANFVLIGSFTLAVIAAAFGFVLWFQNLHS-SKARSPLRIVFEGSASGLRNGGSVNF 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NGI VG +V + LD   P   +A  ++    P+   T   +  QGL G+  I L      
Sbjct: 60  NGIRVGEVVSVKLD--DPRRVVALTMVENAAPIRKDTRVGLEFQGLTGVAAISLKGGEVA 117

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
              +     + +    +TA P+G+     +   T + ++      +  ++N  + + T  
Sbjct: 118 ASPV---PLDGDGVPTLTADPAGLRDVTESIRATLQNVNRVVAENETAVKNTLRNVETFT 174

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
           A++   +  + + +   +++M                  +T     +  +      +   
Sbjct: 175 ASLAHNAGKIDDLVQKFNEVMSKAD------------GVMTKTDELMLGLNAIAGGKDGG 222

Query: 241 QILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDF 288
           ++L+ ++         + +    + D R T          +D   +  
Sbjct: 223 ELLKTVKSVREFADDFNKRSGALMVDGRRTLGDISRAVNNLDRNPTRL 270



 Score = 53.8 bits (126), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 27/174 (15%), Positives = 59/174 (33%), Gaps = 23/174 (13%)

Query: 271 TQTFQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNMRSSISAIREITDQRQKIIS 330
             T       +  +     + +++       EN     + +R+  +    +     KI  
Sbjct: 128 VPTLTADPAGLRDVTESIRATLQNVN-RVVAENETAVKNTLRNVETFTASLAHNAGKIDD 186

Query: 331 TINTIENITSNLNDSSQKFAELMSKINNISALKENNSLFKDAQRAMHTFRDTSEKINRYI 390
            +     + S  +    K  ELM  +N I+  K+   L     + + + R+ ++  N+  
Sbjct: 187 LVQKFNEVMSKADGVMTKTDELMLGLNAIAGGKDGGELL----KTVKSVREFADDFNKRS 242

Query: 391 PSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFERNPQDIVWGREKGS 444
                               L+   + T+      +NN +RNP  +++G   GS
Sbjct: 243 G------------------ALMVDGRRTLGDISRAVNNLDRNPTRLLFGPSLGS 278


>gi|77463400|ref|YP_352904.1| ABC transporter periplasmic substrate-binding protein [Rhodobacter
           sphaeroides 2.4.1]
 gi|77387818|gb|ABA79003.1| Putative ABC transporter, periplasmic substrate-binding protein
           [Rhodobacter sphaeroides 2.4.1]
          Length = 321

 Score =  110 bits (273), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 36/131 (27%), Positives = 66/131 (50%), Gaps = 2/131 (1%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++  Y  +G+F ++ +  +   + WL++  Q D   AE  I    SV+GL   S VR+
Sbjct: 1   METRARYVLIGIFTLASILATLGFLLWLAKV-QLDRTYAEYDILFT-SVEGLGRASPVRY 58

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NG+ VG ++ + +D E P+    +  +   TP+   T A + +QG+ G++Y+ LS     
Sbjct: 59  NGVDVGEVLNIAVDAEDPSLVRVRIQLAATTPVRTDTKAQVASQGVTGVSYVSLSGGAAP 118

Query: 121 KKTIFQIATER 131
           +    +     
Sbjct: 119 EPLTAEGDQWP 129



 Score = 62.3 bits (148), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 27/201 (13%), Positives = 58/201 (28%), Gaps = 16/201 (7%)

Query: 263 TVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNMRSSISAIREIT 322
              +  +           +  L +D  + +                 N  +  S +    
Sbjct: 121 LTAEGDQWPPVIPSERSAVQALTADAPTLLAEAIALLKDIQTFTGPENRAAVESILTNAD 180

Query: 323 DQRQKIISTINTIENITSNLNDSSQKFAELMSKINNISAL-----KENNSLFKDAQRAMH 377
              Q I +        TS LND + +   +  + +   A      +E       A+    
Sbjct: 181 ASVQNIAAITRDAAEATSRLNDFTARLDAMADRADVALASLETALEEGKGAAASARDTFE 240

Query: 378 TFRDTSE--------KINRYIPSIGNNLQ---NFSQSGLNDIQNLVRKLQETVNHFDDCL 426
                 +        +I   +  I  ++    NF+ +GL     L  + + TV + +  +
Sbjct: 241 AVNRVVDRDVPPMIAQIRSAVSGIERSVAGIRNFADNGLPQYATLAAETRRTVTNLNSLI 300

Query: 427 NNFERNPQDIVWGREKGSVKI 447
               R+P     G +  S + 
Sbjct: 301 AQISRDPARFFLGSQTPSYRR 321


>gi|90422965|ref|YP_531335.1| hypothetical protein RPC_1454 [Rhodopseudomonas palustris BisB18]
 gi|90104979|gb|ABD87016.1| Mammalian cell entry related [Rhodopseudomonas palustris BisB18]
          Length = 289

 Score =  110 bits (273), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 40/208 (19%), Positives = 87/208 (41%), Gaps = 6/208 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++  Y  +G FV++++  +   + W    +        + I   GS  GL    +V F
Sbjct: 1   METRANYFLIGSFVLAVIVAALGFVLWFQSLHTTKTRS-PLRIIFEGSASGLRNGGNVNF 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NG+ +G ++ + LD   P   +A A++    P+   T   +  QGL G+  I L   ++ 
Sbjct: 60  NGVRIGEVISVKLD--NPRRVVALAMVENSAPIRKDTLVGLEFQGLTGVAAISLKGGQET 117

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
              +     + +   M+TA P+ +         T K ++      ++ +    + + T  
Sbjct: 118 APPV---PLDEDGTPMLTADPAALQDVTEAIRATLKNVNRIFADNEEAVRTSLQNVQTFT 174

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTP 208
           +++ + S  + + +   D ++  T    
Sbjct: 175 SSLASSSEHIDSIMKKADGVITKTDNLM 202



 Score = 49.5 bits (115), Expect = 0.001,   Method: Composition-based stats.
 Identities = 20/138 (14%), Positives = 55/138 (39%), Gaps = 22/138 (15%)

Query: 309 SNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNISALKENNSL 368
            N  +  ++++ +      + S+   I++I    +    K   LM  ++ ++  K+   L
Sbjct: 158 DNEEAVRTSLQNVQTFTSSLASSSEHIDSIMKKADGVITKTDNLMLGLDALAGGKDGGEL 217

Query: 369 FKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNN 428
                +A+ +FR+ ++ +++                      L+   + T+      +NN
Sbjct: 218 L----QAVKSFRELTDNLDKRAG------------------ALMLDGRRTLADISRAVNN 255

Query: 429 FERNPQDIVWGREKGSVK 446
            ++NP  I++G    + +
Sbjct: 256 LDKNPTRILFGPSTSASE 273


>gi|197120796|ref|YP_002132747.1| hypothetical protein AnaeK_0376 [Anaeromyxobacter sp. K]
 gi|196170645|gb|ACG71618.1| Mammalian cell entry related domain protein [Anaeromyxobacter sp.
           K]
          Length = 295

 Score =  110 bits (273), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 37/131 (28%), Positives = 55/131 (41%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M ++     VG FVV +   +     WL+    +       I R   SV GL   + V F
Sbjct: 1   MRAQPNLAVVGAFVVGLGAAAIVVGLWLAAGGFHLKRQERYIARFEESVSGLGRGAPVSF 60

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G+PVG +  L L+   P        + P TP+   T A +  QGL GI  +ELS   + 
Sbjct: 61  RGVPVGSVRDLSLEPGDPARVRLVLEVAPGTPVTRDTVAVLAFQGLTGIASVELSGGGRG 120

Query: 121 KKTIFQIATER 131
              + + A + 
Sbjct: 121 APPLARAAGDP 131


>gi|302039181|ref|YP_003799503.1| putative ABC transporter periplasmic-binding protein [Candidatus
           Nitrospira defluvii]
 gi|300607245|emb|CBK43578.1| putative ABC-type transport system, periplasmic binding component
           [Candidatus Nitrospira defluvii]
          Length = 320

 Score =  110 bits (273), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 42/128 (32%), Positives = 62/128 (48%), Gaps = 1/128 (0%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME K  Y  VG FVV +      +I+WL ++  Y G      +    SV GLS DS+V++
Sbjct: 1   MEPKVNYILVGAFVVLLGATILGAIFWLGKT-DYRGIYDRYYVYTRESVAGLSVDSTVKY 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G+ VGR+  + L+ E          I   TP+   T A + TQGL G+  + L+   +E
Sbjct: 60  RGVDVGRVKQVILNPENTEEVRVTLDIVGGTPVKTDTQAVLVTQGLTGLVTLNLTGGSRE 119

Query: 121 KKTIFQIA 128
              +  IA
Sbjct: 120 APFLTPIA 127



 Score = 59.9 bits (142), Expect = 8e-07,   Method: Composition-based stats.
 Identities = 19/164 (11%), Positives = 60/164 (36%), Gaps = 5/164 (3%)

Query: 281 IDHLLSDFSSKMKSKETSAFLENIADSTSNMRSSISAIREITDQRQKIISTINTIENITS 340
           +  L+++ +   ++  ++   +N       ++   +  + + ++  ++   +        
Sbjct: 157 LSTLVANLNGLAQNAASALDEDNRTVLRQILKDVSAVTKVLAERSGQMDRGVQQAVQAAD 216

Query: 341 NLNDSSQKFAELMSKINNISALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNF 400
                +++ ++ +  +     ++  +      Q+       TS  +   I +    ++ F
Sbjct: 217 QSARVTEQLSKQLPAL-----VERLSRSAAGLQQMTEDLSRTSRSVGEMIGASRPGIEQF 271

Query: 401 SQSGLNDIQNLVRKLQETVNHFDDCLNNFERNPQDIVWGREKGS 444
           S+  L D   LV +L++     +      ER P  +V GR    
Sbjct: 272 SRQTLADTGLLVTELRQLTATLNRVAQQVERQPNVLVLGRSAQP 315


>gi|126462255|ref|YP_001043369.1| hypothetical protein Rsph17029_1487 [Rhodobacter sphaeroides ATCC
           17029]
 gi|126103919|gb|ABN76597.1| Mammalian cell entry related domain protein [Rhodobacter
           sphaeroides ATCC 17029]
          Length = 321

 Score =  110 bits (273), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 36/131 (27%), Positives = 66/131 (50%), Gaps = 2/131 (1%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++  Y  +G+F ++ +  +   + WL++  Q D   AE  I    SV+GL   S VR+
Sbjct: 1   METRARYVLIGIFTLASILATLGFLLWLAKV-QLDRTYAEYDILFT-SVEGLGRASPVRY 58

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NG+ VG ++ + +D E P+    +  +   TP+   T A + +QG+ G++Y+ LS     
Sbjct: 59  NGVDVGEVLNIAVDAEDPSLVRVRIQLAATTPVRTDTKAQVASQGVTGVSYVSLSGGAAP 118

Query: 121 KKTIFQIATER 131
           +    +     
Sbjct: 119 EPLTAEGDQWP 129



 Score = 61.5 bits (146), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 27/201 (13%), Positives = 58/201 (28%), Gaps = 16/201 (7%)

Query: 263 TVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNMRSSISAIREIT 322
              +  +           +  L +D  + +    +            N  +  S +    
Sbjct: 121 LTAEGDQWPPVIPSERSAVQALTADAPTLLAEAISLLKDIQTFTGPENRAAVESILTNAD 180

Query: 323 DQRQKIISTINTIENITSNLNDSSQKFAELMSKINNISAL-----KENNSLFKDAQRAMH 377
              Q I +        TS LND + +   +  + +   A      +E       A+    
Sbjct: 181 ASVQNIAAITRDAAEATSRLNDFTARLDAMADRADVALASLETALEEGKGAAASARDTFE 240

Query: 378 TFRDTSE--------KINRYIPSIGNNLQ---NFSQSGLNDIQNLVRKLQETVNHFDDCL 426
                          +I   +  I  ++    NF+ +GL     L  + + TV + +  +
Sbjct: 241 AVNRVVNRDVPPMIAQIRSAVSGIERSVAGIRNFADNGLPQYATLAAETRRTVTNLNSLI 300

Query: 427 NNFERNPQDIVWGREKGSVKI 447
               R+P     G +  S + 
Sbjct: 301 AQISRDPARFFLGNQTPSYRR 321


>gi|82703104|ref|YP_412670.1| hypothetical protein Nmul_A1983 [Nitrosospira multiformis ATCC
           25196]
 gi|82411169|gb|ABB75278.1| Mammalian cell entry related protein [Nitrosospira multiformis ATCC
           25196]
          Length = 301

 Score =  110 bits (273), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 48/295 (16%), Positives = 111/295 (37%), Gaps = 16/295 (5%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++ +  + GLFV+ +      ++ W              ++     V GL++ + VR+
Sbjct: 1   MENRAHALAAGLFVIILGTALVAAVLWFGGDTMMRNK---YMLVSEMPVSGLNSQAIVRY 57

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G+ VG++  + LD+E P+  L +  +  + PL  +  A +  QGL G+ Y++L+    E
Sbjct: 58  RGVTVGKVENIKLDKEDPHKILIQIAVDKNVPLTRNAFAQLGYQGLTGLAYVQLNDEDGE 117

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
            + +    T+ ++   I   PS  +   S+ ++     S     +  ++E+  +      
Sbjct: 118 TEQLE---TDSDEPPQIPLRPSLFDSITSSGQHLLGTASVLIERMNLLLEDENRT----- 169

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
                    +  N       +                          +     +DL ++ 
Sbjct: 170 -----RFMHILENTEKATGRLSRVLNQLEPGLKAIPGLAADASSVMKNADQLVVDLNQIT 224

Query: 241 QILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSK 295
             L     + +    ++ ++  T+  +RE T+  +   + +D +L     +  S 
Sbjct: 225 SRLNRQGGAIDGLSVATVELGETMRSLREATEGIKNTTRSVDRVLLQLEDQPTSL 279


>gi|212212805|ref|YP_002303741.1| hypothetical protein CbuG_1274 [Coxiella burnetii CbuG_Q212]
 gi|212011215|gb|ACJ18596.1| hypothetical exported protein [Coxiella burnetii CbuG_Q212]
          Length = 308

 Score =  110 bits (273), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 55/291 (18%), Positives = 124/291 (42%), Gaps = 5/291 (1%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M++K  YT VG F++ +   S     W S           + + +   V G++T + VRF
Sbjct: 1   MDTKVNYTLVGFFIILLGAASIVIFLWFSTFRHRQTFDTYL-VYMHEEVSGINTQTPVRF 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NG+ VG +  + ++   P   +    I+ +TP+  ST AT+R++G+ G  Y+ L  L   
Sbjct: 60  NGVKVGYVQKIEINPADPQQVVLTLKIKHETPITTSTVATLRSEGIMGTDYVALKALTAT 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIEN-IEKPLTTT 179
              +  IA    +  +I + PS +    +  +  +K I + S ++ K+ +    + ++ +
Sbjct: 120 APPL--IAKPGEKYPVIPSEPSLLMKLSTALQEVTKTIKELSDNVGKVFDEKNRRAISAS 177

Query: 180 IANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKV 239
           + NI+ ++  L++N  +ID  +H+ +    +S   +                  I  ++ 
Sbjct: 178 LVNIQKVTKTLSDNSENIDATLHSMKQLMKNSAKASEQLPTIMHQLQDTLANIKITARQF 237

Query: 240 NQILENIQVSSNNFVKSSDQV-INTVHDVRETTQTFQEVGQKIDHLLSDFS 289
           ++    I+++  +   +   +    +  V++           +  L  +  
Sbjct: 238 DRAGHGIELTVGDAHTAMQSMSTQILPTVQQLLTKLNATAAHLQQLSIELQ 288



 Score = 49.2 bits (114), Expect = 0.001,   Method: Composition-based stats.
 Identities = 22/167 (13%), Positives = 60/167 (35%), Gaps = 9/167 (5%)

Query: 274 FQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNMRSSISAIREITDQRQKIISTIN 333
             ++   +  +         +       +N    ++++ +     + ++D  + I +T++
Sbjct: 141 LMKLSTALQEVTKTIKELSDNVGKVFDEKNRRAISASLVNIQKVTKTLSDNSENIDATLH 200

Query: 334 TIENITSNLNDSSQKFAELMSKINNISALKENNSLFKDAQRAMHTFRDTSEKINRYIPSI 393
           +++ +  N   +S++   +M ++              + +     F      I   +   
Sbjct: 201 SMKQLMKNSAKASEQLPTIMHQL---------QDTLANIKITARQFDRAGHGIELTVGDA 251

Query: 394 GNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFERNPQDIVWGR 440
              +Q+ S   L  +Q L+ KL  T  H        + NP  +V G+
Sbjct: 252 HTAMQSMSTQILPTVQQLLTKLNATAAHLQQLSIELQHNPSMLVRGK 298


>gi|304319771|ref|YP_003853414.1| hypothetical protein PB2503_00962 [Parvularcula bermudensis
           HTCC2503]
 gi|303298674|gb|ADM08273.1| hypothetical protein PB2503_00962 [Parvularcula bermudensis
           HTCC2503]
          Length = 310

 Score =  110 bits (272), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 38/131 (29%), Positives = 61/131 (46%), Gaps = 3/131 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++ +Y  +G F++  +  +     WL  +        E  I     + GL   ++V F
Sbjct: 1   METRAHYVLIGAFMLGGIVLTVLFTLWLGSAR---SEYDEYRIIFTQKISGLQEGANVLF 57

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NGIPVG +  L LDQE PN SLA   +   TP+   T   +   G+ G+  I+ +    E
Sbjct: 58  NGIPVGEVASLELDQENPNRSLALVRVDQGTPVKTDTGVELELAGVTGLAVIQFTGGSPE 117

Query: 121 KKTIFQIATER 131
              +  ++ ER
Sbjct: 118 APLLQNVSPER 128



 Score = 56.9 bits (134), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 27/183 (14%), Positives = 63/183 (34%), Gaps = 8/183 (4%)

Query: 271 TQTFQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNMRSSISAIREITDQRQKIIS 330
             T       +  +L        + +      N       +    S      D+  +I  
Sbjct: 129 IPTIDANLGGVAAVLESSGELALNLQRLISQRNAEAVGRVLADVESLTDIFADRENEIGL 188

Query: 331 TINTIENITSNLNDSSQKFAELMSKINNISALKENNSLFKDAQRAMHTFRDTSEKINRYI 390
            I+    +++ +  +++  +   ++++ + A  E   +  D ++A   F D +  +   I
Sbjct: 189 IIDNAAAVSTEMRVAAENISAASARLDAVLADVETV-VDGDVRQATEAFADAAVDLQELI 247

Query: 391 PSIGNNLQN-------FSQSGLNDIQNLVRKLQETVNHFDDCLNNFERNPQDIVWGREKG 443
             +   L+        F++ GL     +V K    V+     L  F+RNP     G  + 
Sbjct: 248 VEMREVLEENRGAIRSFTREGLGAAVAMVNKASRLVDTTQAILLEFDRNPAAFFVGEGRP 307

Query: 444 SVK 446
           + +
Sbjct: 308 TAR 310


>gi|315498541|ref|YP_004087345.1| mammalian cell entry related domain protein [Asticcacaulis
           excentricus CB 48]
 gi|315416553|gb|ADU13194.1| Mammalian cell entry related domain protein [Asticcacaulis
           excentricus CB 48]
          Length = 320

 Score =  110 bits (272), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 48/296 (16%), Positives = 109/296 (36%), Gaps = 4/296 (1%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME + +Y  VGL  + +   +F   +WL     ++   +E  +    SV+GL+    V F
Sbjct: 1   MERQAHYAVVGLITLVLTAAAFVFAFWL-IQGSFNETYSEYDVVFNSSVNGLTEGGEVHF 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NGI VG +  L L +      +A   +   TP+   +TA +   G+ G+ YI++S   KE
Sbjct: 60  NGIKVGEVKELRLGKANTAQVIATVRVDSSTPVRVDSTAVLEPLGVTGLNYIQISPGSKE 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKII-ENIEKPLTTT 179
              + +      +  +I AT S ++  ++ +    +   +S   I +++ ++     + T
Sbjct: 120 AALLKREPGIGARNPIIRATESRLDKLLAGSGGVIESAYESLNRINRLMSDDNLNAFSKT 179

Query: 180 IANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKV 239
           + NIE I++ +      + +          +             + +   ++    + + 
Sbjct: 180 MKNIEDITSDIGEVTEDLKQRKQLLDDAHEAIVQAGIAAENLSKLANSADVLVKDRVPQT 239

Query: 240 NQILENIQVSSNNFVKSSDQVINTVHDVRETTQT--FQEVGQKIDHLLSDFSSKMK 293
              +++      +       +                  +   + +L     S   
Sbjct: 240 MNRIDDAAAKLADAATEVANLSKVAQGPINEVSETTLPALSDSLRNLNQATRSVED 295


>gi|114570552|ref|YP_757232.1| hypothetical protein Mmar10_2002 [Maricaulis maris MCS10]
 gi|114341014|gb|ABI66294.1| Mammalian cell entry related domain protein [Maricaulis maris
           MCS10]
          Length = 316

 Score =  110 bits (272), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 41/136 (30%), Positives = 65/136 (47%), Gaps = 3/136 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K ++  VGLF V +L    F   WL + + +D   A   I   G V GL     VRF
Sbjct: 1   METKAHHALVGLFAVLLLAAGGFFALWLGKVS-FDEDYAFYDIVFDGPVRGLRESGEVRF 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NGI VG +  L LD    +  +A+  +   TP+  ++ A +  QGL G++Y+ ++    +
Sbjct: 60  NGIQVGEVTELELD--DQSRVIARIRVLAQTPVRTNSEAQLEPQGLTGLSYVLITGGTPD 117

Query: 121 KKTIFQIATERNQRAM 136
            + +   A     R  
Sbjct: 118 AQRLESPANRPVPRIF 133



 Score = 46.9 bits (108), Expect = 0.007,   Method: Composition-based stats.
 Identities = 22/203 (10%), Positives = 68/203 (33%), Gaps = 9/203 (4%)

Query: 253 FVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNMR 312
               +                      +++ L+      + + +T+ F      S  N+ 
Sbjct: 111 ITGGTPDAQRLESPANRPVPRIFARRAQLEGLVEGSEDVLDAAQTALFRLTALLSEQNVG 170

Query: 313 SSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNISALKENNSLFKDA 372
              + +  + +   ++      I ++ + L       +++ +   ++       + F D 
Sbjct: 171 EVSATLTNLREITDRLSEEEALIADMRNTLAGIDTAASDMSAAAMSLQEFGVTATAFLDN 230

Query: 373 QRAMHTFRDTSE---------KINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFD 423
           +  + T   T             N+ + ++   +++ + SG+ D+   +  L+  V   +
Sbjct: 231 EMTLATNETTLAAMAVNQAAADTNQIVLTLQPAIESLADSGVEDLNRTLSDLRRVVASLE 290

Query: 424 DCLNNFERNPQDIVWGREKGSVK 446
              +  E NP   + G  + +V+
Sbjct: 291 RITSEVESNPGGFIAGAPRETVE 313


>gi|126656905|ref|ZP_01728083.1| hypothetical protein CY0110_01964 [Cyanothece sp. CCY0110]
 gi|126621743|gb|EAZ92452.1| hypothetical protein CY0110_01964 [Cyanothece sp. CCY0110]
          Length = 458

 Score =  110 bits (272), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 51/437 (11%), Positives = 121/437 (27%), Gaps = 46/437 (10%)

Query: 10  VGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRFNGIPVGRIV 69
           VGLF +  L      + WL           +        V GL   + VR+ G+ VG+I+
Sbjct: 12  VGLFALFGLIIFGGLVVWLRG-GIIGQKTYQFFAEFKD-VSGLQIGAPVRYRGVAVGKIL 69

Query: 70  GLFLDQEYPNHSLAKALIRP-DTPLYPSTTATIRTQGLAGITYIELSTLRKEKKTIFQIA 128
           GL               I      +   +   I   GL G   ++++  R+  +    I 
Sbjct: 70  GLQPSSNG---VTVAVEISSAQLRIPKGSEVQINRYGLIGEASVDITPSRELSEDALSID 126

Query: 129 TERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTIANIETIST 188
                           +  +    +   +      +     E +           +    
Sbjct: 127 PTSEDCEQAGKILCNNDQVMGQTGSQLVEALTRLSNAYSDPEFVGNMNAALQNVAKAGGK 186

Query: 189 VLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVNQILENIQV 248
           V   +         T       SD   + +      + L + +  +  +    +   +  
Sbjct: 187 VATLSEEVTKLSKATRGEIGGVSDVLRSADQAAQDASQLMRNVNTVVAENRTDLNRTVSS 246

Query: 249 SSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAFLENIADST 308
           ++N        V     ++  T  + Q    ++  L  +F++ +          ++A   
Sbjct: 247 AANLISNLDGLVSENRGNIVNTLDSIQRTSDQVRFLALNFNTTVDRLNEGIDEIDMA--- 303

Query: 309 SNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNISALKENNSL 368
                                        + ++L       A+    + N+S    +  +
Sbjct: 304 ----------------------------KLANDLETLMTNAAQTSENLQNLSQSLNDPEV 335

Query: 369 FKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNN 428
               Q+ + + R T E   +    +     +               +++ ++   + +  
Sbjct: 336 LLTIQKTLDSARVTFENTQKITSDVEELTGD---------PTFRNNIRKLIDGLSNLVAY 386

Query: 429 FERNPQDIVWGREKGSV 445
            E+  Q +  G+   SV
Sbjct: 387 TEQLEQQVYVGQVIESV 403


>gi|258404806|ref|YP_003197548.1| Mammalian cell entry related domain-containing protein
           [Desulfohalobium retbaense DSM 5692]
 gi|257797033|gb|ACV67970.1| Mammalian cell entry related domain protein [Desulfohalobium
           retbaense DSM 5692]
          Length = 529

 Score =  110 bits (272), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 52/368 (14%), Positives = 117/368 (31%), Gaps = 9/368 (2%)

Query: 4   KNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRFNGI 63
           K     VG+FV   L    +    + +    D    +V +    +V GL   + V   GI
Sbjct: 5   KGAEIKVGIFVCIALVALGYMSMQVGQGLFVDKDTKKVSV-FFDNVSGLKQGAPVEIAGI 63

Query: 64  PVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKEKKT 123
            VG++  + L       +     +     +     A IRT+G+ G  ++EL     E   
Sbjct: 64  EVGQVHSIGLA---DGRAELTLALDKGIAVPVDVKAVIRTRGVLGDKFVELRGGSPEMPN 120

Query: 124 IFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTIANI 183
           +     E  QR   +++P+ ++  +      ++ IS  S+ +  +    +          
Sbjct: 121 L-----EEGQRITRSSSPADLDQLLQKVGQIAEDISTVSQSVSNVFGGEQGEAQLQTIMD 175

Query: 184 ETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVNQIL 243
                 +  N           ++  +          +T           +        + 
Sbjct: 176 NVRELTVTLNGLVQQNAESVERIVANLDGFTADMREMTARNKDQINDAVSDLGAFAANMR 235

Query: 244 ENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAFLEN 303
           E    + +   +    +      ++ T Q  Q+V  K+D       + +  +E +  L+ 
Sbjct: 236 EITGENKDGIQRIVTNLDRASGKLQTTMQAMQDVLGKVDEGQGTLGTMVNDEEMAYDLKK 295

Query: 304 IADSTSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNISALK 363
              S  ++   I   R    +     +T   ++     +N    K  +  + ++  S   
Sbjct: 296 TMASLESVSRKIDEGRGTLGKLVNDDTTGKELDKALEGVNTFLAKQEQFKTSVDFTSEYL 355

Query: 364 ENNSLFKD 371
            ++   K 
Sbjct: 356 ADSGDMKS 363


>gi|182680398|ref|YP_001834544.1| hypothetical protein Bind_3498 [Beijerinckia indica subsp. indica
           ATCC 9039]
 gi|182636281|gb|ACB97055.1| Mammalian cell entry related domain protein [Beijerinckia indica
           subsp. indica ATCC 9039]
          Length = 378

 Score =  109 bits (271), Expect = 8e-22,   Method: Composition-based stats.
 Identities = 67/379 (17%), Positives = 123/379 (32%), Gaps = 11/379 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+   Y  VGLF ++++   F    W   S           +R  G V GL T S+V+F
Sbjct: 1   METTARYLWVGLFSLAVIAAGFILYLWSHNSGGLAKHSY-YQVRFAGPVSGLQTGSTVQF 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NGI VG +  L LD   P+   A   I P TP+   T   I  QGL G   I LS     
Sbjct: 60  NGIRVGEVTALALDARDPSSLTATIAIAPGTPVRSDTKIDINFQGLLGTPAIALSGGTLT 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
              +    T           P  +       ++ ++    + +HI KI+++    L  T+
Sbjct: 120 APELHGSET----------QPPLLRADALTGQDLTQAARAALQHINKILDDNADSLKGTL 169

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
            N++T + VLA N    DK++                      +T           +   
Sbjct: 170 GNLKTFTDVLARNTGDFDKIIAGLVKLAGGGPEAKPKPVYDLTVTQATPAPAPKGKKLGQ 229

Query: 241 QILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAF 300
            ++     +     +             +    + +   K+       S + +    S  
Sbjct: 230 IVIAEPTTTVVFDTQRLLARSKDGEFTPQGEMQWADSIPKLVQEKMVQSFENEGLIGSVT 289

Query: 301 LENIADSTSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNIS 360
                 +      +      +T   +       +++ +    +  + K   +   + +  
Sbjct: 290 APVEGVTRQYQLLTDIRNFAVTSDSRPSADVELSVKLMNEEGHVIAGKIFHVTVPVESED 349

Query: 361 ALKENNSLFKDAQRAMHTF 379
             K   +  +   +AM   
Sbjct: 350 TSKVVAAFSQAFNQAMTEL 368


>gi|295677862|ref|YP_003606386.1| Mammalian cell entry related domain protein [Burkholderia sp.
           CCGE1002]
 gi|295437705|gb|ADG16875.1| Mammalian cell entry related domain protein [Burkholderia sp.
           CCGE1002]
          Length = 202

 Score =  109 bits (271), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 28/117 (23%), Positives = 41/117 (35%), Gaps = 1/117 (0%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M+       VGLFVV       F    +   +         +     ++ GL   + V+ 
Sbjct: 24  MKKNVLDFWVGLFVVLGFVALLFLALKVGNMSSLSFQATYPVKLKFDNIGGLKPRAPVKS 83

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTL 117
            G+ VGR+  +  D      +L    I         T+A I T GL G  YI L   
Sbjct: 84  AGVTVGRVASIGFDSNTY-QALVTIDIDKQFEFPRDTSAKILTSGLLGEQYIGLEPG 139


>gi|146277757|ref|YP_001167916.1| hypothetical protein Rsph17025_1718 [Rhodobacter sphaeroides ATCC
           17025]
 gi|145555998|gb|ABP70611.1| Mammalian cell entry related domain protein [Rhodobacter
           sphaeroides ATCC 17025]
          Length = 321

 Score =  109 bits (271), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 50/326 (15%), Positives = 111/326 (34%), Gaps = 7/326 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++  Y  +G+F +  +  +   + WL++    D   AE  I    SV+GL   S VR+
Sbjct: 1   METRARYVLIGIFTLLSILATLGFLLWLAKVE-LDRTYAEYDILFT-SVEGLGRASPVRY 58

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NG+ VG ++ + +D+E  +    +  +   TP+   T A + +QG+ G++Y+ LS     
Sbjct: 59  NGVDVGEVLTIEVDEEDSSLVRVRIQLAATTPVRTDTRAQVASQGVTGVSYVALSGGAAP 118

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
           +      A E     +I +  S +    ++A     +     + IQ       +    +I
Sbjct: 119 EPL---QAEEGQWPPVIPSERSAVQALTADAPTLLAEAIALLKDIQTFTGPENRAAVESI 175

Query: 181 ANIETISTVLAN--NISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQK 238
                 S            +        T       +        + +  +  +      
Sbjct: 176 LTNADASVQNIAAITRDASEATARLNDFTARLDTMADRAEEALATLETALEEGQGAASAA 235

Query: 239 VNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETS 298
            +      +V   +      Q+ + V  + ++    +          +  +++ +   T+
Sbjct: 236 RDTFESVNRVVDQDVPPMLAQIRSAVAGIEQSVAGIRNFADNGLPQYASLAAETRRTVTN 295

Query: 299 AFLENIADSTSNMRSSISAIREITDQ 324
                   S    R  +        +
Sbjct: 296 FNSLIAQISRDPARFFLGNQTPSYRR 321



 Score = 60.3 bits (143), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 27/201 (13%), Positives = 60/201 (29%), Gaps = 16/201 (7%)

Query: 263 TVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNMRSSISAIREIT 322
              +  +           +  L +D  + +                 N  +  S +    
Sbjct: 121 LQAEEGQWPPVIPSERSAVQALTADAPTLLAEAIALLKDIQTFTGPENRAAVESILTNAD 180

Query: 323 DQRQKIISTINTIENITSNLNDSSQKFAELMSKINNISAL-----KENNSLFKDAQRAMH 377
              Q I +        T+ LND + +   +  +     A      +E       A+    
Sbjct: 181 ASVQNIAAITRDASEATARLNDFTARLDTMADRAEEALATLETALEEGQGAASAARDTFE 240

Query: 378 TFRDTSEK--------INRYIPSIGNNLQ---NFSQSGLNDIQNLVRKLQETVNHFDDCL 426
           +     ++        I   +  I  ++    NF+ +GL    +L  + + TV +F+  +
Sbjct: 241 SVNRVVDQDVPPMLAQIRSAVAGIEQSVAGIRNFADNGLPQYASLAAETRRTVTNFNSLI 300

Query: 427 NNFERNPQDIVWGREKGSVKI 447
               R+P     G +  S + 
Sbjct: 301 AQISRDPARFFLGNQTPSYRR 321


>gi|78222006|ref|YP_383753.1| virulence factor MCE-like protein-related protein [Geobacter
           metallireducens GS-15]
 gi|78193261|gb|ABB31028.1| Mammalian cell entry-related protein [Geobacter metallireducens
           GS-15]
          Length = 150

 Score =  109 bits (271), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 29/133 (21%), Positives = 49/133 (36%), Gaps = 1/133 (0%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M+       VG+FV   +    +    L +     G   EV      SV GL   ++V  
Sbjct: 1   MKKVTLELIVGIFVAIGILCLGWLSVKLGKMELVGGDHYEVYAEF-DSVSGLKEGAAVEI 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G+ VGR+  + LD ++ + +     I     L     A++RT G+ G  +I L     +
Sbjct: 60  AGVEVGRVDRIALDPKFNDRARVSMRIANGVKLQDDVIASVRTSGIIGDKFILLKPGGSD 119

Query: 121 KKTIFQIATERNQ 133
                       +
Sbjct: 120 NFLADNGRIRETE 132


>gi|78357342|ref|YP_388791.1| putative ABC transport system substrate-binding protein
           [Desulfovibrio desulfuricans subsp. desulfuricans str.
           G20]
 gi|78219747|gb|ABB39096.1| putative ABC transport system substrate-binding protein
           [Desulfovibrio desulfuricans subsp. desulfuricans str.
           G20]
          Length = 148

 Score =  109 bits (270), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 37/120 (30%), Positives = 57/120 (47%), Gaps = 2/120 (1%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M      TSVG+FV+  L    +    L +   +      V  R   SV GL   + V  
Sbjct: 1   MNKYTKETSVGIFVLIGLLCLGYVTVKLGKMEVFSSEGYTVQARFT-SVTGLRVGADVEI 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           +G+PVG++ G+ LD +  N ++    +RPD  L   T A+++T GL G  Y++LS     
Sbjct: 60  SGVPVGKVSGINLD-QMDNVAVVSLRLRPDVELSEDTIASVKTSGLIGDKYVKLSPGGAM 118


>gi|163793379|ref|ZP_02187354.1| hypothetical protein BAL199_02689 [alpha proteobacterium BAL199]
 gi|159181181|gb|EDP65696.1| hypothetical protein BAL199_02689 [alpha proteobacterium BAL199]
          Length = 335

 Score =  109 bits (270), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 58/305 (19%), Positives = 119/305 (39%), Gaps = 5/305 (1%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++  Y  VG FV+++         W     + D  + + +I   GSV GLS  S VR+
Sbjct: 1   METRAGYAVVGAFVLALFLGGLGLAVWFGNV-RLDQDVRDYLIEFDGSVGGLSVGSRVRY 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           +G+PVG +  + +D +          +    P+  +  AT+ +QGL G+ +I++    ++
Sbjct: 60  HGVPVGSVTDIRIDPDNVEKVAVTVELDAAIPIKVNMYATLESQGLTGLGFIQIQGGTRD 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQ-KIIENIEKPLTTT 179
              +     E     +I +  S +     +A   + ++     H+Q  + ++ +K +   
Sbjct: 120 APNLQVA--EAGTLPLIPSRASRLEKVFQSAPEIAGQLVTLIAHLQGFLSDDNQKSVRDI 177

Query: 180 IANIETISTVLANNISHIDKMMHTTQVTPHSSDSKN-TFNTITDLITSLDKMIKAIDLQK 238
           + N+ T+S VLA     I+  +           +       +   +    K I       
Sbjct: 178 LRNLATVSAVLAQRTDEIETAVVDGAAAATEVRAAMADLTPLIKELRGNFKTITEEVSVT 237

Query: 239 VNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETS 298
           ++     +        K SD++  T   +  T    + +  +    + DFS+    + T 
Sbjct: 238 LSAARGTVTGVDAEIGKLSDRLAFTTERIGGTAAQLEALLGEARPGMRDFSNSGLYELTQ 297

Query: 299 AFLEN 303
              E 
Sbjct: 298 FLFEA 302



 Score = 63.0 bits (150), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 25/213 (11%), Positives = 67/213 (31%), Gaps = 6/213 (2%)

Query: 240 NQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSA 299
             +      +       + ++        E       +   +   LSD + K        
Sbjct: 121 PNLQVAEAGTLPLIPSRASRLEKVFQSAPEIAGQLVTLIAHLQGFLSDDNQKSVRDILRN 180

Query: 300 FLENIADSTSNMRSSISAIREITDQRQKIISTINTIE----NITSNLNDSSQKFAELMSK 355
                A          +A+ +      ++ + +  +      +  N    +++ +  +S 
Sbjct: 181 LATVSAVLAQRTDEIETAVVDGAAAATEVRAAMADLTPLIKELRGNFKTITEEVSVTLSA 240

Query: 356 INNISA--LKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVR 413
                     E   L             T+ ++   +      +++FS SGL ++   + 
Sbjct: 241 ARGTVTGVDAEIGKLSDRLAFTTERIGGTAAQLEALLGEARPGMRDFSNSGLYELTQFLF 300

Query: 414 KLQETVNHFDDCLNNFERNPQDIVWGREKGSVK 446
           + +E V + D  +    R+P   ++G+ +G V+
Sbjct: 301 EARELVGNLDRVVRQLNRDPSQFLFGKREGQVE 333


>gi|172037582|ref|YP_001804083.1| hypothetical protein cce_2669 [Cyanothece sp. ATCC 51142]
 gi|171699036|gb|ACB52017.1| unknown [Cyanothece sp. ATCC 51142]
          Length = 455

 Score =  109 bits (270), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 51/439 (11%), Positives = 122/439 (27%), Gaps = 46/439 (10%)

Query: 10  VGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRFNGIPVGRIV 69
           VGLF +  L      + WL           +        V GL   + VR+ G+ VG+I+
Sbjct: 12  VGLFALFGLIIFGGLVVWLRG-GIIGQKTYQFFAEFKD-VSGLQIGAPVRYRGVAVGKIL 69

Query: 70  GLFLDQEYPNHSLAKALIRP-DTPLYPSTTATIRTQGLAGITYIELSTLRKEKKTIFQIA 128
           GL               I      +   +   I   GL G   ++++  R+  +    I 
Sbjct: 70  GLQPSSNG---VTVAVEISSAQLRIPKGSKVQINRYGLIGEASVDITPSRELSEDALSID 126

Query: 129 TERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTIANIETIST 188
                           +  +    +   +      +     E +           +    
Sbjct: 127 PTSEDCEQAGKILCNNDQVMGQTGSQLVEALTRLSNAYSDPEFVGNMNAALQNVAKAGGK 186

Query: 189 VLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVNQILENIQV 248
           V   +         T       SD   + +      + L + +  +  +    +   ++ 
Sbjct: 187 VATLSEEVTKLSKATRGEIGGVSDVLRSADQAAQDASQLMRNVNTVVAENRTDLNRTVRS 246

Query: 249 SSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAFLENIADST 308
           ++N        V     ++  T  + +    ++  L  +F++ +          ++A   
Sbjct: 247 AANLMSNLDGLVSENRGNIVNTLDSIERTSDQVRLLALNFNTTVDRVNEGIDEIDMA--- 303

Query: 309 SNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNISALKENNSL 368
                                        + ++L       A+    + N+S    +  +
Sbjct: 304 ----------------------------KLANDLETLMSNAAQTSENLQNLSQSLNDPEV 335

Query: 369 FKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNN 428
               Q+ + + R T E   +    +     +               +++ ++   + +  
Sbjct: 336 LLTIQKTLDSARVTFENTQKITSDVEELTGD---------PTFRNNIRKLIDGLSNLVAY 386

Query: 429 FERNPQDIVWGREKGSVKI 447
            E+  Q I  G+   SV  
Sbjct: 387 TEQLEQQIYVGQVIESVTE 405


>gi|218885957|ref|YP_002435278.1| hypothetical protein DvMF_0854 [Desulfovibrio vulgaris str.
           'Miyazaki F']
 gi|218756911|gb|ACL07810.1| Mammalian cell entry related domain protein [Desulfovibrio vulgaris
           str. 'Miyazaki F']
          Length = 148

 Score =  109 bits (270), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 35/122 (28%), Positives = 54/122 (44%), Gaps = 2/122 (1%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M+  +  TSVG+FV+  L    +    L R          V  R   S+ GL   + V  
Sbjct: 1   MKKYSRETSVGIFVLIGLLCVGYLTIKLGRMELLSDKGYTVHARFT-SITGLRVGAEVEI 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G+PVGR+ G+ L  + P  ++    +R    L     A+++T GL G  YI+LS     
Sbjct: 60  AGVPVGRVAGINLAPDKP-VAVVSLRMREGVHLTDDVIASVKTSGLIGDKYIKLSPGGSP 118

Query: 121 KK 122
            +
Sbjct: 119 DQ 120


>gi|168700260|ref|ZP_02732537.1| hypothetical protein GobsU_12080 [Gemmata obscuriglobus UQM 2246]
          Length = 504

 Score =  109 bits (270), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 53/473 (11%), Positives = 139/473 (29%), Gaps = 34/473 (7%)

Query: 9   SVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRFNGIPVGRI 68
            +GLF+ + L      +     + +      +  +       GL   + +R +G+ +G++
Sbjct: 2   RLGLFMGASLLALAGLVVLFGGTPRVFSSDVKYSVLFSE-APGLGPGTPIRKSGVRIGQV 60

Query: 69  VGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGI-TYIELSTLRKEKKTIFQI 127
            G+ LD E       +  +        S  A I    L+G      L  L  + + + + 
Sbjct: 61  TGVELDPES-GQVRVRIELDRKYLPRKSEEAHITRGLLSGDTAVDFLPKLGPDSQPVPRG 119

Query: 128 ATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTIANIETIS 187
                   +   TP      ++ A N  +    S   + K  E +E+  +     IE  +
Sbjct: 120 EDWPPGSEIPGVTPITPRSLVAPASNALQNAQQSLERMTKAFEKLERL-SEVGPRIEATA 178

Query: 188 TVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVNQILENIQ 247
                    +   +   + T     +    +               I  +     +    
Sbjct: 179 DEATALFKDVRAFIPELRKTNAKIQNILGPDGPVPPKGPPAPGAAPIGAELPVGFVSTQP 238

Query: 248 VSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAFLENIADS 307
                         +    +R       +V   +  L  + ++ +K   T+    N   S
Sbjct: 239 PLVPEEPNLKTLFRDAQDALRTIKPAVDDVRAAVKRLEPEVAAAVKGARTAFDNVNDVLS 298

Query: 308 TSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNISAL--KEN 365
             N +     ++ +      ++     +  +  +   + +   + ++++  + A      
Sbjct: 299 PENRKQFAELLKNLNSVALNVVKFAGALGTLLDSAEKTVKNIDDRVTEVGQVVADVRAVT 358

Query: 366 NSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQS-------------------GLN 406
             L   ++  +    +++E++ + I  I   +  F +                       
Sbjct: 359 RPLAARSEGLVKGVAESAEQLGKLIAEIRGIVNAFGKENGTVQKLISDPTVYQNLDLAAG 418

Query: 407 DIQNLVRKLQETVNHFDDCLNNFERNPQDIVWGR---------EKGSVKIYKP 450
            +  ++ + ++     +   +   R P+ I  G          E      Y+P
Sbjct: 419 SLARILARSEKITRDLEVFADKVARRPELIGVGGALRGSGGLKELPGTPSYRP 471


>gi|254411405|ref|ZP_05025182.1| mce related protein [Microcoleus chthonoplastes PCC 7420]
 gi|196181906|gb|EDX76893.1| mce related protein [Microcoleus chthonoplastes PCC 7420]
          Length = 469

 Score =  109 bits (270), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 66/438 (15%), Positives = 151/438 (34%), Gaps = 38/438 (8%)

Query: 1   MESKN-YYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVR 59
           M S+     SVGL ++  L        W+    ++       ++  P +V G+   ++VR
Sbjct: 1   MRSRTIREGSVGLLILVGLAVFAGLAIWIRGL-KFGNRSYSFVVNFP-NVAGMKEGATVR 58

Query: 60  FNGIPVGRIVGLFLDQEYPNHSLAKALI-RPDTPLYPSTTATIRTQGLAGITYIELSTLR 118
           + G+ VG I  +               I   D  +           GL G T ++++ LR
Sbjct: 59  YRGVDVGNITDIEATTNG---VDVTIEIASEDLVIPEDVAIEANQSGLIGETSVDITPLR 115

Query: 119 KEKKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTT 178
           +    I  +   +++        SG         +  + + ++ R      + +      
Sbjct: 116 EVSSNIQSMNPLKSECNSDVIICSGEQIEGEIGVSFIELLRNTERLTTIYTDPLFFNNIN 175

Query: 179 TIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQK 238
           ++A   +++      ++    ++  +        S+ +    T    +  ++    D   
Sbjct: 176 SLAQNASLAASGIAQLAGELSLLSRSVRQEVGGFSQASDAITTAATQTTQRIGDTADQFS 235

Query: 239 VNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETS 298
              +  N          ++D V      +  T  +  +  +++  LLSD    +++  T+
Sbjct: 236 QTAVQLN-----RLIASTNDLVTRNRAVLVGTLTSVGQTSEQLGVLLSDLRPTLENVNTT 290

Query: 299 AFLENIADSTSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINN 358
             L N     +++ +                  I  +E  + NL   S   AEL + + +
Sbjct: 291 IDLVNTQVDQADVSTI-----------------IENVETASENLVALSANAAELSADLRD 333

Query: 359 ISALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQET 418
           IS   ++ S     Q+ + + R T E   +    + +   +             + L+E 
Sbjct: 334 ISNSLDSPSTAIVLQQLLDSARVTFENTQKITSDLEDLTGD---------PAFRQNLKEL 384

Query: 419 VNHFDDCLNNFERNPQDI 436
           VN   + +++ E+  Q I
Sbjct: 385 VNGLSELVSSTEQLEQQI 402


>gi|91776720|ref|YP_546476.1| hypothetical protein Mfla_2368 [Methylobacillus flagellatus KT]
 gi|91710707|gb|ABE50635.1| Mammalian cell entry related protein [Methylobacillus flagellatus
           KT]
          Length = 316

 Score =  108 bits (269), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 45/299 (15%), Positives = 109/299 (36%), Gaps = 7/299 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++ +  +VG+  + ++    F+ +W+S S Q   P+ E  I     V GL+ ++SV+F
Sbjct: 1   MENRAHALAVGIATLILVAILAFAFWWMSGSRQ---PLTEYKIISRQPVTGLNQEASVKF 57

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G+ VG++  + LD +  +       +     L     A +R+QG+ G+ YI+L+    +
Sbjct: 58  RGVNVGKVSSIALDPDSQSSIEITIRVDEKLHLTKDAYAELRSQGVTGLAYIDLNDPNDD 117

Query: 121 KKTIFQIATERNQR----AMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPL 176
            + +   +    +      +    P  ++   S   +  + I  ++  +Q I        
Sbjct: 118 GEQLPPGSLITMRPSLIDRISERVPRLVDKVESFVNHGVETIEQANTMMQSIDVKRLNQT 177

Query: 177 TTTIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDL 236
            + +    +       + +             +      T N +     +   ++  +  
Sbjct: 178 LSNLEEASSKLGPALVSANEAFGQATKLLSEQNQQQFTQTLNNLQAATQAATPLLNELTA 237

Query: 237 QKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSK 295
              +       + ++  +        T+  + E T       ++I  +L       +S 
Sbjct: 238 TVHDVRGMTGDIRNSASLIGDTLNHETLPQLNELTANASNDARRISRILDMLEENPQSL 296



 Score = 51.5 bits (120), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 23/173 (13%), Positives = 55/173 (31%), Gaps = 7/173 (4%)

Query: 268 RETTQTFQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNMRSSISAIREITDQRQK 327
              ++    +  K++  ++     ++   T     ++      + +   A  ++      
Sbjct: 135 DRISERVPRLVDKVESFVNHGVETIEQANTMMQSIDVKRLNQTLSNLEEASSKLGPALVS 194

Query: 328 IISTINTIENITSNLNDSSQKFAELMSKINNISALKENNSLFKDAQRAMHTFRDTSEKIN 387
                     + S  N   Q+F + ++ +    A +    L  +    +H  R  +  I 
Sbjct: 195 ANEAFGQATKLLSEQNQ--QQFTQTLNNLQA--ATQAATPLLNELTATVHDVRGMTGDIR 250

Query: 388 RYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFERNPQDIVWGR 440
                IG+ L       L  +  L              L+  E NPQ +++G+
Sbjct: 251 NSASLIGDTLN---HETLPQLNELTANASNDARRISRILDMLEENPQSLLFGK 300


>gi|295690464|ref|YP_003594157.1| mammalian cell entry related domain-containing protein [Caulobacter
           segnis ATCC 21756]
 gi|295432367|gb|ADG11539.1| Mammalian cell entry related domain protein [Caulobacter segnis
           ATCC 21756]
          Length = 312

 Score =  108 bits (269), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 48/300 (16%), Positives = 105/300 (35%), Gaps = 6/300 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME    Y  VG   +++         WL++ + +        +   G V GLS      F
Sbjct: 1   MERNANYAVVGAVTLALFMGLIVFAVWLAKIS-FSRDYDLYDVLFVGPVRGLSQGGEAHF 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NGI VG +  + LD+  PN  +A+  +  D P+   + AT+  QG+ G+ YI+++     
Sbjct: 60  NGIKVGEVTRIELDKSDPNRVIARIRVTSDVPIKVDSYATLEPQGITGVNYIQITAGSPN 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
           K+ +           + +   +  +         ++ I    R  + + +N  K  +  +
Sbjct: 120 KELLKDTVKGGRVPVLRSQRSALSDLLEGGGTVLTRTIEALDRVNRVLSDNNIKTFSAAL 179

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIK-----AID 235
           ++++ ++  +      I       Q    ++ S        D + + D            
Sbjct: 180 SDVQAVTAEMRERKEVIADAQKALQSIDQTAQSITQLANSADGVVNGDAKRTLKELGDAA 239

Query: 236 LQKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSK 295
            +      +   +       +SD     +  +     T Q   + +D L+ +     +  
Sbjct: 240 AELKAAAKDARGMVGKLEGPTSDFATTGLPQLSAAIVTLQSAAESLDRLVGEVEQNPRGA 299


>gi|307150087|ref|YP_003885471.1| Mammalian cell entry related domain-containing protein [Cyanothece
           sp. PCC 7822]
 gi|306980315|gb|ADN12196.1| Mammalian cell entry related domain protein [Cyanothece sp. PCC
           7822]
          Length = 474

 Score =  108 bits (269), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 42/395 (10%), Positives = 133/395 (33%), Gaps = 15/395 (3%)

Query: 10  VGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRFNGIPVGRIV 69
           VGLF +  L        WL     +      +I+    +V GL   + V++ G+ VGR+ 
Sbjct: 12  VGLFALLGLVIFGGITIWLRG-GNWGQTSYRLIVYF-DNVAGLQLGAPVQYRGVQVGRLT 69

Query: 70  GLFLDQEYPNHSLAKALIRP-DTPLYPSTTATIRTQGLAGIT---YIELSTLRKEKKTIF 125
            L       N   A   I   D  +  + T      GL G         + L  + +++ 
Sbjct: 70  ALKP---KDNQVEAILEISSTDLRIPRNVTIQTNRYGLIGEPAIDITPNAQLSPQAQSMS 126

Query: 126 QIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTIANIET 185
            +  + NQ+ ++                +  +++ +    +      +      +   + 
Sbjct: 127 PLGKQCNQQLILCDNTRIQGESGGQLIESLTRLAQTYSDPEFFQNLNKAAKNANLTLKDI 186

Query: 186 ISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVNQILEN 245
                  +       +   +V+ + + +  + +   D  ++      ++ L+    + + 
Sbjct: 187 SRLTKEFSNLSKTAQLEIRKVSGNFATTSASVSRTADSASNFVNNANSVLLENRQALNQA 246

Query: 246 IQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAFLENIA 305
           I  ++     ++  V+     +    ++   +  ++  L ++ +       T+    N  
Sbjct: 247 INNANQLVSNANQLVVENRQRISTAIESINRMSDRLTLLAANLNKTAVKINTTLDSANTE 306

Query: 306 DSTSNMRSSISAIREITDQRQKIISTINTIE------NITSNLNDSSQKFAELMSKINNI 359
               ++ + ++    ++ + +++   IN             +   + +   ++ S ++ +
Sbjct: 307 KMVDDLETLLTNAAAVSKELREVSEKINDPTVILTLQQTLDSARVTFENTQKITSDVDEL 366

Query: 360 SALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIG 394
               E  S  +     +     +S+++ + + ++ 
Sbjct: 367 VGDPEFRSNLRRLVNGLSNLVSSSQQLQKQMATVE 401


>gi|291568100|dbj|BAI90372.1| hypothetical protein [Arthrospira platensis NIES-39]
          Length = 460

 Score =  108 bits (269), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 49/448 (10%), Positives = 140/448 (31%), Gaps = 37/448 (8%)

Query: 1   MESKN-YYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVR 59
           M S++    SVGL ++  +     + +WL           ++    P S  GL     VR
Sbjct: 1   MRSRSVREGSVGLLIILGVGLFGATAFWLRGL-TLGQQSYQIRAEFP-SATGLQIGVPVR 58

Query: 60  FNGIPVGRIVGLFLDQEYPNHSLAKALIRP-DTPLYPSTTATIRTQGLAGITYIELSTLR 118
           + G+ VGR+  +               I   D  +  ++   +   G    TY+++    
Sbjct: 59  YRGVKVGRVTRIQPQSNG---VEVVLNIESTDLVMPRNSQVLVNQTGFLNETYVDIIPNA 115

Query: 119 KEKKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTT 178
                +                          + +     S          + + + +  
Sbjct: 116 VLTPELVAANPISAT---------------CPSSDILCHESSIQGLPGISPDRLMETMLD 160

Query: 179 TIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQK 238
                         N +  +  +   + T  ++            + +    +       
Sbjct: 161 LGELYGNPELFANLNAAVENTALAAAEATKLTTQMGQLVEIAKLELGNFSASVDQNMNLF 220

Query: 239 VNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETS 298
            +++ +       +  + S   + + + +   T     + Q+++ L++   S + +    
Sbjct: 221 SSEMTQLSDQLERSMQEVSGAALQSANSLDRVTGDISALTQEVNALVATNRSTLLTT--- 277

Query: 299 AFLENIADSTSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINN 358
             L NI +++  +  +I+ +  +  + ++    +  +E +++N   +S+   ++   +NN
Sbjct: 278 --LNNINETSQELSVAIATLTPVIARFEQGEL-LTNLETLSANAVIASENLRDVSKTVNN 334

Query: 359 ISALKENNSLFKDAQRAMHTFRDTSEKINRYIPS--IGNNLQNFSQSGLNDIQNLVRKLQ 416
              L         A+  +   +  +  I        + ++L+     GL +I     +L+
Sbjct: 335 PDNLILLQQTLDSARSTLQNMQKVTADIEDLTGDPRLRDSLRRIIN-GLGNILASTEELE 393

Query: 417 E------TVNHFDDCLNNFERNPQDIVW 438
                  T+          +     +++
Sbjct: 394 RQTAVAETLAPLSQAAEAGDEKTIKLLF 421


>gi|284052669|ref|ZP_06382879.1| methyl-accepting chemotaxis sensory transducer [Arthrospira
           platensis str. Paraca]
          Length = 460

 Score =  108 bits (269), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 49/448 (10%), Positives = 140/448 (31%), Gaps = 37/448 (8%)

Query: 1   MESKN-YYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVR 59
           M S++    SVGL ++  +     + +WL           ++    P S  GL     VR
Sbjct: 1   MRSRSVREGSVGLLIILGVGLFGATAFWLRGL-TLGQQSYQIRAEFP-SATGLQIGVPVR 58

Query: 60  FNGIPVGRIVGLFLDQEYPNHSLAKALIRP-DTPLYPSTTATIRTQGLAGITYIELSTLR 118
           + G+ VGR+  +               I   D  +  ++   +   G    TY+++    
Sbjct: 59  YRGVKVGRVTRIQPQSNG---VEVVLNIESTDLVMPRNSQVLVNQTGFLNETYVDIIPNA 115

Query: 119 KEKKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTT 178
                +                          + +     S          + + + +  
Sbjct: 116 VLTPELVAANPISAT---------------CPSSDILCHESSIQGLPGISPDRLMETMLD 160

Query: 179 TIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQK 238
                         N +  +  +   + T  ++            + +    +       
Sbjct: 161 LGELYGNPELFANLNAAVENTALAAAEATKLTTQMGQLVEIAKLELGNFSASVDQNMNLF 220

Query: 239 VNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETS 298
            +++ +       +  + S   + + + +   T     + Q+++ L++   S + +    
Sbjct: 221 SSEMTQLSDQLERSMQEVSGAALQSANSLDRVTGDISALTQEVNALVATNRSTLLTT--- 277

Query: 299 AFLENIADSTSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINN 358
             L NI +++  +  +I+ +  +  + ++    +  +E +++N   +S+   ++   +NN
Sbjct: 278 --LNNINETSQELSVAIATLTPVIARFEQGEL-LTNLETLSANAVIASENLRDVSKTVNN 334

Query: 359 ISALKENNSLFKDAQRAMHTFRDTSEKINRYIPS--IGNNLQNFSQSGLNDIQNLVRKLQ 416
              L         A+  +   +  +  I        + ++L+     GL +I     +L+
Sbjct: 335 PDNLILLQQTLDSARSTLQNMQKVTADIEDLTGDPRLRDSLRRIIN-GLGNILASTEELE 393

Query: 417 E------TVNHFDDCLNNFERNPQDIVW 438
                  T+          +     +++
Sbjct: 394 RQTAVAETLAPLSQAAEAGDEKTIKLLF 421


>gi|297569475|ref|YP_003690819.1| Mammalian cell entry related domain protein [Desulfurivibrio
           alkaliphilus AHT2]
 gi|296925390|gb|ADH86200.1| Mammalian cell entry related domain protein [Desulfurivibrio
           alkaliphilus AHT2]
          Length = 316

 Score =  108 bits (269), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 40/180 (22%), Positives = 77/180 (42%), Gaps = 6/180 (3%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+++Y  + G+FV+ +      +I+W +   +  G   E I+   G++  L+  + VRF
Sbjct: 1   MENRSYALAAGIFVLVLGTAMVLAIWWFAGERELAG---EYILVTEGNIGNLNVGADVRF 57

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            GI  G++  + LD E P   L    I    P+   T A + TQG+ G+ Y++L     +
Sbjct: 58  RGIAAGKVTDIRLDAEDPRQILVTIRIDDQLPVTRGTVAVLDTQGVTGVAYVQLEDDGSD 117

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
            + +     E      +   PS +      A    + +   S ++ K +    +     +
Sbjct: 118 PRPLVA---EPGYPPRLPLKPSMLTRIAEAALEAMQGLELMSNNLAKFLSAENQVRFDEM 174


>gi|27381003|ref|NP_772532.1| hypothetical protein bll5892 [Bradyrhizobium japonicum USDA 110]
 gi|27354169|dbj|BAC51157.1| bll5892 [Bradyrhizobium japonicum USDA 110]
          Length = 292

 Score =  108 bits (268), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 46/241 (19%), Positives = 93/241 (38%), Gaps = 6/241 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++  Y  +G F ++++  +   + W    +      + + +   G   GL    SV F
Sbjct: 1   METRANYVLIGSFTLAVIAAAIGFVLWFQSLHTT-KQRSPLRVVFEGPAAGLRNGGSVNF 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NGI VG +V + LD   P   +A A++  + P+   T   +  QGL G+  I L    + 
Sbjct: 60  NGIRVGEVVSVKLD--NPRRVVALAMVENNAPIRKDTLVGLEFQGLTGVAAISLKGGEE- 116

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
                    + +    +TA P+ +         T + I+      Q+ ++N  K L T  
Sbjct: 117 --AAPPPPLDEDGIPSLTADPNKLQDVTEAIRGTLQNINKIVADNQESVKNSLKNLETFT 174

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
            ++   S  +   ++ +D +M          ++        +L  ++  + +  D     
Sbjct: 175 NSLARNSEKIDGVMAKVDGVMLKADNLMLGLNTLAGGKDGGELFQAVKSIRELADDFDKR 234

Query: 241 Q 241
            
Sbjct: 235 S 235



 Score = 50.7 bits (118), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 22/131 (16%), Positives = 58/131 (44%), Gaps = 8/131 (6%)

Query: 313 SSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNISALKENNSLFKDA 372
           +  +  + + D ++ + +++  +E  T++L  +S+K   +M+K++ +    +N  L  + 
Sbjct: 148 TLQNINKIVADNQESVKNSLKNLETFTNSLARNSEKIDGVMAKVDGVMLKADNLMLGLNT 207

Query: 373 QRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFERN 432
                       ++ + + SI     +F +        L+   + T+      +NNF+RN
Sbjct: 208 LAGGKD----GGELFQAVKSIRELADDFDKRS----GLLISDGRRTLGDISRAVNNFDRN 259

Query: 433 PQDIVWGREKG 443
           P  +++G    
Sbjct: 260 PTRVLFGASNS 270


>gi|313202097|ref|YP_004040755.1| mammalian cell entry related domain-containing protein
           [Methylovorus sp. MP688]
 gi|312441413|gb|ADQ85519.1| Mammalian cell entry related domain protein [Methylovorus sp.
           MP688]
          Length = 314

 Score =  108 bits (268), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 49/299 (16%), Positives = 115/299 (38%), Gaps = 7/299 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++++  +VGLF + +   + F+ +WLS S           I     V GL+ ++SV+F
Sbjct: 1   MENRSHAIAVGLFTLILGLAAIFAFWWLSGSR---EEKTHYTINSNRPVSGLNPEASVKF 57

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G+ VG+++ + LD    N       +     L  +  A +R QG+ G+ YI+L+     
Sbjct: 58  RGVEVGKVLHISLDDNTQNDIHVDIEVTKTLQLSKAAYAELRLQGVTGLAYIDLNDDGSS 117

Query: 121 KKTIFQIATERNQR----AMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPL 176
           ++ +    T   +           P  I    +  +++S+  + +   +QKI  +     
Sbjct: 118 QQRLGPDDTIPLRPSFVDRFTEHAPEIIEQVETLVKSSSQLAATAHEMVQKIDTDQLNRT 177

Query: 177 TTTIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDL 236
              +         L    +     + +     +    ++T  ++     ++  ++  +  
Sbjct: 178 IANLEKASAQLEPLLRTSTATMNRLGSFASERNRQQLESTLKSLQQTSDAVRPLMDTLGQ 237

Query: 237 QKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSK 295
              +       ++ ++   S     +T+  +   T + Q   Q+ + L+       +S 
Sbjct: 238 SARDFSSMTGTLTQSSQQLSDSLQQDTLPRLNALTDSLQRDSQQFEQLMETLEDHPQSL 296



 Score = 51.5 bits (120), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 26/175 (14%), Positives = 62/175 (35%), Gaps = 7/175 (4%)

Query: 268 RETTQTFQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNMRSSISAIREITDQRQK 327
              T+   E+ ++++ L+   S    +        +       + +   A  ++    + 
Sbjct: 135 DRFTEHAPEIIEQVETLVKSSSQLAATAHEMVQKIDTDQLNRTIANLEKASAQLEPLLRT 194

Query: 328 IISTINTIENITSNLNDSSQKFAELMSKINNISALKENNSLFKDAQRAMHTFRDTSEKIN 387
             +T+N + +  S  N   Q+    +  +   S       L     ++   F   +  + 
Sbjct: 195 STATMNRLGSFASERNR--QQLESTLKSLQQTS--DAVRPLMDTLGQSARDFSSMTGTLT 250

Query: 388 RYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFERNPQDIVWGREK 442
           +    + ++LQ   Q  L  +  L   LQ     F+  +   E +PQ ++ G+ K
Sbjct: 251 QSSQQLSDSLQ---QDTLPRLNALTDSLQRDSQQFEQLMETLEDHPQSLLLGKPK 302


>gi|254000134|ref|YP_003052197.1| Mammalian cell entry related domain-containing protein
           [Methylovorus sp. SIP3-4]
 gi|253986813|gb|ACT51670.1| Mammalian cell entry related domain protein [Methylovorus sp.
           SIP3-4]
          Length = 314

 Score =  108 bits (268), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 49/299 (16%), Positives = 116/299 (38%), Gaps = 7/299 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++++  +VGLF + +   + F+ +WLS S           I     V GL+ ++SV+F
Sbjct: 1   MENRSHAIAVGLFTLILGLAAIFAFWWLSGSR---EEKTHYTINSNRPVSGLNPEASVKF 57

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G+ VG+++ + LD    N    +  +     L  +  A +R QG+ G+ YI+L+     
Sbjct: 58  RGVEVGKVLHISLDDNTQNDIHVEIEVTKTLQLSKAAYAELRLQGVTGLAYIDLNDDGSS 117

Query: 121 KKTIFQIATERNQR----AMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPL 176
           ++ +    T   +           P  I    +  +++S+  + +   +QKI  +     
Sbjct: 118 QQRLGPDDTIPLRPSFVDRFTEHAPEIIEQVETLVKSSSQLAATAHEMVQKIDTDQLNRT 177

Query: 177 TTTIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDL 236
              +         L    +     + +     +    ++T  ++     ++  ++  +  
Sbjct: 178 IANLEKASAQLEPLLRTSTATMNRLGSFASERNRQQLESTLQSLQQTSDAVRPLMDTLGQ 237

Query: 237 QKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSK 295
              +       ++ ++   S     +T+  +   T + Q   Q+ + L+       +S 
Sbjct: 238 SARDFSSMTGTLTQSSQQLSDSLQQDTLPRLNALTDSLQRDSQQFEQLMETLEDHPQSL 296



 Score = 51.5 bits (120), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 26/175 (14%), Positives = 62/175 (35%), Gaps = 7/175 (4%)

Query: 268 RETTQTFQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNMRSSISAIREITDQRQK 327
              T+   E+ ++++ L+   S    +        +       + +   A  ++    + 
Sbjct: 135 DRFTEHAPEIIEQVETLVKSSSQLAATAHEMVQKIDTDQLNRTIANLEKASAQLEPLLRT 194

Query: 328 IISTINTIENITSNLNDSSQKFAELMSKINNISALKENNSLFKDAQRAMHTFRDTSEKIN 387
             +T+N + +  S  N   Q+    +  +   S       L     ++   F   +  + 
Sbjct: 195 STATMNRLGSFASERNR--QQLESTLQSLQQTS--DAVRPLMDTLGQSARDFSSMTGTLT 250

Query: 388 RYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFERNPQDIVWGREK 442
           +    + ++LQ   Q  L  +  L   LQ     F+  +   E +PQ ++ G+ K
Sbjct: 251 QSSQQLSDSLQ---QDTLPRLNALTDSLQRDSQQFEQLMETLEDHPQSLLLGKPK 302


>gi|207109055|ref|ZP_03243217.1| ABC transport system substrate binding protein [Helicobacter pylori
           HPKX_438_CA4C1]
          Length = 182

 Score =  108 bits (268), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 24/111 (21%), Positives = 46/111 (41%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME    YT +G      L      I WL      DG   E ++     + G++T+S V +
Sbjct: 1   MERHVNYTLIGGLFFLCLVCMVGFILWLGHLGLDDGKYYEYVVYTDKDLGGIATNSPVNY 60

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITY 111
            GI VG ++ +   ++         +I+    +   +   + ++GL G+ +
Sbjct: 61  KGIQVGNVIKVGFAKDKVGVVRLDLMIKSSVKIRKDSKVAVSSRGLMGLKF 111


>gi|237747262|ref|ZP_04577742.1| ABC transporter periplasmic substrate-binding protein [Oxalobacter
           formigenes HOxBLS]
 gi|229378613|gb|EEO28704.1| ABC transporter periplasmic substrate-binding protein [Oxalobacter
           formigenes HOxBLS]
          Length = 151

 Score =  108 bits (268), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 24/117 (20%), Positives = 45/117 (38%), Gaps = 1/117 (0%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M+ K+    VGLFV+       F        + +       +     ++ GL   + V+ 
Sbjct: 1   MQRKSLDIWVGLFVLLGAVALMFLALKAGNMSSFSFEKTYTVSSRFDNIGGLKPRAPVKS 60

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTL 117
            G+ VGR+  +  D +    +L    ++        ++A I T GL G  Y+ +   
Sbjct: 61  AGVVVGRVGDISFD-DQDFRALVTLQLQERYKFPKDSSAKILTSGLLGEQYVGIEPG 116


>gi|170731750|ref|YP_001763697.1| hypothetical protein Bcenmc03_0395 [Burkholderia cenocepacia MC0-3]
 gi|169814992|gb|ACA89575.1| Mammalian cell entry related domain protein [Burkholderia
           cenocepacia MC0-3]
          Length = 187

 Score =  108 bits (268), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 28/123 (22%), Positives = 47/123 (38%), Gaps = 3/123 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQY-DGPMAEVIIRIPGSVDGLSTDSSVR 59
           M+       VGLFVV       F    +   +     P   V ++   ++ GL   ++V+
Sbjct: 1   MKKTALDFWVGLFVVVGFLAVLFLALKVGNMSSLSFQPTYSVRMKF-DNIGGLKPRAAVK 59

Query: 60  FNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRK 119
             G+ VGR+  +  D      ++    +    P    ++A I T GL G  YI L     
Sbjct: 60  SAGVVVGRVKSIGFDPNTY-QAVVTIDVDGQYPFPKDSSAKILTSGLLGEQYIGLDPGGD 118

Query: 120 EKK 122
            + 
Sbjct: 119 TEM 121


>gi|16126559|ref|NP_421123.1| ABC transporter periplasmic substrate-binding protein [Caulobacter
           crescentus CB15]
 gi|221235341|ref|YP_002517778.1| ABC membrane transporter periplasmic protein [Caulobacter
           crescentus NA1000]
 gi|13423843|gb|AAK24291.1| ABC transporter, periplasmic substrate-binding protein, putative
           [Caulobacter crescentus CB15]
 gi|220964514|gb|ACL95870.1| ABC membrane transporter, periplasmic component [Caulobacter
           crescentus NA1000]
          Length = 312

 Score =  108 bits (268), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 48/294 (16%), Positives = 105/294 (35%), Gaps = 6/294 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME    Y  VG   +++         WL++ + ++       I   G V GLS    V F
Sbjct: 1   MERNANYALVGAISLALFMGLVIFAVWLAKLS-FNRDYDVYDILFVGPVRGLSQGGEVHF 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NGI VG +  + LD+   N  +A+  +  D P+   + AT+  QG+ G+ Y++++     
Sbjct: 60  NGIKVGEVTRIELDKTDTNRVIARVRVTSDVPIKVDSYATLEPQGITGVNYVQITAGAPN 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
           K+ +           + T   +  +         ++ I    R  + + +   K    T+
Sbjct: 120 KELLKDTVKTGKVPVIRTQRSALSDLLEGGGTVLTRTIEALDRVNRVLSDRNIKSFGATL 179

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIK-----AID 235
            N++ ++  + +    +       Q    ++ S    +   + +   D            
Sbjct: 180 TNVQAVTQEMRDRKEILADAQKALQSIDQTAQSITELSNSANTLVDGDAKRTLKELGDAA 239

Query: 236 LQKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFS 289
            +      +   + +     +SD     +  +     T Q   + +D L+ +  
Sbjct: 240 AELRATAKDARGMVTKLEGPASDFATTGLPQLSSAIVTLQSAAESLDRLVGEVE 293


>gi|261838739|gb|ACX98505.1| ABC transport system substrate binding protein [Helicobacter pylori
           51]
 gi|317182669|dbj|BAJ60453.1| ABC transport system substrate binding protein [Helicobacter pylori
           F57]
          Length = 271

 Score =  108 bits (268), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 36/242 (14%), Positives = 84/242 (34%), Gaps = 3/242 (1%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME    YT +G      L      I WL      DG   E ++     + G++T+S V +
Sbjct: 1   MERHVNYTLIGGLFFLCLVCMVGFILWLGHLGLDDGKYYEYVVYTDKDLGGIATNSPVNY 60

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            GI VG ++ +   ++         +I+    +   +   + ++GL G+ ++ L     E
Sbjct: 61  KGIQVGNVIKVGFAKDKVGVVRLDLMIKSSVKIRKDSKVAVSSRGLMGLKFLALEQSHNE 120

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
           +   F  + ++ +R +I          +   +   + +       + + +   +     +
Sbjct: 121 E---FYGSGDKGERILIFKEGLIDRLSVDANQAMQEVMKAIKNVNKILDDENVEKFKHIL 177

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
           A+I+ +   L +     D ++        + ++              D       L    
Sbjct: 178 ASIDDLIANLDSRKVQFDSLIGNANNLVSNVNNVVLDVDKRIKQGQYDFKAMFTPLIMQA 237

Query: 241 QI 242
           Q+
Sbjct: 238 QL 239


>gi|317178168|dbj|BAJ55957.1| ABC transport system substrate binding protein [Helicobacter pylori
           F16]
          Length = 271

 Score =  108 bits (268), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 36/242 (14%), Positives = 85/242 (35%), Gaps = 3/242 (1%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME    YT +G      L      I WL      DG   E ++     + G++T+S V +
Sbjct: 1   MERHVNYTLIGGLFFLCLVCMVGFILWLGHLGLDDGKYYEYVVYTDKDLGGIATNSPVNY 60

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            GI VG ++ +   ++         +I+    +   +   + ++GL G+ ++ L     E
Sbjct: 61  KGIQVGNVIKVGFAKDKVGVVRLDLMIKSSVKIRKDSKVAVSSRGLMGLKFLALEQSHNE 120

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
           +   F  + ++ +R +I          +   +   + +       + + +   +     +
Sbjct: 121 E---FYGSGDKGERILIFKEGLIDRLSVDANQAMQEVMKAIKNVNKILDDENVEKFKHIL 177

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
           A+I+ +   L +  +  D ++        + ++              D       L    
Sbjct: 178 ASIDDLIANLDSRKAQFDSLIGNANNFVSNVNNVVLDVDKRIKQGQYDFKAMFTPLIMQA 237

Query: 241 QI 242
           Q+
Sbjct: 238 QL 239


>gi|284928695|ref|YP_003421217.1| organic solvent resistence ABC transporter ATPase periplasmic
           protein [cyanobacterium UCYN-A]
 gi|284809154|gb|ADB94859.1| ABC-type transport system involved in resistance to organic
           solvents, periplasmic component [cyanobacterium UCYN-A]
          Length = 437

 Score =  108 bits (268), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 47/428 (10%), Positives = 121/428 (28%), Gaps = 46/428 (10%)

Query: 10  VGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRFNGIPVGRIV 69
           VGLFV+  L      + WL           +       +V GL   + +R+ G+ VG+I+
Sbjct: 12  VGLFVIFGLTIFGGLVVWLRG-GVLGQKTYQFFANFK-NVSGLQVGAPIRYRGVTVGKIL 69

Query: 70  GLFLDQEYPNHSLAKALIRPD-TPLYPSTTATIRTQGLAGITYIELSTLRKEKKTIFQIA 128
           GL  +            I  +   +   +   I   GL G   ++++      +    I 
Sbjct: 70  GLQPNSNG---VRVILEISSNQLRIPKDSNVQINRYGLIGEASVDITPSHNLSEQELAID 126

Query: 129 TERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTIANIETIST 188
               +           +  I    +   +      +     + I    +      +    
Sbjct: 127 PISEECIKERQILCNNDEVIGKTGSQLVEALTRLSNAYSDPKFIGDVNSAVRNVSKAGDR 186

Query: 189 VLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVNQILENIQV 248
           +   +                  D+    +      + L + + +I ++    + + I+ 
Sbjct: 187 IAVLSQEVTKLSEVARGQIDGIGDAIRNTDQAAQDASKLIRNVDSIIVENRTDVDKTIKG 246

Query: 249 SSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAFLENIADST 308
           ++N     +  V     ++  T  + ++   +I  L  +F   +          +I    
Sbjct: 247 AANLTHNLNTLVEENRENIVNTLNSIEQTSDQIRLLALNFGVTVDKINQGISEIDI---- 302

Query: 309 SNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNISALKENNSL 368
                                      +   ++L       A     + N+S    +  +
Sbjct: 303 ---------------------------KQFANDLESLMSNAALTAKNLQNLSKSLSDPEV 335

Query: 369 FKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNN 428
               Q+ + + R T +   +    +     +               +++ ++   D ++ 
Sbjct: 336 IITIQQTLDSARVTFDNAQKITSDVEELTGD---------PVFRNNIRKLIDGLSDLVSE 386

Query: 429 FERNPQDI 436
            E   Q +
Sbjct: 387 TESLEQQV 394


>gi|86748753|ref|YP_485249.1| hypothetical protein RPB_1629 [Rhodopseudomonas palustris HaA2]
 gi|86571781|gb|ABD06338.1| Mammalian cell entry related [Rhodopseudomonas palustris HaA2]
          Length = 291

 Score =  108 bits (268), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 35/160 (21%), Positives = 70/160 (43%), Gaps = 6/160 (3%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++  Y  +G+F ++++  +F  + W    +        + +   GS  GL    SV F
Sbjct: 1   METRANYFLIGVFTLAVIAAAFGFVLWFQSLHSTKARS-PLRVVFEGSATGLRNGGSVNF 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NG+ VG ++ + LD   P   +A A++    P+   T   +  QGL G+  I L    + 
Sbjct: 60  NGVRVGEVISVKLD--NPKRVVALAMVENTAPIRKDTLVGLEFQGLTGVAAISLKGGMET 117

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISD 160
              +     + +   ++TA P  +     + + T + ++ 
Sbjct: 118 APPV---PLDEDGVPVLTADPDLLMDISESVKATLRNVNK 154



 Score = 51.5 bits (120), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 21/140 (15%), Positives = 56/140 (40%), Gaps = 22/140 (15%)

Query: 305 ADSTSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNISALKE 364
                N  +   ++  +      +  + + I++I + ++    K   +M  I+ ++  K+
Sbjct: 154 KVVAENAETVKESLSNLQVFTSSLARSSDKIDSIMAKVDGVIGKTDSVMQGIDALAGGKD 213

Query: 365 NNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDD 424
              LF    +A+ +FR+ ++ +++                      L+   + T+     
Sbjct: 214 GGELF----QAVKSFRELADNLDKRSS------------------ALIIDGRRTLADISR 251

Query: 425 CLNNFERNPQDIVWGREKGS 444
            +NNF+RNP  +++G    +
Sbjct: 252 AINNFDRNPTRVLFGPSNTA 271


>gi|39937022|ref|NP_949298.1| hypothetical protein RPA3961 [Rhodopseudomonas palustris CGA009]
 gi|192292849|ref|YP_001993454.1| mammalian cell entry related domain protein [Rhodopseudomonas
           palustris TIE-1]
 gi|39650879|emb|CAE29402.1| putative periplasmic binding protein for ABC transporter
           [Rhodopseudomonas palustris CGA009]
 gi|192286598|gb|ACF02979.1| Mammalian cell entry related domain protein [Rhodopseudomonas
           palustris TIE-1]
          Length = 297

 Score =  108 bits (268), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 45/242 (18%), Positives = 97/242 (40%), Gaps = 6/242 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++  Y  +G F ++++  +F  + W    +        + +   G+  GL    SV F
Sbjct: 1   METRANYFLIGTFTLAVIAAAFGFVLWFQSLHTTKARS-PLRVVFEGAASGLRNGGSVNF 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NG+ VG +V + LD   P   +A A++    P+   T   +  QGL G+  I L    + 
Sbjct: 60  NGVRVGEVVSVKLD--NPRRVVALAMVENTAPIRKDTQVGLEFQGLTGVAAISLKGGSET 117

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
              +     + +   ++TA P  +     + + T + ++      Q+ ++   + L T  
Sbjct: 118 APPV---PLDDDGTPVLTADPELLQDISESIKATLRNVNRLVSENQESVKTSLENLQTFT 174

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
           +++   S  + + +S +D ++  T       D+        +L  ++    +  D     
Sbjct: 175 SSLARSSDKIDSIMSRVDGVIAKTDSVMQGIDALAGGKDGGELFQAVKSFRELADNLDKR 234

Query: 241 QI 242
             
Sbjct: 235 SA 236



 Score = 51.5 bits (120), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 23/133 (17%), Positives = 57/133 (42%), Gaps = 22/133 (16%)

Query: 307 STSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNISALKENN 366
            + N  S  +++  +      +  + + I++I S ++    K   +M  I+ ++  K+  
Sbjct: 156 VSENQESVKTSLENLQTFTSSLARSSDKIDSIMSRVDGVIAKTDSVMQGIDALAGGKDGG 215

Query: 367 SLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCL 426
            LF    +A+ +FR+ ++ +++                      L+   + T+      +
Sbjct: 216 ELF----QAVKSFRELADNLDKRSA------------------TLILDGRRTLADISRAV 253

Query: 427 NNFERNPQDIVWG 439
           NNF+RNP  +++G
Sbjct: 254 NNFDRNPTRVLFG 266


>gi|317179640|dbj|BAJ57428.1| ABC transport system substrate binding protein [Helicobacter pylori
           F30]
 gi|317181147|dbj|BAJ58933.1| ABC transport system substrate binding protein [Helicobacter pylori
           F32]
          Length = 271

 Score =  108 bits (267), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 36/242 (14%), Positives = 85/242 (35%), Gaps = 3/242 (1%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME    YT +G      L      I WL      DG   E ++     + G++T+S V +
Sbjct: 1   MERHVNYTLIGGLFFLCLVCMVGFILWLGHLGLDDGKYYEYVVYTDKDLGGIATNSPVNY 60

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            GI VG ++ +   ++         +I+    +   +   + ++GL G+ ++ L     E
Sbjct: 61  KGIQVGNVIKVGFAKDKVGVVRLDLMIKSSVKIRKDSKVAVSSRGLMGLKFLALEQSHNE 120

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
           +   F  + ++ +R +I          +   +   + +       + + +   +     +
Sbjct: 121 E---FYGSGDKGERILIFKEGLIDRLSVDANQAMQEVMKAIKNVNKVLDDENVEKFKHIL 177

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
           A+I+ +   L +  +  D ++        + ++              D       L    
Sbjct: 178 ASIDDLIANLDSRKAQFDSLIGNANNLVSNVNNVVLDVDKRIKQGQYDFKAMFTPLIMQA 237

Query: 241 QI 242
           Q+
Sbjct: 238 QL 239


>gi|91976117|ref|YP_568776.1| hypothetical protein RPD_1638 [Rhodopseudomonas palustris BisB5]
 gi|91682573|gb|ABE38875.1| Mammalian cell entry related [Rhodopseudomonas palustris BisB5]
          Length = 317

 Score =  108 bits (267), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 43/241 (17%), Positives = 93/241 (38%), Gaps = 6/241 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++  Y  +G F ++++  +F  + W    +        + +   G+  GL    SV F
Sbjct: 15  METRANYFLIGTFTLAVIAAAFGFVLWFQSLHSTKARS-PLRVVFEGAASGLRNGGSVNF 73

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NG+ VG ++ + LD   P   +A A++    P+   T   +  QGL G+  I L      
Sbjct: 74  NGVRVGEVISVKLD--NPKRVVALAMVENTAPIRKDTLVGLEFQGLTGVAAISLKGGLDS 131

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
              +     + +   ++TA P  +     + + T + ++       + ++     L T  
Sbjct: 132 APPV---PLDEDGVPVLTADPELLMDISESVKATLRNLNKVVAENAETVKESLSNLQTFT 188

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
           A++   S  + + +  +D ++  T       D+        +L  ++    +  D     
Sbjct: 189 ASLARSSDKIDSIMVKVDGVIGKTDSVMQGIDALAGGKDGGELFQAVKSFRELADNLDKR 248

Query: 241 Q 241
            
Sbjct: 249 S 249



 Score = 53.8 bits (126), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 20/143 (13%), Positives = 55/143 (38%), Gaps = 22/143 (15%)

Query: 305 ADSTSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNISALKE 364
                N  +   ++  +      +  + + I++I   ++    K   +M  I+ ++  K+
Sbjct: 168 KVVAENAETVKESLSNLQTFTASLARSSDKIDSIMVKVDGVIGKTDSVMQGIDALAGGKD 227

Query: 365 NNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDD 424
              LF    +A+ +FR+ ++ +++                      L+   + T+     
Sbjct: 228 GGELF----QAVKSFRELADNLDKRSN------------------ALIIDGRRTLVDISR 265

Query: 425 CLNNFERNPQDIVWGREKGSVKI 447
            +NN +RNP  +++G    + + 
Sbjct: 266 AVNNLDRNPTRLLFGPSNNAAQE 288


>gi|315585853|gb|ADU40234.1| ABC superfamily ATP binding cassette transporter substrate binding
           protein [Helicobacter pylori 35A]
          Length = 271

 Score =  108 bits (267), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 36/242 (14%), Positives = 84/242 (34%), Gaps = 3/242 (1%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME    YT +G      L      I WL      DG   E ++     + G++T+S V +
Sbjct: 1   MERHVNYTLIGGLFFLCLVCMVGFILWLGHLGLDDGKYYEYVVYTDKDLGGIATNSPVNY 60

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            GI VG ++ +   ++         +I+    +   +   + ++GL G+ ++ L     E
Sbjct: 61  KGIQVGNVIKVGFAKDKVGVVRLDLMIKSSVKIRKDSKVAVSSRGLMGLKFLALEQSHNE 120

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
           +   F  + ++ +R +I          +   +   + +       + + +   +     +
Sbjct: 121 E---FYGSGDKGERILIFKEGLIDRLSVDANQAMQEVMKAIKNVNKVLDDENVEKFKHIL 177

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
           A+I+ +   L +     D ++        + ++              D       L    
Sbjct: 178 ASIDDLIANLDSRKVQFDSLIGNANNLVSNVNNVVLDVDKRIKQGQYDFKAMFTPLIMQA 237

Query: 241 QI 242
           Q+
Sbjct: 238 QL 239


>gi|163854450|ref|YP_001628748.1| mce related protein [Bordetella petrii DSM 12804]
 gi|163258178|emb|CAP40477.1| mce related protein [Bordetella petrii]
          Length = 158

 Score =  108 bits (267), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 26/128 (20%), Positives = 48/128 (37%), Gaps = 3/128 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQY-DGPMAEVIIRIPGSVDGLSTDSSVR 59
           M  +     VGLFV+       F        + +   P   +      ++ GL   + V+
Sbjct: 1   MSREKTDFWVGLFVLLGAAALVFLALRAGNLSSFSFTPTYTLTANF-DNIGGLKVRAPVK 59

Query: 60  FNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRK 119
             G+ VGR+  +  D +    ++    +         ++A+I T GL G  Y+ LS   +
Sbjct: 60  SAGVVVGRVGKISFD-DKVFQAVVTLDLEEGYQFPKDSSASILTSGLLGEQYVGLSAGSE 118

Query: 120 EKKTIFQI 127
           E+      
Sbjct: 119 EENFADGG 126


>gi|209516601|ref|ZP_03265455.1| Mammalian cell entry related domain protein [Burkholderia sp. H160]
 gi|209503042|gb|EEA03044.1| Mammalian cell entry related domain protein [Burkholderia sp. H160]
          Length = 176

 Score =  108 bits (267), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 28/117 (23%), Positives = 40/117 (34%), Gaps = 1/117 (0%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M+       VGLFVV       F        +         +     ++ GL   + V+ 
Sbjct: 1   MKKNVLDFWVGLFVVLGFVALLFLALKAGNMSSLSFQATYQVKLKFDNIGGLKPRAPVKS 60

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTL 117
            G+ VGR+  +  D      +L    I         T+A I T GL G  YI L   
Sbjct: 61  AGVTVGRVASIGFDSNNY-QALVTIDIDKQYQFPRDTSAKILTSGLLGEQYIGLEPG 116


>gi|221639255|ref|YP_002525517.1| Mammalian cell entry related domain-containing protein [Rhodobacter
           sphaeroides KD131]
 gi|221160036|gb|ACM01016.1| Mammalian cell entry related domain protein [Rhodobacter
           sphaeroides KD131]
          Length = 321

 Score =  108 bits (267), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 37/117 (31%), Positives = 64/117 (54%), Gaps = 2/117 (1%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++  Y  +G+F +S +  +   + WL++  Q D   AE  I    SV+GL   S VR+
Sbjct: 1   METRARYVLIGIFTLSSILATLGFLLWLAKV-QLDRTYAEYDILFT-SVEGLGRASPVRY 58

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTL 117
           NG+ VG ++ + +D E P+    +  +   TP+   T A + +QG+ G++Y+ LS  
Sbjct: 59  NGVDVGEVLNIAVDAEDPSLVRVRIQLAATTPVRTDTKAQVASQGVTGVSYVSLSGG 115



 Score = 61.9 bits (147), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 29/201 (14%), Positives = 60/201 (29%), Gaps = 16/201 (7%)

Query: 263 TVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNMRSSISAIREIT 322
              +  +           +  L +D  + +    +            N  +  S +    
Sbjct: 121 LTAEEDQWPPVIPSERSAVQALTADAPTLLAEAISLLKDIQTFTGPENRAAVESILTNAD 180

Query: 323 DQRQKIISTINTIENITSNLNDSSQKFAELMSKINNISAL-----KENNSLFKDAQRAMH 377
              Q I +        TS LND + +   +  + +   A      +E       A+    
Sbjct: 181 ASVQNIAAITRDAAEATSRLNDFTARLDAMADRADVALASLETALEEGKGAAASARDTFE 240

Query: 378 TFRDTSE--------KINRYIPSIGNNLQ---NFSQSGLNDIQNLVRKLQETVNHFDDCL 426
           T     E        +I   +  I  ++    NF+ +GL     L  + + TV + +  +
Sbjct: 241 TVNRVVERDVPPMIAQIRSAVSGIERSVAGIRNFADNGLPQYATLAAETRRTVTNLNALI 300

Query: 427 NNFERNPQDIVWGREKGSVKI 447
               R+P     G +  S + 
Sbjct: 301 AQISRDPARFFLGNQTPSYRR 321


>gi|212703463|ref|ZP_03311591.1| hypothetical protein DESPIG_01507 [Desulfovibrio piger ATCC 29098]
 gi|212673123|gb|EEB33606.1| hypothetical protein DESPIG_01507 [Desulfovibrio piger ATCC 29098]
          Length = 149

 Score =  108 bits (267), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 33/132 (25%), Positives = 56/132 (42%), Gaps = 2/132 (1%)

Query: 3   SKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRFNG 62
           +    T+VG+FV+  L    +    L +   +D    E++     SV GL   + V   G
Sbjct: 2   NSFRQTAVGIFVLLGLVCVAYLTIKLGKMEVFDSKGFELVANF-NSVSGLRVGADVEMAG 60

Query: 63  IPVGRIVGLFLDQE-YPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKEK 121
           +PVGR+  + LD +     +    ++  D  L   T A+++T GL G  Y+ L+    E 
Sbjct: 61  VPVGRVASIKLDDDLSRRQARVVLILDKDLQLPADTIASVKTSGLIGDKYVNLTAGGSED 120

Query: 122 KTIFQIATERNQ 133
                   E  +
Sbjct: 121 ILASGDTLEETE 132


>gi|207091859|ref|ZP_03239646.1| ABC transport system substrate binding protein [Helicobacter pylori
           HPKX_438_AG0C1]
          Length = 271

 Score =  108 bits (267), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 32/201 (15%), Positives = 77/201 (38%), Gaps = 3/201 (1%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME    YT +G      L      I WL      DG   E ++     + G++T+S V +
Sbjct: 1   MERHVNYTLIGGLFFLCLVCMVGFILWLGHLGLDDGKYYEYVVYTDKDLGGIATNSPVNY 60

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            GI VG ++ +   ++         +I+    +   +   + ++GL G+ ++ L     E
Sbjct: 61  KGIQVGNVIKVGFAKDKVGVVRLDLMIKSSVKIRKDSKVAVSSRGLMGLKFLALEQSHNE 120

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
           +   F  + ++ +R +I          +   +   + +       + + +   +     +
Sbjct: 121 E---FYGSGDKGERILIFKEGLMDRLSVDANQAMQEVMKAIKNVNKILDDENVEKFKHIL 177

Query: 181 ANIETISTVLANNISHIDKMM 201
           A++  +   L +  +  D ++
Sbjct: 178 ASVNDLIANLDSRKTQFDSLI 198


>gi|288819065|ref|YP_003433413.1| ABC-type transport system [Hydrogenobacter thermophilus TK-6]
 gi|288788465|dbj|BAI70212.1| ABC-type transport system [Hydrogenobacter thermophilus TK-6]
 gi|308752648|gb|ADO46131.1| virulence factor Mce family protein [Hydrogenobacter thermophilus
           TK-6]
          Length = 523

 Score =  108 bits (267), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 50/355 (14%), Positives = 124/355 (34%), Gaps = 16/355 (4%)

Query: 5   NYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRFNGIP 64
           +    VG FV+++     F I        +  P  +V      +V GLS  + VR  GI 
Sbjct: 4   STEFKVGTFVIAVSLAFAFLILTFGEI-PFLKPGVKVYKVYFDNVAGLSKGAEVRVAGIK 62

Query: 65  VGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKEKKTI 124
            G++  + L             +     LY   +A I T GL G  Y+ ++        +
Sbjct: 63  SGKVRSVEL---KDGKVEVIFEVDKSINLYRDASAQIGTLGLMGDKYLAINPGNPSSGLL 119

Query: 125 FQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTIANIE 184
            +    +          +  +  +    N S+ I     + Q I+    + +   + N+E
Sbjct: 120 SEGQVIQKTYGY-----ADTDRLVKELTNASESIRLMVENFQLILMENREDIRRIVQNLE 174

Query: 185 TISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVNQILE 244
            +S  L        + +  T      ++      +++  + S    I+ +       ++E
Sbjct: 175 MLSDSLNKMALENRENLRQT-----IANLNILVASLSRTLPSTIASIERLSNDLDRAVVE 229

Query: 245 NIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAFLENI 304
           N      +         +    + E  +   ++ + ++ + ++    +++  T++ L  +
Sbjct: 230 NRGDIKESLENLRSLTSDLKTSLPELVKNLNDLSRNLNAIATENRENLRA--TTSNLAEL 287

Query: 305 ADSTSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNI 359
             S       + +I    ++ +  +  +   E +  N+  +++ FA+     +  
Sbjct: 288 TTSLKKSSQDLQSILARIERGEGTLGKLVKDEELYRNITSATKTFAKAGEVADKT 342


>gi|317010163|gb|ADU80743.1| ABC transport system substrate binding protein [Helicobacter pylori
           India7]
          Length = 271

 Score =  108 bits (267), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 32/201 (15%), Positives = 78/201 (38%), Gaps = 3/201 (1%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME    YT +G      L      I WL      DG   E ++     + G++T+S V +
Sbjct: 1   MERHVNYTLIGGLFFLCLVCMVGFILWLGHLGLDDGKYYEYVVYTDKDLGGIATNSPVNY 60

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            GI VG ++ +   ++         +I+    +   +   + ++GL G+ ++ L     E
Sbjct: 61  KGIQVGNVIKVGFAKDKVGVVRLDLMIKSSVKIRKDSKVAVSSRGLMGLKFLALEQSHNE 120

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
           +   F  + ++ +R +I          +   +   + +       + + +   +     +
Sbjct: 121 E---FYGSGDKGERILIFKEGLIDRLSVDANQAMQEVMKAIKNVNKILDDENVEKFKHIL 177

Query: 181 ANIETISTVLANNISHIDKMM 201
           A+++ +   L +  +  D ++
Sbjct: 178 ASVDDLIANLDSRKTQFDSLI 198


>gi|237749419|ref|ZP_04579899.1| ABC-type transport system [Oxalobacter formigenes OXCC13]
 gi|229380781|gb|EEO30872.1| ABC-type transport system [Oxalobacter formigenes OXCC13]
          Length = 151

 Score =  108 bits (267), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 25/122 (20%), Positives = 43/122 (35%), Gaps = 1/122 (0%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M+ K     VG FV+       F        +         +     ++ GL   + V+ 
Sbjct: 1   MQRKPLDIWVGFFVLLGAAALMFLALKAGNMSSLSFDKTYTVSSRFDNIGGLKPRAPVKS 60

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G+ VGR+  +  D +    +L    ++        ++A I T GL G  YI +     E
Sbjct: 61  AGVVVGRVGDISFD-DQDYRALVTLQLQEKYKFPKDSSAKILTSGLLGEQYIGIEPGGDE 119

Query: 121 KK 122
             
Sbjct: 120 TY 121


>gi|115523492|ref|YP_780403.1| hypothetical protein RPE_1473 [Rhodopseudomonas palustris BisA53]
 gi|115517439|gb|ABJ05423.1| Mammalian cell entry related domain protein [Rhodopseudomonas
           palustris BisA53]
          Length = 293

 Score =  107 bits (266), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 46/243 (18%), Positives = 94/243 (38%), Gaps = 6/243 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++  Y  +GLF V+++  +   + W    +        + I   GS  GL    +V F
Sbjct: 1   METRANYFLIGLFTVAVVASALGFVLWFQALHTTKLRS-PLRIVFEGSASGLRNGGNVNF 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NG+ +G ++ + LD   P   +A A++    P+   T   +  QGL G+  I L   ++ 
Sbjct: 60  NGVRIGEVITVKLD--NPRRVVALAMVENSAPIRKDTLVGLEFQGLTGVAAISLKGGQET 117

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
              +     + +   M+TA PS +         T   ++      +  ++N  + + T  
Sbjct: 118 APPV---PLDDDGVPMLTADPSLLQDIGEAVRATLTNVNRMVADNEDALKNSLQNVMTFT 174

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
            ++   S  + + +   DK++  T       D+        +L  ++    +  D     
Sbjct: 175 QSLANSSEHIDSIMRKTDKLISKTDNIMLGLDALAGGKDGGELFQAVKSFRELADNLDKR 234

Query: 241 QIL 243
              
Sbjct: 235 ASA 237



 Score = 50.7 bits (118), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 20/135 (14%), Positives = 56/135 (41%), Gaps = 22/135 (16%)

Query: 305 ADSTSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNISALKE 364
                N  +  ++++ +    Q + ++   I++I    +    K   +M  ++ ++  K+
Sbjct: 154 RMVADNEDALKNSLQNVMTFTQSLANSSEHIDSIMRKTDKLISKTDNIMLGLDALAGGKD 213

Query: 365 NNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDD 424
              LF    +A+ +FR+ ++ +++                      L+   + T++    
Sbjct: 214 GGELF----QAVKSFRELADNLDKRAS------------------ALMLDGRRTLSDISR 251

Query: 425 CLNNFERNPQDIVWG 439
            +NN ++NP  I++G
Sbjct: 252 AVNNLDKNPTRILFG 266


>gi|307731183|ref|YP_003908407.1| Mammalian cell entry related domain-containing protein
           [Burkholderia sp. CCGE1003]
 gi|307585718|gb|ADN59116.1| Mammalian cell entry related domain protein [Burkholderia sp.
           CCGE1003]
          Length = 184

 Score =  107 bits (266), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 28/117 (23%), Positives = 40/117 (34%), Gaps = 1/117 (0%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M+       VGLFVV       F        +         +     ++ GL   + V+ 
Sbjct: 1   MKKTALDFWVGLFVVLGFVALLFLALKAGNMSSLSFQATYPVKLKFDNIGGLKARAPVKS 60

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTL 117
            G+ VGR+  +  D      +L    I         T+A I T GL G  YI L   
Sbjct: 61  AGVTVGRVASIGFDSNAY-QALVTIDIDRQYQFPKDTSAKILTSGLLGEQYIGLEPG 116


>gi|107024235|ref|YP_622562.1| hypothetical protein Bcen_2691 [Burkholderia cenocepacia AU 1054]
 gi|116688440|ref|YP_834063.1| hypothetical protein Bcen2424_0416 [Burkholderia cenocepacia
           HI2424]
 gi|254246537|ref|ZP_04939858.1| Mce4/Rv3499c/MTV023.06c protein [Burkholderia cenocepacia PC184]
 gi|105894424|gb|ABF77589.1| Mammalian cell entry related protein [Burkholderia cenocepacia AU
           1054]
 gi|116646529|gb|ABK07170.1| Mammalian cell entry related domain protein [Burkholderia
           cenocepacia HI2424]
 gi|124871313|gb|EAY63029.1| Mce4/Rv3499c/MTV023.06c protein [Burkholderia cenocepacia PC184]
          Length = 189

 Score =  107 bits (266), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 28/123 (22%), Positives = 47/123 (38%), Gaps = 3/123 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQY-DGPMAEVIIRIPGSVDGLSTDSSVR 59
           M+       VGLFVV       F    +   +     P   V ++   ++ GL   ++V+
Sbjct: 3   MKKTALDFWVGLFVVVGFLAVLFLALKVGNMSSLSFQPTYSVRMKF-DNIGGLKPRAAVK 61

Query: 60  FNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRK 119
             G+ VGR+  +  D      ++    +    P    ++A I T GL G  YI L     
Sbjct: 62  SAGVVVGRVKSIGFDPNTY-QAVVTIDVDGQYPFPKDSSAKILTSGLLGEQYIGLDPGGD 120

Query: 120 EKK 122
            + 
Sbjct: 121 TEM 123


>gi|323527529|ref|YP_004229682.1| mammalian cell entry related domain-containing protein
           [Burkholderia sp. CCGE1001]
 gi|323384531|gb|ADX56622.1| Mammalian cell entry related domain protein [Burkholderia sp.
           CCGE1001]
          Length = 186

 Score =  107 bits (266), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 28/117 (23%), Positives = 40/117 (34%), Gaps = 1/117 (0%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M+       VGLFVV       F        +         +     ++ GL   + V+ 
Sbjct: 1   MKKTALDFWVGLFVVLGFVALLFLALKAGNMSSLSFQATYPVKLKFDNIGGLKARAPVKS 60

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTL 117
            G+ VGR+  +  D      +L    I         T+A I T GL G  YI L   
Sbjct: 61  AGVTVGRVASIGFDSNAY-QALVTIDIDKQYQFPKDTSAKILTSGLLGEQYIGLEPG 116


>gi|160871631|ref|ZP_02061763.1| ABC-type transport system involved in resistance to organic
           solvents periplasmic component [Rickettsiella grylli]
 gi|159120430|gb|EDP45768.1| ABC-type transport system involved in resistance to organic
           solvents periplasmic component [Rickettsiella grylli]
          Length = 156

 Score =  107 bits (266), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 30/135 (22%), Positives = 50/135 (37%), Gaps = 2/135 (1%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M  +     VG F++  +    F  + +S  +   G     +     ++ GL   S V  
Sbjct: 1   MRERVIEIWVGFFMLFGVLALLFLAFKVSGLSSTIGRGGYNVTAAFDNIGGLKMRSPVSL 60

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTP-LYPSTTATIRTQGLAGITYIELSTLRK 119
            G+ VG +  + LD +    ++    I      L   T+A+I TQGL G  YI L+    
Sbjct: 61  AGVHVGEVSAIKLD-DLKFKAIVTMRIDSRYKQLPIDTSASILTQGLLGANYINLTPGFA 119

Query: 120 EKKTIFQIATERNQR 134
            K        +    
Sbjct: 120 HKFLNNNDIIQDTHP 134


>gi|39995921|ref|NP_951872.1| mce-related protein [Geobacter sulfurreducens PCA]
 gi|39982685|gb|AAR34145.1| mce-related protein [Geobacter sulfurreducens PCA]
 gi|298504935|gb|ADI83658.1| ABC transporter, periplasmic substrate-binding protein, MCE family
           [Geobacter sulfurreducens KN400]
          Length = 149

 Score =  107 bits (265), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 30/133 (22%), Positives = 50/133 (37%), Gaps = 2/133 (1%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M+       VG+FV+  +    +    L +     G   +V      SV GL   ++V  
Sbjct: 1   MKRVTLELIVGIFVLVGIICLAWLSVRLGQMELLGGDHYQVSADF-DSVSGLKKGATVEI 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G+ VGR+  + LD      +     IR    L     A++RT G+ G  +I+L     +
Sbjct: 60  AGVEVGRVDRIELDSSNDR-ARVYLRIRDGVKLQDDVIASVRTSGIIGDKFIKLKPGGAD 118

Query: 121 KKTIFQIATERNQ 133
           K           +
Sbjct: 119 KLLADGGRIRDTE 131


>gi|239906933|ref|YP_002953674.1| hypothetical protein DMR_22970 [Desulfovibrio magneticus RS-1]
 gi|239796799|dbj|BAH75788.1| hypothetical protein [Desulfovibrio magneticus RS-1]
          Length = 149

 Score =  107 bits (265), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 31/133 (23%), Positives = 56/133 (42%), Gaps = 2/133 (1%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M+     TSVG+FV++ L    +    L +     G   +V  +    V GL   + V  
Sbjct: 1   MKKYAMETSVGVFVLAGLLCVAYLTVKLGKLEVVGGDGYQVTAKFKD-VTGLKNGAYVEM 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G+ +GR+ G+ LD +  + +L    +  D  L     A+I+T GL G  ++++S    +
Sbjct: 60  AGVRIGRVSGIRLDPKD-HAALVGLTLDKDVRLTDDAIASIKTSGLIGDKFVKISPGGSD 118

Query: 121 KKTIFQIATERNQ 133
                       +
Sbjct: 119 DALTPGGMIVETE 131


>gi|301057236|ref|ZP_07198365.1| conserved hypothetical protein [delta proteobacterium NaphS2]
 gi|300448687|gb|EFK12323.1| conserved hypothetical protein [delta proteobacterium NaphS2]
          Length = 331

 Score =  107 bits (265), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 47/288 (16%), Positives = 97/288 (33%), Gaps = 3/288 (1%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M SK    +VGLFV   L  +  +I WL   ++Y       +     SV GL  DS V++
Sbjct: 1   MASKKAKFTVGLFVAGGLAITVLAIVWLG-MSRYFEKGRFYVTYFNESVQGLQKDSPVKY 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G+ +GR+  + +  +          I     L  S  A ++  G+ G   +EL   +  
Sbjct: 60  RGVSIGRVESIGVAPDS-KLIQVILKIETGQKLDHSIVAQLKNVGITGSMLVELDRKKMG 118

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
           +       +  ++  ++ + PS IN  +   ++                  +       +
Sbjct: 119 ESDKSPGISFPSEYPIVASKPSEINRLLQGLDDMLNHFKSIDLKGISDKLKLTLDNANIM 178

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
                I  + +   S +       +     S    + +   +   +L K  +   ++  N
Sbjct: 179 MADADIKGISSKLQSSLTSADQILKNEKWESILG-SVDHAAESADALMKNAERTLVRLEN 237

Query: 241 QILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDF 288
            I EN +  S         ++N  + + +           ++ L    
Sbjct: 238 FIGENEKPVSEAATDLRKVMVNANNLLEKWAAFISSSDDTLNRLKVQL 285


>gi|198282479|ref|YP_002218800.1| Mammalian cell entry related domain-containing protein
           [Acidithiobacillus ferrooxidans ATCC 53993]
 gi|218665055|ref|YP_002424669.1| mce-related protein [Acidithiobacillus ferrooxidans ATCC 23270]
 gi|198247000|gb|ACH82593.1| Mammalian cell entry related domain protein [Acidithiobacillus
           ferrooxidans ATCC 53993]
 gi|218517268|gb|ACK77854.1| mce-related protein [Acidithiobacillus ferrooxidans ATCC 23270]
          Length = 152

 Score =  107 bits (265), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 25/133 (18%), Positives = 48/133 (36%), Gaps = 1/133 (0%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME +     VG+FV+  +         +   + +      V+     +V  L   S V+ 
Sbjct: 1   MEKRAIDWWVGIFVLLGIAALVVLALRVGNLSGFAYNDGYVLHADFSNVGSLKPRSPVKL 60

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G+ +G +  + ++ +    +     I P   L   T A+I T+GL G  Y+ +      
Sbjct: 61  GGVTIGEVTHIGMNPKTF-MAKVTMRIEPQVKLPTDTGASIYTEGLLGEQYVSIQPGGMP 119

Query: 121 KKTIFQIATERNQ 133
           +           Q
Sbjct: 120 QDLQPGGTITMTQ 132


>gi|108563876|ref|YP_628192.1| ABC transport system substrate binding protein [Helicobacter pylori
           HPAG1]
 gi|107837649|gb|ABF85518.1| ABC transport system substrate binding protein [Helicobacter pylori
           HPAG1]
          Length = 271

 Score =  107 bits (265), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 32/201 (15%), Positives = 78/201 (38%), Gaps = 3/201 (1%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME    YT +G      L      I WL      DG   E ++     + G++T+S V +
Sbjct: 1   MERHVNYTLIGGLFFLCLVCMVGFILWLGHLGLDDGKYYEYVVYTDKDLGGIATNSPVNY 60

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            GI VG ++ +   ++         +I+    +   +   + ++GL G+ ++ L     E
Sbjct: 61  KGIQVGNVIKVGFAKDKVGVVRLDLMIKSSVKIRKDSKVAVSSRGLMGLKFLALEQSHNE 120

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
           +   F  + ++ +R +I          +   +   + +       + + +   +     +
Sbjct: 121 E---FYGSGDKGERILIFKEGLMDRLSVDANQVMQEVMRAIRNVNRILDDENVEKFKHIL 177

Query: 181 ANIETISTVLANNISHIDKMM 201
           A+++ +   L +  +  D ++
Sbjct: 178 ASVDDLIANLDSRKTQFDALI 198


>gi|88810290|ref|ZP_01125547.1| hypothetical protein NB231_14458 [Nitrococcus mobilis Nb-231]
 gi|88791920|gb|EAR23030.1| hypothetical protein NB231_14458 [Nitrococcus mobilis Nb-231]
          Length = 304

 Score =  107 bits (265), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 55/292 (18%), Positives = 106/292 (36%), Gaps = 5/292 (1%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M SK  YT VGLFVV +      +  W +   ++ G   +  +   GSV GL+  + V +
Sbjct: 1   MGSKVSYTLVGLFVVLLTIGLVATGLWFAGGLKHTGQFRQYSVYTAGSVAGLTPGAQVTY 60

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            GI VG++V + +D   P+           TP+  +T A  + +GL G T +ELS     
Sbjct: 61  KGIGVGKVVRIAIDHRDPSRVHVVLAAARSTPINTATRAAFKPRGLTGATLVELSGYAAN 120

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
              +     E         + +      + +E          +  + + E+  + + + +
Sbjct: 121 AAPLSAPPGEPYPVIRSKNS-ALTQLDQALSEGIGTLNRIGKQFEELLSEHNRQAIASIL 179

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTIT----DLITSLDKMIKAIDL 236
           A+   +S+ LA N   I++ +        +S         T    D        +     
Sbjct: 180 ADFARLSSTLATNSERIEQTLVHLDQITQNSAQITRHIPKTLGRLDRSLQGLDQLSRSLN 239

Query: 237 QKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDF 288
           Q    +    +        +  ++      +R TT     + QK++   +  
Sbjct: 240 QTATTLTGLGRSGETGLRTTMPELKALFAQIRRTTSHLDRLIQKLEREPAAL 291



 Score = 53.0 bits (124), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 25/243 (10%), Positives = 72/243 (29%), Gaps = 13/243 (5%)

Query: 197 IDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVNQILENIQVSSNNFVKS 256
           + K++         S              +                L  +   + N    
Sbjct: 65  VGKVVRIAIDHRDPSRVHVVLAAARSTPINTATRAAFKPRGLTGATLVELSGYAANAAPL 124

Query: 257 SDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNMRSSIS 316
           S         +R       ++ Q +   +   +   K  E      N     S +     
Sbjct: 125 SAPPGEPYPVIRSKNSALTQLDQALSEGIGTLNRIGKQFEELLSEHNRQAIASILADFAR 184

Query: 317 AIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNISALKENNSLFKDAQRAM 376
               +    ++I  T+  ++ IT N    ++   + + +++                + +
Sbjct: 185 LSSTLATNSERIEQTLVHLDQITQNSAQITRHIPKTLGRLDRSL-------------QGL 231

Query: 377 HTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFERNPQDI 436
                +  +    +  +G + +   ++ + +++ L  +++ T +H D  +   ER P  +
Sbjct: 232 DQLSRSLNQTATTLTGLGRSGETGLRTTMPELKALFAQIRRTTSHLDRLIQKLEREPAAL 291

Query: 437 VWG 439
           + G
Sbjct: 292 LRG 294


>gi|218961391|ref|YP_001741166.1| hypothetical protein; putative signal peptide [Candidatus
           Cloacamonas acidaminovorans]
 gi|167730048|emb|CAO80960.1| hypothetical protein; putative signal peptide [Candidatus
           Cloacamonas acidaminovorans]
          Length = 410

 Score =  106 bits (264), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 61/441 (13%), Positives = 139/441 (31%), Gaps = 32/441 (7%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M SK     +G+F++            ++ S   +      I     SV GL   SSV +
Sbjct: 1   MVSKAAKIRLGIFLIIGAILIILFAIVVAGSRLVEKKDIYYIEFEDYSVSGLQVGSSVNY 60

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            GI +GR+  + ++ +     +    +   TP+   T A +   G+ G+  +EL     E
Sbjct: 61  RGIKIGRVEDVKINPKDVTKIIITISVNRGTPIKEDTEAVLLLSGITGLKNVELRGGTNE 120

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
            K +   +  +    ++          +   +  +  ++  +    +   +     T+ I
Sbjct: 121 AKLLKPKSYIKTGTTVLEDISERAKSIVDKIDMIAANLNAITGEENRNNISTILAQTSLI 180

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
                                                 T    I+ +      +  +   
Sbjct: 181 LKDTH-----------------------------ENLATTMQSISRIANNTADLTEELSK 211

Query: 241 QILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAF 300
            +    +  + N    +    + + +V ET+QT   +    +++           ETS  
Sbjct: 212 DLSAVTENLTKNLDAITSSATSNIQNVSETSQT--SLINVTNNVNQQLEELTAKLETSLT 269

Query: 301 LENIADSTSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNIS 360
                 S     +++          Q I+ T   I  I++N+N +  +   ++      S
Sbjct: 270 QLTNDGSALIREANLKVSTVGEHSDQMILETTREILTISNNINRALDQVNAILYTPGFDS 329

Query: 361 ALKENNSLFKDAQRA-MHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETV 419
            +     L  +  R  + +         +   ++ +NL      G  D+  ++  L ET 
Sbjct: 330 LMTNLGKLSGELSRTDLKSMVTELSTTIQKTGTLVSNLNRVVTRGQGDLLEILSTLTETS 389

Query: 420 NHFDDCLNNFERNPQDIVWGR 440
            + ++        P  ++ G 
Sbjct: 390 ENLNEFSRQIADTPAILLRGN 410


>gi|298735567|ref|YP_003728088.1| putative ABC transport system substrate-binding protein
           [Helicobacter pylori B8]
 gi|298354752|emb|CBI65624.1| putative ABC transport system substrate-binding protein
           [Helicobacter pylori B8]
          Length = 271

 Score =  106 bits (264), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 23/111 (20%), Positives = 45/111 (40%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME    YT +G      L      I WL      DG   E ++     + G++T+S V +
Sbjct: 1   MERHVNYTLIGGLFFLCLVCMVGFILWLGHLGLDDGKYYEYVVYTDKDLGGIATNSPVNY 60

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITY 111
            GI VG ++ +   ++         +I+    +   +   + ++G  G+ +
Sbjct: 61  KGIQVGNVIKVGFAKDKVGVVRLDLMIKSSVKIRKDSKVAVSSRGFMGLKF 111


>gi|186477516|ref|YP_001858986.1| hypothetical protein Bphy_2768 [Burkholderia phymatum STM815]
 gi|184193975|gb|ACC71940.1| Mammalian cell entry related domain protein [Burkholderia phymatum
           STM815]
          Length = 184

 Score =  106 bits (264), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 27/117 (23%), Positives = 40/117 (34%), Gaps = 1/117 (0%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M+       VGLFVV       F        +         +     ++ GL   + V+ 
Sbjct: 1   MKKTALDFWVGLFVVLGFIALLFLALKAGNMSSLSFQATYPVKLKFDNIGGLKVRAPVKS 60

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTL 117
            G+ VGR+  +  D      +L    +         T+A I T GL G  YI L   
Sbjct: 61  AGVTVGRVGAIGFDSNSY-QALVTLDLDKQYQFPKDTSAKILTSGLLGEQYIGLEPG 116


>gi|224369298|ref|YP_002603462.1| ABC-type transporter involved in resistance to organic solvents,
           periplasmic binding component [Desulfobacterium
           autotrophicum HRM2]
 gi|223692015|gb|ACN15298.1| ABC-type transporter involved in resistance to organic solvents,
           periplasmic binding component [Desulfobacterium
           autotrophicum HRM2]
          Length = 149

 Score =  106 bits (263), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 30/133 (22%), Positives = 49/133 (36%), Gaps = 2/133 (1%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M+       VG FV+  L    + +  L       G    +     GSV GL   + V  
Sbjct: 1   MKKTTVELYVGFFVIIGLVCCAYIVVQLGGLRINQGDQYTLNA-FFGSVAGLKPGADVEM 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G+ VG++  + LD+E    +  +  +     L     A+++T G+ G  YI LS    E
Sbjct: 60  AGVAVGQVASISLDRERF-VAKVEISLDKKILLSEDVIASVKTSGIIGDKYINLSPGGSE 118

Query: 121 KKTIFQIATERNQ 133
                       +
Sbjct: 119 TTLSPGGTIFHTE 131


>gi|254442151|ref|ZP_05055627.1| mce related protein [Verrucomicrobiae bacterium DG1235]
 gi|198256459|gb|EDY80767.1| mce related protein [Verrucomicrobiae bacterium DG1235]
          Length = 154

 Score =  106 bits (263), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 33/133 (24%), Positives = 54/133 (40%), Gaps = 2/133 (1%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M SK    SVGLFV+  L    +    +  S         V      ++ GLS+ S++  
Sbjct: 1   MNSKKIDFSVGLFVLIGLLAIVYMAVQIGGSRFLGSDSRSVTAIFT-NIGGLSSGSNITI 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G+ +G +  + L+ E    +  +  I  D  L+   TA+I+T GL G  YI +      
Sbjct: 60  AGVKIGTVGPITLNPETL-KAEVELRIDNDIELFDDATASIKTNGLIGDKYIAIYPGTPG 118

Query: 121 KKTIFQIATERNQ 133
                + A    +
Sbjct: 119 IGFPLEGAIVDTE 131


>gi|303246387|ref|ZP_07332666.1| Mammalian cell entry related domain protein [Desulfovibrio
           fructosovorans JJ]
 gi|302492097|gb|EFL51972.1| Mammalian cell entry related domain protein [Desulfovibrio
           fructosovorans JJ]
          Length = 149

 Score =  106 bits (263), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 31/117 (26%), Positives = 55/117 (47%), Gaps = 2/117 (1%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M+     T+VG+FV++ L    +    L +     G    V  R    V GL + + V  
Sbjct: 1   MKKYTMETTVGVFVLAGLLCVAYLTIKLGKLEVIGGDSYSVTARFKD-VTGLKSGAYVEM 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTL 117
            G+ +GR+ G+ LD +  N ++    I+    L   + A+I+T GL G  ++++S  
Sbjct: 60  AGVRIGRVTGIRLDPKN-NMAMVTLDIQNGVRLTDDSIASIKTSGLIGDKFVKVSPG 115


>gi|316935523|ref|YP_004110505.1| mammalian cell entry related domain-containing protein
           [Rhodopseudomonas palustris DX-1]
 gi|315603237|gb|ADU45772.1| Mammalian cell entry related domain protein [Rhodopseudomonas
           palustris DX-1]
          Length = 291

 Score =  106 bits (262), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 44/242 (18%), Positives = 95/242 (39%), Gaps = 6/242 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++  Y  +G F ++++  +   + W    +        + +   G+  GL    SV F
Sbjct: 1   METRANYFLIGTFTLAVIAAALGFVLWFQSLHTTKARS-PLRVVFEGAASGLRNGGSVNF 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NG+ VG +V + LD   P   +A A++    P+   T   +  QGL G+  I L    + 
Sbjct: 60  NGVRVGEVVSVKLD--NPRRVVALAMVENTAPIRKDTQVGLEFQGLTGVAAISLKGGSET 117

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
              +     + +   ++TA P  +     + + T + ++      Q+ ++   + L T  
Sbjct: 118 APPV---PLDDDGTPVLTADPELLQDISESIKATLRNVNRLVADNQESVKTSLENLQTFT 174

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
           + +   S  + + +S +D ++  T       D+        +L  ++    +  D     
Sbjct: 175 SGLARSSDKIDSIVSRVDSVIAKTDSVMQGIDALAGGKDGGELFQAVKSFRELADNLDKR 234

Query: 241 QI 242
             
Sbjct: 235 SA 236



 Score = 52.6 bits (123), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 23/138 (16%), Positives = 57/138 (41%), Gaps = 22/138 (15%)

Query: 307 STSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNISALKENN 366
              N  S  +++  +      +  + + I++I S ++    K   +M  I+ ++  K+  
Sbjct: 156 VADNQESVKTSLENLQTFTSGLARSSDKIDSIVSRVDSVIAKTDSVMQGIDALAGGKDGG 215

Query: 367 SLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCL 426
            LF    +A+ +FR+ ++ +++                      L+   + T+      +
Sbjct: 216 ELF----QAVKSFRELADNLDKRSA------------------TLILDGRRTLADISRAV 253

Query: 427 NNFERNPQDIVWGREKGS 444
           NNF+RNP  +++G    +
Sbjct: 254 NNFDRNPTRVLFGPSNTA 271


>gi|67922747|ref|ZP_00516249.1| Mce4/Rv3499c/MTV023.06c protein [Crocosphaera watsonii WH 8501]
 gi|67855401|gb|EAM50658.1| Mce4/Rv3499c/MTV023.06c protein [Crocosphaera watsonii WH 8501]
          Length = 465

 Score =  106 bits (262), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 57/437 (13%), Positives = 139/437 (31%), Gaps = 45/437 (10%)

Query: 10  VGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRFNGIPVGRIV 69
           VGLF +  L      + WL           +       +VDGL   + VR+ G+ VG+I+
Sbjct: 12  VGLFALFGLIIFGSIVVWLRG-GILGQQTYQFFADF-ENVDGLQIGAPVRYRGVAVGKIL 69

Query: 70  GLFLDQEYPNHSLAKALIRP-DTPLYPSTTATIRTQGLAGITYIELSTLRKEKKTIFQIA 128
           GL               I   +  +   +   I   GL G   ++++  R+         
Sbjct: 70  GLQPSSNG---VTVAVEISSAELRIPKDSKVRINRSGLIGEASVDITPSRE--------- 117

Query: 129 TERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTIANIETIST 188
                          ++      +   K  + + + +    E I+    + +    T  +
Sbjct: 118 ---------------LDEEALAIDPVGKDCASAEQILCNNDEGIKGERGSQLVEALTRLS 162

Query: 189 VLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVNQILENIQV 248
              ++   +  +    +    + D   T +     ++   +         ++   +  + 
Sbjct: 163 RAYSDPEFVGNLNAAARNVAKAGDKIATLSQEVTELSKAARGEIGGVSDLISSADQAAKD 222

Query: 249 SSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAFLENIADST 308
           +S   +  +  V     D   T  +   +   +D L+S+             L +I  ++
Sbjct: 223 ASQLMLNVNTVVAENRTDFNRTVSSAANLVSNLDGLVSENRG-----NIVNTLSSIERTS 277

Query: 309 SNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNISALKENNSL 368
             +R          D+  + I  I  +  + ++L       A+    + N+S    +  +
Sbjct: 278 DQVRLLAMNFNTTVDRVNEGIDEI-DMAQLANDLEVLMANAAQTAQNLQNLSQSLNDPEV 336

Query: 369 FKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNN 428
               Q+ + + R T E   +    +     +             + +++ ++   + +  
Sbjct: 337 LVTIQKTLDSARVTFENTQKITSDVEELTGD---------PTFRQNIRKLIDGLGNLVAY 387

Query: 429 FERNPQDIVWGREKGSV 445
            E+  Q +  G+   SV
Sbjct: 388 TEQLEQQVYVGQVIESV 404


>gi|152981828|ref|YP_001354933.1| ABC-type transport system involved in resistance to organic
           solvents, periplasmic component [Janthinobacterium sp.
           Marseille]
 gi|151281905|gb|ABR90315.1| ABC-type transport system involved in resistance to organic
           solvents, periplasmic component [Janthinobacterium sp.
           Marseille]
          Length = 304

 Score =  106 bits (262), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 34/125 (27%), Positives = 58/125 (46%), Gaps = 3/125 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K +    G+F + +L  +     W +R            I    SV GL+  + VR+
Sbjct: 1   MENKAHALMAGIFTIVLLIAAVLIALWFNRDRV---ERVPYEIATTLSVPGLNPQAGVRY 57

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G+ VGR+  +  D + P   L +  +  DTP+  ST AT+  QG+ G+ Y++L     +
Sbjct: 58  RGLDVGRVDAVLFDPQKPGQILIRFSVSKDTPITHSTFATLSYQGVTGLAYVQLDDDGSQ 117

Query: 121 KKTIF 125
              + 
Sbjct: 118 PVLLP 122



 Score = 48.0 bits (111), Expect = 0.003,   Method: Composition-based stats.
 Identities = 20/124 (16%), Positives = 44/124 (35%), Gaps = 3/124 (2%)

Query: 316 SAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNISALKENNSLFKDAQRA 375
              + I      + +  N IE I   L  +  K   L +K ++            +A + 
Sbjct: 166 ENQKTILSSFSDVSAAANKIEKIPQQLQPTLDKLPALANKADSALNSIN--RFSDEATQI 223

Query: 376 MHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFERNPQD 435
                 T   I+  +    N + + +         L+ + + ++   +  L +F + PQ 
Sbjct: 224 TSKLNATGGPIDS-LDDTINKVGSAASLVEYQASPLIDETRTSMRSLNRALESFNQRPQG 282

Query: 436 IVWG 439
           I++G
Sbjct: 283 ILFG 286


>gi|332187413|ref|ZP_08389151.1| mce related family protein [Sphingomonas sp. S17]
 gi|332012574|gb|EGI54641.1| mce related family protein [Sphingomonas sp. S17]
          Length = 320

 Score =  106 bits (262), Expect = 9e-21,   Method: Composition-based stats.
 Identities = 30/132 (22%), Positives = 53/132 (40%), Gaps = 2/132 (1%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+++ +  VG  V+ +L        W++R         E  I    SVDGL+  S+V +
Sbjct: 1   METRSNHVLVGSVVLILLAVLAIFTVWIARLGGTSEK--EYDIFFRQSVDGLAKGSAVTY 58

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           +G+P G++  + L +  P     +  +   TP+   TTA+I        T       +  
Sbjct: 59  SGVPSGQVKEIALWRPDPQFVRVRVSVNEQTPILQGTTASISASFTGTSTISLDGARKGA 118

Query: 121 KKTIFQIATERN 132
                     R+
Sbjct: 119 PPITCPQPENRS 130


>gi|94986677|ref|YP_594610.1| ABC-type transport system involved in resistance to organic
           solvents, periplasmic component [Lawsonia
           intracellularis PHE/MN1-00]
 gi|94730926|emb|CAJ54289.1| ABC-type transport system involved in resistance to organic
           solvents, periplasmic component [Lawsonia
           intracellularis PHE/MN1-00]
          Length = 147

 Score =  106 bits (262), Expect = 9e-21,   Method: Composition-based stats.
 Identities = 28/129 (21%), Positives = 52/129 (40%), Gaps = 3/129 (2%)

Query: 5   NYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRFNGIP 64
           +   +VG FV+  L    +    L +   ++     V      SV GL   + V   G+ 
Sbjct: 4   SKEAAVGFFVLIGLICLGYLTIKLGKMELFNSDGYSVFATFT-SVSGLKPGAEVDIAGVK 62

Query: 65  VGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKEKKTI 124
           VGR+  + LD + P  ++ +  +  +  L     A+++T GL G  YI +S      + +
Sbjct: 63  VGRVKSIRLDNKLPR-AIVELNVNNNIHLTDDAIASVKTSGLIGDKYISISPG-GTGEPL 120

Query: 125 FQIATERNQ 133
                  + 
Sbjct: 121 KNGDEIMDT 129


>gi|84516866|ref|ZP_01004224.1| putative ABC transporter, periplasmic substrate-binding protein
           [Loktanella vestfoldensis SKA53]
 gi|84509334|gb|EAQ05793.1| putative ABC transporter, periplasmic substrate-binding protein
           [Loktanella vestfoldensis SKA53]
          Length = 564

 Score =  106 bits (262), Expect = 9e-21,   Method: Composition-based stats.
 Identities = 53/435 (12%), Positives = 134/435 (30%), Gaps = 9/435 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++  +  +G+F ++ +  +     WL+   Q D       I +   V GL    +V +
Sbjct: 1   METRANFILIGIFTLAAMLGTLGFFIWLASV-QLDRQYVTYGILL-DDVSGLDAAGAVTY 58

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NGI VG ++GL + ++ P+       +   TP+  +T A +++QG+ G+ +I LS     
Sbjct: 59  NGIAVGSVIGLRIFEDDPSKVFTIIQVDAATPVSTATIAQLQSQGVTGVAFISLSATDGV 118

Query: 121 KKTIFQIA----TERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQK--IIENIEK 174
              I   A       ++R+ + A        ++ A    +++   +    +  + + +  
Sbjct: 119 AAPIDTFAGGLPIIDSKRSTVQALVEDAPNLLAEARLLLQQVQGFAGAENQALVADILRN 178

Query: 175 PLTTTIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAI 234
              TT    + +S     + +  D     TQ T                  S    ++  
Sbjct: 179 LSRTTGRLDQALSDFSEISGTVRDATAQITQFTERLDTIGEAVEITLRSTDSALVAVQQA 238

Query: 235 DLQKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKS 294
            +     +     +        +         +        E   + +  + D  ++   
Sbjct: 239 FVSADVVLNTTGPMLDRADGAFTLAENLLREQIPMILAQVSETVLQTNAAVQDIQTRTGR 298

Query: 295 KETSAFLENIADSTSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMS 354
                       +   +    +             ++ +    +  +      +    ++
Sbjct: 299 TLDGFGETAALLNARLVELETTLADATIAFDAVTTASESLEVLVEGDGAALIAEVRAAVA 358

Query: 355 KINNISALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRK 414
            +  +    +   +  D +RA+ T     E +   +      L   +  G   +      
Sbjct: 359 TVETVVNT-DLPLIVADVRRAVQTASVAVEDVAADVTGFTGRLTPLADDGQAALTAATDL 417

Query: 415 LQETVNHFDDCLNNF 429
           + +            
Sbjct: 418 IAQAQTSLAALNTTL 432


>gi|121607912|ref|YP_995719.1| hypothetical protein Veis_0922 [Verminephrobacter eiseniae EF01-2]
 gi|121552552|gb|ABM56701.1| Mammalian cell entry related domain protein [Verminephrobacter
           eiseniae EF01-2]
          Length = 321

 Score =  106 bits (262), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 36/175 (20%), Positives = 73/175 (41%), Gaps = 6/175 (3%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K++  + GLFV+ +         WL+R N Y     E  +     V GL   ++VR+
Sbjct: 1   MENKSHALAAGLFVLLVAAMLAGLSLWLTRDNAY---YEEYELSTRDGVSGLQPQANVRY 57

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G+ VG++  +  D +   + L +  +    P+ P+T A +  QG+ G+ ++ L      
Sbjct: 58  KGVAVGKVTRIGFDPQVNGNVLIRIAVNEQAPISPTTYAVLGYQGVTGLAHVLLDDAATP 117

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKP 175
              +            +   PS        A     +  +++R I +++ +  + 
Sbjct: 118 YPALPPGP---GGLPRLPLKPSPFGRLAEQAPTILAQADEATRRINQLLGDGNQQ 169


>gi|114330427|ref|YP_746649.1| hypothetical protein Neut_0406 [Nitrosomonas eutropha C91]
 gi|114307441|gb|ABI58684.1| Mammalian cell entry related domain protein [Nitrosomonas eutropha
           C91]
          Length = 301

 Score =  106 bits (262), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 50/288 (17%), Positives = 109/288 (37%), Gaps = 10/288 (3%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++ +  + GLFV+ +   +  ++ WLSR N         +I   GSV GL+ ++SVR+
Sbjct: 1   MENRAHAFAAGLFVLLLGVAAVMAVKWLSRDNI--NHNHYFLISAGGSVSGLNPEASVRY 58

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G+ +G++  ++ D+E   + + +  +     L  +  A + +QG+ G+TY+EL+     
Sbjct: 59  RGVNIGKVEEIYFDKENIRNIIVRIAVSSHVTLPKNIYAQLASQGITGLTYVELNDDVS- 117

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
                  A      A I    S I     + E   K  +   + I  ++    +     I
Sbjct: 118 ----EAGAGYLENEAHIFLRSSLIKTLSDSLEEILKNSNTVIKQINNLLNKKNQAHIGKI 173

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
            +          +   + + +            + T           +       L +  
Sbjct: 174 LSH---LEQTVQHYDKLTEELQNGLQALPQLTGEFTSTFRQTRQVMENTSQVLQKLNQQQ 230

Query: 241 QILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDF 288
            +++N+   S     + D +  T   V ++T+   ++   ++      
Sbjct: 231 GLIDNLTQGSLEMAHTLDSLNETGQAVTQSTRKLNQLLNLLEAHPQSL 278



 Score = 45.3 bits (104), Expect = 0.021,   Method: Composition-based stats.
 Identities = 19/126 (15%), Positives = 49/126 (38%), Gaps = 4/126 (3%)

Query: 317 AIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNISALKENNSLFKDAQRAM 376
                   +  I   ++ +E    + +  +++    +  +  ++   E  S F+  ++ M
Sbjct: 159 NNLLNKKNQAHIGKILSHLEQTVQHYDKLTEELQNGLQALPQLTG--EFTSTFRQTRQVM 216

Query: 377 HTFRDTSEKINRYIPSIGNNLQNFS--QSGLNDIQNLVRKLQETVNHFDDCLNNFERNPQ 434
                  +K+N+    I N  Q        L+ +    + + ++    +  LN  E +PQ
Sbjct: 217 ENTSQVLQKLNQQQGLIDNLTQGSLEMAHTLDSLNETGQAVTQSTRKLNQLLNLLEAHPQ 276

Query: 435 DIVWGR 440
            +V+G+
Sbjct: 277 SLVFGK 282


>gi|188590869|ref|YP_001795469.1| ABC transporter periplasmic protein [Cupriavidus taiwanensis LMG
           19424]
 gi|170937763|emb|CAP62747.1| putative ABC-type transporter, periplasmic component [Cupriavidus
           taiwanensis LMG 19424]
          Length = 314

 Score =  106 bits (262), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 38/316 (12%), Positives = 108/316 (34%), Gaps = 11/316 (3%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K++    G+F + +     F+I+W S  +          +    +V+GL   + V++
Sbjct: 2   MENKSHAFLAGVFTIGLAVLVLFAIFWFSSDHAV---RVPYDLITRSTVNGLGPQADVKY 58

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G+ VG++  +  D + P   + +  +  +TP+  +T AT+  QG+ GI Y++L      
Sbjct: 59  RGLAVGKVESIKFDPQVPGQIIVRVNVNRETPITRTTYATLGFQGVTGIAYVQLDDSAAH 118

Query: 121 KKTIFQIATERNQR------AMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEK 174
                      + R                    S        +   +   +    +   
Sbjct: 119 DGAGASPPLPTSPRAVARIAMRPGFFEELEKRGDSLLTQAETLMGSLNDMFRGANRDELM 178

Query: 175 PLTTTIANIETISTVLANNISHIDKMMHTTQVTPHS--SDSKNTFNTITDLITSLDKMIK 232
               ++       + L+++++   + +       ++    ++     + +   ++ + + 
Sbjct: 179 AAIRSVRKTAEDYSRLSDSLAPAAQRLPKVAENLNATLESTRRLTQELANPNGTVMRTVD 238

Query: 233 AIDLQKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKM 292
           ++              +     ++  Q+     D R+T ++F+    + +   S      
Sbjct: 239 SVGRDLQGAAASVQSAAGTFHEETLPQLNGLARDARQTARSFERAAGQFNESPSSVLFGA 298

Query: 293 KSKETSAFLENIADST 308
            +          + + 
Sbjct: 299 PAPTPGPGEPGFSAAP 314


>gi|170695755|ref|ZP_02886897.1| Mammalian cell entry related domain protein [Burkholderia graminis
           C4D1M]
 gi|170139360|gb|EDT07546.1| Mammalian cell entry related domain protein [Burkholderia graminis
           C4D1M]
          Length = 184

 Score =  106 bits (262), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 27/122 (22%), Positives = 40/122 (32%), Gaps = 1/122 (0%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M+       VGLFVV       F        +         +     ++ GL   + V+ 
Sbjct: 1   MKKTALDFWVGLFVVLGFVALLFLALKAGNMSSLSFQATYPVKLKFDNIGGLKARAPVKS 60

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G+ VGR+  +  D      +     I         T+A I T GL G  YI L      
Sbjct: 61  AGVTVGRVASIGFDSNAY-QAQVTIDIDKQYQFPKDTSAKILTSGLLGEQYIGLEPGGDT 119

Query: 121 KK 122
           + 
Sbjct: 120 EM 121


>gi|119897099|ref|YP_932312.1| hypothetical protein azo0808 [Azoarcus sp. BH72]
 gi|119669512|emb|CAL93425.1| conserved hypothetical secreted protein [Azoarcus sp. BH72]
          Length = 157

 Score =  105 bits (261), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 29/117 (24%), Positives = 42/117 (35%), Gaps = 1/117 (0%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M        VG+FV   L    F    +   +  +G     I     ++ GL   + V+ 
Sbjct: 1   MSRTTLDLWVGIFVALGLAALVFLAMKVGNFSGLNGAALYSIEAPFDNIGGLKVRAPVKS 60

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTL 117
            G+ VGR+  +  D E       +  I         T ATI T GL G  Y+ L   
Sbjct: 61  AGVLVGRVADIRFDPESYRAV-VRLDIDTRYRFPRDTIATILTSGLLGEQYVGLEPG 116


>gi|146341948|ref|YP_001206996.1| ABC transporter periplasmic-binding protein [Bradyrhizobium sp.
           ORS278]
 gi|146194754|emb|CAL78779.1| Putative ABC transporter (periplasmic binding protein)
           [Bradyrhizobium sp. ORS278]
          Length = 293

 Score =  105 bits (261), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 43/201 (21%), Positives = 83/201 (41%), Gaps = 6/201 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++  Y  +G F +++L  +   + W    +      + + +   G   GL    SV F
Sbjct: 1   METRANYVLIGSFTLAVLAAAVGFVLWFQSLHTT-KQRSPLRVVFEGPAAGLRNGGSVNF 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NGI VG ++ + LD   P   +A A++  + P+   T   +  QGL G+  I L    + 
Sbjct: 60  NGIRVGEVISVKLD--NPRRVVALAMVENNAPIRKDTLVGLEFQGLTGVAAISLKGGEE- 116

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
                    + +   ++ A P+ +         T + I+      Q+ ++N  K L    
Sbjct: 117 --AAPPPPLDEDGVPLLRADPTRLQDVTEAIRATLQNINKVVADNQEAVKNSIKNLEVFT 174

Query: 181 ANIETISTVLANNISHIDKMM 201
            ++   S  +   +S +D +M
Sbjct: 175 QSLARNSERIDGVMSRVDGIM 195



 Score = 53.4 bits (125), Expect = 8e-05,   Method: Composition-based stats.
 Identities = 22/133 (16%), Positives = 56/133 (42%), Gaps = 8/133 (6%)

Query: 312 RSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNISALKENNSLFKD 371
            +  +  + + D ++ + ++I  +E  T +L  +S++   +MS+++ I    +   L  +
Sbjct: 147 ATLQNINKVVADNQEAVKNSIKNLEVFTQSLARNSERIDGVMSRVDGIMGKADTLMLGLN 206

Query: 372 AQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFER 431
                    +    + + I  +  +    S         L+   + T++     +NNF+R
Sbjct: 207 TLAGGKDGGELFLTV-KSIRELAEDFDKRSG-------ALMADGRRTLSDISRAVNNFDR 258

Query: 432 NPQDIVWGREKGS 444
           NP  +++G    S
Sbjct: 259 NPTRVLFGASNSS 271


>gi|189218798|ref|YP_001939439.1| organic solvents resistance ABC-type transport system, periplasmic
           component [Methylacidiphilum infernorum V4]
 gi|189185656|gb|ACD82841.1| organic solvents resistance ABC-type transport system, periplasmic
           component [Methylacidiphilum infernorum V4]
          Length = 261

 Score =  105 bits (261), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 31/134 (23%), Positives = 47/134 (35%), Gaps = 1/134 (0%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME KN    VGLF++  L      I +  R  +   P  ++ +  P +  GL   + V+F
Sbjct: 1   MEPKNLEIKVGLFLLIGLAILGGLIIYFGRYGEKFRPSYQITVEFP-NAYGLIKGAPVQF 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G PVGR+V                 I  D  +       I   G+ G   I ++     
Sbjct: 60  AGAPVGRVVSTPRQIREGRAVEVDLKINADAKIRKDALFQIVDVGMLGDKAIAITPKGTT 119

Query: 121 KKTIFQIATERNQR 134
              +      R  R
Sbjct: 120 APFLRNGDKVRGSR 133


>gi|46579655|ref|YP_010463.1| hypothetical protein DVU1244 [Desulfovibrio vulgaris str.
           Hildenborough]
 gi|120602862|ref|YP_967262.1| hypothetical protein Dvul_1818 [Desulfovibrio vulgaris DP4]
 gi|46449070|gb|AAS95722.1| conserved hypothetical protein [Desulfovibrio vulgaris str.
           Hildenborough]
 gi|120563091|gb|ABM28835.1| Mammalian cell entry related domain protein [Desulfovibrio vulgaris
           DP4]
 gi|311233453|gb|ADP86307.1| Mammalian cell entry related domain protein [Desulfovibrio vulgaris
           RCH1]
          Length = 148

 Score =  105 bits (261), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 33/117 (28%), Positives = 53/117 (45%), Gaps = 2/117 (1%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M   +  T+ G+FV+  L    +    L R          V+ +   SV GL   + V  
Sbjct: 1   MNKYSRETAAGVFVLLGLLCVAYLTVKLGRMELLADKGYTVMCKFS-SVTGLRVGAEVEI 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTL 117
            G+PVGR+  + LD+E+P  ++    I     L     A+++T GL G  Y++LS  
Sbjct: 60  AGVPVGRVASITLDREHP-LAVVGLRINEGVKLTDDVIASVKTSGLIGDKYVKLSPG 115


>gi|206889644|ref|YP_002248718.1| ABC transporter substrate binding protein [Thermodesulfovibrio
           yellowstonii DSM 11347]
 gi|206741582|gb|ACI20639.1| ABC transporter substrate binding protein [Thermodesulfovibrio
           yellowstonii DSM 11347]
          Length = 147

 Score =  105 bits (261), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 27/133 (20%), Positives = 54/133 (40%), Gaps = 3/133 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M+ ++    VG+FV+  +    +  + L + + +      V       V G+   S V  
Sbjct: 1   MKKEHLEILVGVFVLIGILSLGYLSFRLGKIDMFKTGYYTVYAEF-DKVGGIKKGSVVEI 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G+PVG +  + L       ++ +  I     L   + A+IRT+GL G  Y++++    E
Sbjct: 60  AGVPVGSVEKVTL--NNKYQAVVELKILSSIKLPDDSIASIRTKGLIGEKYVQITPGGSE 117

Query: 121 KKTIFQIATERNQ 133
           +           +
Sbjct: 118 QYIAQNGKIRETE 130


>gi|326388335|ref|ZP_08209931.1| hypothetical protein Y88_3218 [Novosphingobium nitrogenifigens DSM
           19370]
 gi|326207067|gb|EGD57888.1| hypothetical protein Y88_3218 [Novosphingobium nitrogenifigens DSM
           19370]
          Length = 312

 Score =  105 bits (261), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 36/298 (12%), Positives = 83/298 (27%), Gaps = 2/298 (0%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++  +  VG   + +L        W++R N  +    +  I    SV+G++  S+V F
Sbjct: 1   METRANHIWVGAVTLFLLVGVAALAIWIARLNHPEQR--QYDIFFKQSVEGVAKGSTVSF 58

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           +G+P G++  + L ++ P     +  I    P+   TTA+++       T      +R  
Sbjct: 59  SGVPAGQVADISLWEKDPEFVRVRIRIDRKVPILIGTTASLQGSFTGVTTIQLSGAVRGA 118

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
                +            +    +        +    ++D    +               
Sbjct: 119 PPITEKGPAGVPVIPTKRSGLGELLSSAPVLLDRLAGLTDRLSMLVSDQNIKAVDHILGN 178

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
               T S   A              +   +    +          S++   K +  Q   
Sbjct: 179 TERMTGSLAQAAPEVKATLAELQATIRQANYTLASFEKLSDSTNDSINNPDKGVVRQLRE 238

Query: 241 QILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETS 298
            +      +++      D           T    +   + +              +  
Sbjct: 239 TLKSANAAANSLQGMVDDARPGMRRLNDRTLPAAESALRDLQTTTRSLRDLTDQMKDR 296


>gi|188528236|ref|YP_001910923.1| ABC transport system substrate binding protein [Helicobacter pylori
           Shi470]
 gi|188144476|gb|ACD48893.1| ABC transport system substrate binding protein [Helicobacter pylori
           Shi470]
 gi|308064223|gb|ADO06110.1| ABC transport system substrate binding protein [Helicobacter pylori
           Sat464]
          Length = 271

 Score =  105 bits (261), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 29/206 (14%), Positives = 74/206 (35%), Gaps = 3/206 (1%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME    YT +G      L      I WL      DG   E ++     + G++T+S V +
Sbjct: 1   MERHVNYTLIGGLFFLCLVCMVGFILWLGHLGLEDGKYYEYVVYTDKDLGGIATNSPVNY 60

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            GI VG ++ +   ++         +I+    +   +   + ++G  G+ ++ L     E
Sbjct: 61  KGIQVGNVIKVGFAKDKVGVVRLDLMIKSSVKIRKDSKVAVSSRGFMGLKFLALEQSHNE 120

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
           +      + ++ +R +I          +   +   + +       + + +   +     +
Sbjct: 121 EFY---GSGDKGERILIFKEGFMDRLSVDANQVMQEVMKAIKNVNKILDDENVEKFKHIL 177

Query: 181 ANIETISTVLANNISHIDKMMHTTQV 206
            +++ +   L +     D ++     
Sbjct: 178 VSVDDLIANLDSRKVQFDALIKNANN 203



 Score = 43.4 bits (99), Expect = 0.076,   Method: Composition-based stats.
 Identities = 13/136 (9%), Positives = 45/136 (33%), Gaps = 2/136 (1%)

Query: 304 IADSTSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNISALK 363
             +   +  S  +        +          +              +L++ ++  S   
Sbjct: 135 FKEGFMDRLSVDANQVMQEVMKAIKNVNKILDDENVEKFKHILVSVDDLIANLD--SRKV 192

Query: 364 ENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFD 423
           + ++L K+A   + +  + +  +++ +     + +      +   Q  +R +   V    
Sbjct: 193 QFDALIKNANNLVSSANNVALDVDKRLKEGQYDFKAMFTPLIMQAQLSLRNIDNFVEKGS 252

Query: 424 DCLNNFERNPQDIVWG 439
             ++ F+ NP   ++G
Sbjct: 253 ALIDKFDANPYKTIFG 268


>gi|189426232|ref|YP_001953409.1| hypothetical protein Glov_3183 [Geobacter lovleyi SZ]
 gi|189422491|gb|ACD96889.1| Mammalian cell entry related domain protein [Geobacter lovleyi SZ]
          Length = 150

 Score =  105 bits (261), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 24/121 (19%), Positives = 47/121 (38%), Gaps = 1/121 (0%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M S      VG+F++  +    +    L +     G    +  R   SV GL   + V  
Sbjct: 1   MNSAKLELIVGIFMLIGILCLGYLSIKLGKMELIGGNNYRISARF-DSVSGLKPGARVEL 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G+ +G +  + L     + +     I+    +     A++RT G+ G  +I+L     +
Sbjct: 60  AGVEIGTVERIGLSNASGDQAEVTMKIKDGIKITDDVIASVRTSGIIGDKFIKLKPGGSD 119

Query: 121 K 121
           +
Sbjct: 120 Q 120


>gi|73539805|ref|YP_294325.1| hypothetical protein Reut_A0099 [Ralstonia eutropha JMP134]
 gi|72117218|gb|AAZ59481.1| Mammalian cell entry related [Ralstonia eutropha JMP134]
          Length = 313

 Score =  105 bits (260), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 44/296 (14%), Positives = 106/296 (35%), Gaps = 11/296 (3%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K++    G+F + +     F+I+W S  +          +    +V+GL   + V++
Sbjct: 2   MENKSHAFLAGVFTIGLAVLVLFAIFWFSSDHAV---RVPYDLVTRSTVNGLGPQADVKY 58

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELST---- 116
            G+ VG++V +  D + P   + +  +  DTP+  +T AT+  QG+ GI Y++L      
Sbjct: 59  RGLEVGKVVSIRFDPQVPGQIIVRVNVNKDTPITRTTYATLGFQGVTGIAYVQLDDTAAE 118

Query: 117 -LRKEKKTIFQIATERNQRAMIT-ATPSGINYFISNAENTSKKISDSSRHIQKIIENIEK 174
                   +        + AM             S        ++  +   Q        
Sbjct: 119 EGNGASPPLHTSPKAVARIAMRPGFFEELEKRGDSLLTQVETMMTSLNDMFQGGNRAELM 178

Query: 175 PLTTTIANIETISTVLANNISHIDKMMHTTQVTPHS--SDSKNTFNTITDLITSLDKMIK 232
               +I       + L+++++     +       ++    ++   + +++   ++ + + 
Sbjct: 179 AAIRSIHKTAEDYSKLSDSLAPAAARLPKVAENLNATLESTRKLTHDLSNPNGTVLRTVD 238

Query: 233 AIDLQKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDF 288
            +              +     ++  QV     D R+T +TF     +     +  
Sbjct: 239 TVGRDLQGAAASIQSAAGTLSQETLPQVNGLARDARQTMRTFDRAAGQFSDSPNSL 294



 Score = 56.9 bits (134), Expect = 7e-06,   Method: Composition-based stats.
 Identities = 30/167 (17%), Positives = 61/167 (36%), Gaps = 12/167 (7%)

Query: 273 TFQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNMRSSISAIREITDQRQKIISTI 332
            F+E+ ++ D LL+   + M S        N A+  + +RS      + +     +    
Sbjct: 143 FFEELEKRGDSLLTQVETMMTSLNDMFQGGNRAELMAAIRSIHKTAEDYSKLSDSLAPAA 202

Query: 333 NTIENITSNLNDSSQKFAELMSKINNISALKENNSLFKDAQRAMHTFRDTSEKINRYIPS 392
             +  +  NLN + +   +L   ++N +               + T       +     S
Sbjct: 203 ARLPKVAENLNATLESTRKLTHDLSNPNGT------------VLRTVDTVGRDLQGAAAS 250

Query: 393 IGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFERNPQDIVWG 439
           I +     SQ  L  +  L R  ++T+  FD     F  +P  +++G
Sbjct: 251 IQSAAGTLSQETLPQVNGLARDARQTMRTFDRAAGQFSDSPNSLLFG 297


>gi|257092254|ref|YP_003165895.1| Mammalian cell entry related domain-containing protein [Candidatus
           Accumulibacter phosphatis clade IIA str. UW-1]
 gi|257044778|gb|ACV33966.1| Mammalian cell entry related domain protein [Candidatus
           Accumulibacter phosphatis clade IIA str. UW-1]
          Length = 157

 Score =  105 bits (260), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 30/123 (24%), Positives = 41/123 (33%), Gaps = 3/123 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQY-DGPMAEVIIRIPGSVDGLSTDSSVR 59
           M  K     VG FV   L    F    +   +         +  +   ++ GL   + V+
Sbjct: 1   MSRKLLDLWVGFFVALGLAGVLFLALKVGNLSAANFSEAYPLTAKF-ANIGGLKVRAPVK 59

Query: 60  FNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRK 119
             G+ VGR+  +  D E          I         T A I T GL G  YI L     
Sbjct: 60  SAGVVVGRVADVRFDPETYEAV-VTFSIDGRYHFPKDTFALILTSGLLGEQYIGLDPGGD 118

Query: 120 EKK 122
           EK 
Sbjct: 119 EKM 121


>gi|83719099|ref|YP_440933.1| ABC transporter periplasmic substrate-binding protein [Burkholderia
           thailandensis E264]
 gi|167617724|ref|ZP_02386355.1| ABC transporter, periplasmic substrate-binding protein
           [Burkholderia thailandensis Bt4]
 gi|257140412|ref|ZP_05588674.1| ABC transporter, periplasmic substrate-binding protein
           [Burkholderia thailandensis E264]
 gi|83652924|gb|ABC36987.1| ABC transporter, periplasmic substrate-binding protein
           [Burkholderia thailandensis E264]
          Length = 309

 Score =  105 bits (260), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 41/282 (14%), Positives = 102/282 (36%), Gaps = 5/282 (1%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K++    GLF +++L     ++YW +             +    +V GL  D++VR+
Sbjct: 1   MENKSHAFWAGLFTIALLAAIVGAVYWFNVDRTV---RVPYDLVSRSNVTGLFPDAAVRY 57

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G+ VG++  +  D+ +P   + + L+    P+  ST  ++  QG+ GI +++L     +
Sbjct: 58  RGLDVGKVQSIDFDRGHPGQIVIRILVDTHAPITRSTFGSLGFQGVTGIAFVQLDDTGAD 117

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHI--QKIIENIEKPLTT 178
              +   A    Q  M  +    +           +  + S   +    + + ++    +
Sbjct: 118 LAPLPTSAKAVAQIPMRPSLFDQLQQRGDVLLKQMEIAAKSVNEMLSPDMRDQLKATAAS 177

Query: 179 TIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQK 238
                + ++ +       + +M  T +   H+  + N        + +            
Sbjct: 178 MQHAADGVTHLSRQVEPALAQMPQTMEHVNHALSAANALVAPGGPLVTNLNRAGQALASM 237

Query: 239 VNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQK 280
            + + E       + +   + +   V D   T +       +
Sbjct: 238 NDTLAELSARVRYDTLPRFNALATNVGDASRTLKDVAGDVGR 279



 Score = 44.5 bits (102), Expect = 0.031,   Method: Composition-based stats.
 Identities = 22/173 (12%), Positives = 50/173 (28%), Gaps = 11/173 (6%)

Query: 268 RETTQTFQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNMRSSISAIREITDQRQK 327
            +            D L       +K  E +A   N   S        +    +      
Sbjct: 125 AKAVAQIPMRPSLFDQLQQRGDVLLKQMEIAAKSVNEMLSPDMRDQLKATAASMQHAADG 184

Query: 328 IISTINTIENITSNLNDSSQKFAELMSKINNISALKE-NNSLFKDAQRAMHTFRDTSEKI 386
           +      +E   + +  + +     +S  N + A      +    A +A+ +  DT  ++
Sbjct: 185 VTHLSRQVEPALAQMPQTMEHVNHALSAANALVAPGGPLVTNLNRAGQALASMNDTLAEL 244

Query: 387 NRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFERNPQDIVWG 439
           +  +              L     L   + +      D   +  RNP+ +++G
Sbjct: 245 SARVR----------YDTLPRFNALATNVGDASRTLKDVAGDVGRNPRSLLFG 287


>gi|167561348|ref|ZP_02354264.1| ABC transporter, periplasmic substrate-binding protein
           [Burkholderia oklahomensis EO147]
 gi|167568580|ref|ZP_02361454.1| ABC transporter, periplasmic substrate-binding protein
           [Burkholderia oklahomensis C6786]
          Length = 309

 Score =  105 bits (260), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 42/282 (14%), Positives = 103/282 (36%), Gaps = 5/282 (1%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K++    GLF + +L     ++YW +             +    +V GL  D++VR+
Sbjct: 1   MENKSHAFWAGLFTIGLLLAIVGAVYWFNVDRTV---RVPYDLVSRSNVTGLFPDAAVRY 57

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G+ VG++  +  D+ +P   + + L+  + P+  ST  ++  QG+ GI +++L     +
Sbjct: 58  RGLDVGKVQSINFDRGHPGEIVIRILVDTNAPITRSTFGSLGFQGVTGIAFVQLDDTGAD 117

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHI--QKIIENIEKPLTT 178
           +  +   A    Q  M  +    +           +  + S   +   ++ + ++    +
Sbjct: 118 QAPLPTSAKAVAQIPMHPSLFDQLQQRGDVLLKQMEIAAKSINEMLSPEMRDQLKATAAS 177

Query: 179 TIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQK 238
                + ++ +       + +M  T     H+  S N        + +            
Sbjct: 178 MQHAADGVTRLSKQVEPALAQMPETMAHVNHALTSANALVAPGGPLVTNLNRAGQALASM 237

Query: 239 VNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQK 280
            + + E       + +   + +   V D   T +       +
Sbjct: 238 NDTLAELSARVRYDTLPRFNALATNVGDASRTLKDVAGDVGR 279



 Score = 44.2 bits (101), Expect = 0.045,   Method: Composition-based stats.
 Identities = 21/173 (12%), Positives = 50/173 (28%), Gaps = 11/173 (6%)

Query: 268 RETTQTFQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNMRSSISAIREITDQRQK 327
            +            D L       +K  E +A   N   S        +    +      
Sbjct: 125 AKAVAQIPMHPSLFDQLQQRGDVLLKQMEIAAKSINEMLSPEMRDQLKATAASMQHAADG 184

Query: 328 IISTINTIENITSNLNDSSQKFAELMSKINNISALKE-NNSLFKDAQRAMHTFRDTSEKI 386
           +      +E   + + ++       ++  N + A      +    A +A+ +  DT  ++
Sbjct: 185 VTRLSKQVEPALAQMPETMAHVNHALTSANALVAPGGPLVTNLNRAGQALASMNDTLAEL 244

Query: 387 NRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFERNPQDIVWG 439
           +  +              L     L   + +      D   +  RNP+ +++G
Sbjct: 245 SARVR----------YDTLPRFNALATNVGDASRTLKDVAGDVGRNPRSLLFG 287


>gi|254419715|ref|ZP_05033439.1| mce related protein [Brevundimonas sp. BAL3]
 gi|196185892|gb|EDX80868.1| mce related protein [Brevundimonas sp. BAL3]
          Length = 312

 Score =  105 bits (260), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 51/298 (17%), Positives = 108/298 (36%), Gaps = 8/298 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME   +Y +VG+  V ++        WL+R  Q++       I   G V+GLS    V F
Sbjct: 1   MERDAHYAAVGIATVCLMAALAVFTIWLARL-QFNSDYDLYDIVFYGPVNGLSEGGEVHF 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NGI VG +  L +D +  +  +A+  +   TP+  ++ A +  QG+ G+ YI+++     
Sbjct: 60  NGIRVGEVTDLNIDTKRGDQVIARVRVDGTTPVRVTSRAQLEPQGITGLNYIQITAGSPN 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
              +     +     ++ + PS I   +S +     +  D+   I +++ +      +T 
Sbjct: 120 SALLKDQYPDN-VVPVLQSQPSPIAELLSGSGTVLAQTVDALNRINRVMSDDNIRSFSTS 178

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTF------NTITDLITSLDKMIKAI 234
                  T        I   +       +++  +           +          I   
Sbjct: 179 VKNVEALTTELEARKAIFAELEAAVKNANATILEYQGLAADMRAVVNTDGREAIANINQA 238

Query: 235 DLQKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKM 292
             +    I    +  +       D   +++  +  T +  QE  + +  L+ D  +  
Sbjct: 239 TAEARTAIASANRSITGLERPLGDFATSSLPQLSGTIEELQEATRSLQALIDDVRASP 296


>gi|85858105|ref|YP_460307.1| organic solvents resistance ABC transporter periplasmic protein
           [Syntrophus aciditrophicus SB]
 gi|85721196|gb|ABC76139.1| ABC-type transport system involved in resistance to organic
           solvents, periplasmic component [Syntrophus
           aciditrophicus SB]
          Length = 172

 Score =  105 bits (260), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 32/134 (23%), Positives = 54/134 (40%), Gaps = 2/134 (1%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M+     T+VG+F+   +    +    L   + +     ++  R   SV GL + S V  
Sbjct: 13  MKKYAMETTVGIFLAVGIILIGYMTVKLGHVSLFGDDTYKLSARFT-SVSGLRSGSPVNM 71

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            GI +GR+  L +DQ+       +  IR D  +Y    A+I+T+GL G  Y+ +      
Sbjct: 72  LGIEIGRVEKLAIDQQDLRAV-VEMSIRKDIKIYDDAIASIKTEGLIGDKYLSIDPGGGG 130

Query: 121 KKTIFQIATERNQR 134
                       Q 
Sbjct: 131 DPLQPGGTITETQP 144


>gi|148256835|ref|YP_001241420.1| ABC transporter periplasmic-binding protein [Bradyrhizobium sp.
           BTAi1]
 gi|146409008|gb|ABQ37514.1| Putative ABC transporter (periplasmic binding protein)
           [Bradyrhizobium sp. BTAi1]
          Length = 292

 Score =  105 bits (260), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 42/201 (20%), Positives = 82/201 (40%), Gaps = 6/201 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++  Y  +G F ++++  +   + W    +      + + +   G   GL    SV F
Sbjct: 1   METRANYVLIGSFTLAVIAAAVGFVLWFQSLHTT-KQRSPLRVVFEGPAAGLRNGGSVNF 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NGI VG ++ + LD   P   +A A++  + P+   T   +  QGL G+  I L    + 
Sbjct: 60  NGIRVGEVISVKLD--NPRRVVALAMVENNAPIRKDTLVGLEFQGLTGVAAIALKGGEE- 116

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
                    + +   ++ A P+ +         T + I+      Q  ++N  K L    
Sbjct: 117 --AAPPPPLDEDGVPVLRADPTRLQDVTEAIRATLQNINKVVADNQDAVKNSIKNLEVFT 174

Query: 181 ANIETISTVLANNISHIDKMM 201
            ++   S  +   +S +D +M
Sbjct: 175 QSLARNSERIDGVMSRVDGIM 195



 Score = 52.2 bits (122), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 22/133 (16%), Positives = 56/133 (42%), Gaps = 8/133 (6%)

Query: 312 RSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNISALKENNSLFKD 371
            +  +  + + D +  + ++I  +E  T +L  +S++   +MS+++ I    +   L  +
Sbjct: 147 ATLQNINKVVADNQDAVKNSIKNLEVFTQSLARNSERIDGVMSRVDGIMGKADTLMLGLN 206

Query: 372 AQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFER 431
           +        +    + + I  +  +    S         L+   + T++     +NNF+R
Sbjct: 207 SLAGGKDGGELFLTV-KSIRELAEDFDKRSG-------ALMADGRRTLSDISRAVNNFDR 258

Query: 432 NPQDIVWGREKGS 444
           NP  +++G    S
Sbjct: 259 NPTRVLFGASNSS 271


>gi|116747922|ref|YP_844609.1| hypothetical protein Sfum_0474 [Syntrophobacter fumaroxidans MPOB]
 gi|116696986|gb|ABK16174.1| Mammalian cell entry related domain protein [Syntrophobacter
           fumaroxidans MPOB]
          Length = 164

 Score =  105 bits (260), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 30/135 (22%), Positives = 51/135 (37%), Gaps = 4/135 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME +     VGLF++  L    +  + L   N + G    V  +    V GL   + V  
Sbjct: 1   MERRGLEFGVGLFLLIGLACLGYLSFKLGHLNLWGGSDYPVTAKFST-VAGLKDKAKVFM 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G+ +G +  + L       ++    I  D  L     A+I+T GL G  Y+ ++    +
Sbjct: 60  AGVAIGEVQSIGL---KDGEAVVTLSINKDVKLEDDVIASIKTSGLIGDKYVSVTAGASD 116

Query: 121 KKTIFQIATERNQRA 135
           +      A    Q  
Sbjct: 117 QYIKPGGAIRDTQPP 131


>gi|134096233|ref|YP_001101308.1| ABC transporter periplasmic substrate-binding protein
           [Herminiimonas arsenicoxydans]
 gi|133740136|emb|CAL63187.1| putative ABC transporter [Herminiimonas arsenicoxydans]
          Length = 155

 Score =  105 bits (260), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 29/117 (24%), Positives = 44/117 (37%), Gaps = 1/117 (0%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M+ K+    VGLFVV       F        + +       +I    ++ GL   + V+ 
Sbjct: 1   MQRKSLDLWVGLFVVLGAVALLFLALKAGNMSSFSFEKNYTVITRFDNIGGLKPRAPVKS 60

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTL 117
            G+ VGR+  +  D +    +     I         T+A I T GL G  YI L   
Sbjct: 61  AGVVVGRVADIKFD-DKHYQASVTLDIESRYQFPKDTSAKILTSGLLGEQYIGLEAG 116


>gi|134096150|ref|YP_001101225.1| putative signal peptide protein [Herminiimonas arsenicoxydans]
 gi|133740053|emb|CAL63104.1| putative ABC-type transporter [Herminiimonas arsenicoxydans]
          Length = 311

 Score =  105 bits (260), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 34/128 (26%), Positives = 58/128 (45%), Gaps = 3/128 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K +    G+F +++L  +     W +R            I    SV GL+  + VR+
Sbjct: 1   MENKAHALLAGIFTIALLIAAVLIALWFNRDRV---ERVPYEIATTLSVPGLNPQAGVRY 57

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G+ VGR+  +  D + P   L +  +  DTP+  ST AT+  QG+ G+ Y++L      
Sbjct: 58  RGLDVGRVDAVLFDPQKPGQILIRFSVSKDTPITHSTFATLSYQGVTGLAYVQLDDDETN 117

Query: 121 KKTIFQIA 128
              +    
Sbjct: 118 TTLMPSSP 125



 Score = 44.2 bits (101), Expect = 0.041,   Method: Composition-based stats.
 Identities = 25/181 (13%), Positives = 56/181 (30%), Gaps = 8/181 (4%)

Query: 265 HDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNMRSSISAIREITDQ 324
                   +  +   +I        +                   N   S +  + I   
Sbjct: 115 ETNTTLMPSSPKKIARIGLRPGLLDTLQIRGLAILEQTEQVAKRVNSILSDANQKLILGA 174

Query: 325 RQKIISTINTIENITSNLNDSSQKFAELMSKINNISALKENNSLFKDAQRAMHTFRDTSE 384
              + +  N +  I   L  +  K   L +K +N+        L  DA        + + 
Sbjct: 175 FTDVSNAANKVAKIPDQLQPTLDKMPALAAKADNVLVSLN--KLSDDATILTGNLNEFTV 232

Query: 385 KINR------YIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFERNPQDIVW 438
           ++N          S   N+ + +    ++I  L+ + + ++   +  L  F + PQ I++
Sbjct: 233 RLNAPDGPLNGFNSAVTNIGSTASMVEHEIVPLINETRTSMRALNRTLETFNQRPQSILF 292

Query: 439 G 439
           G
Sbjct: 293 G 293


>gi|302036235|ref|YP_003796557.1| putative ATP-dependent toluene efflux ABC transporter
           periplasmic-binding protein [Candidatus Nitrospira
           defluvii]
 gi|300604299|emb|CBK40631.1| ABC transporter, periplasmic binding component, putative
           ATP-dependent toluene efflux transporter [Candidatus
           Nitrospira defluvii]
          Length = 147

 Score =  105 bits (260), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 33/133 (24%), Positives = 52/133 (39%), Gaps = 5/133 (3%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME       VG+FV+  +    +    L +     G    V      S  GL   +SV  
Sbjct: 1   MERAKLELMVGVFVLVGIACLGYLSIKLGKLEVIGGHNYPVEAEFT-SASGLKPGASVEI 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G+ VGR+  + L  +    +L    I+    LY  T A+I+T+G+ G  Y+ LS     
Sbjct: 60  AGVEVGRVRHIGLSSD---RALVALAIQDGVKLYSDTIASIKTRGIIGDKYLALSVGGG- 115

Query: 121 KKTIFQIATERNQ 133
              +      R+ 
Sbjct: 116 GDPLKPGDKIRDT 128


>gi|171322153|ref|ZP_02911011.1| Mammalian cell entry related domain protein [Burkholderia ambifaria
           MEX-5]
 gi|171092529|gb|EDT37851.1| Mammalian cell entry related domain protein [Burkholderia ambifaria
           MEX-5]
          Length = 193

 Score =  105 bits (259), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 29/123 (23%), Positives = 47/123 (38%), Gaps = 3/123 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQY-DGPMAEVIIRIPGSVDGLSTDSSVR 59
           M+       VGLFVV       F    +   +     P   V ++   ++ GL   ++V+
Sbjct: 1   MKKTALDFWVGLFVVVGFLAVLFLALKVGNMSSLSFQPTYSVRMKF-DNIGGLKPRAAVK 59

Query: 60  FNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRK 119
             G+ VGR+  +  D      +L    +    P    ++A I T GL G  YI L     
Sbjct: 60  SAGVVVGRVKAIGFDSNTY-QALVTIDVDGQYPFPKDSSAKILTSGLLGEQYIGLDPGGD 118

Query: 120 EKK 122
            + 
Sbjct: 119 TEM 121


>gi|317011597|gb|ADU85344.1| ABC transport system substrate binding protein [Helicobacter pylori
           SouthAfrica7]
          Length = 271

 Score =  105 bits (259), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 30/201 (14%), Positives = 76/201 (37%), Gaps = 3/201 (1%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME    YT +G      L      I WL      DG   E ++     + G++T+S + +
Sbjct: 1   MERHVNYTLIGGLFFLCLVCMVGFILWLGHLGLDDGKYYEYVVYTDKDLGGIATNSPINY 60

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            GI VG ++ +   ++         +I+    +   +   + ++G  G+ ++ L     E
Sbjct: 61  KGIQVGNVIKVGFAKDKVGVVRLDLMIKSSVKIRKDSKVAVSSRGFMGLKFLALEQSHNE 120

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
           +   F  + ++ +R +I              +   + +       + + +   +     +
Sbjct: 121 E---FYGSGDKGERILIFKEGLMDRLSGDANQVMQEVMKAIKNVNRILDDQNVEKFKHIL 177

Query: 181 ANIETISTVLANNISHIDKMM 201
           A+++ +   L +  +  D ++
Sbjct: 178 ASVDDLIANLDSRKTQFDSLI 198


>gi|209524886|ref|ZP_03273432.1| Mammalian cell entry related domain protein [Arthrospira maxima
           CS-328]
 gi|209494765|gb|EDZ95074.1| Mammalian cell entry related domain protein [Arthrospira maxima
           CS-328]
          Length = 460

 Score =  105 bits (259), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 48/448 (10%), Positives = 145/448 (32%), Gaps = 37/448 (8%)

Query: 1   MESKN-YYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVR 59
           M S++    SVGL ++  +     + +WL   +       ++    P S  GL     VR
Sbjct: 1   MRSRSVREGSVGLLIILGVGLFGATAFWLRGIS-LGQQSYQIRAEFP-SATGLQIGVPVR 58

Query: 60  FNGIPVGRIVGLFLDQEYPNHSLAKALIRP-DTPLYPSTTATIRTQGLAGITYIELSTLR 118
           +  + VGR+  +               I   D  +  ++   +   G    TYI++    
Sbjct: 59  YRAVRVGRVTRIQPQSNG---VEVLLNIESTDLVMPRNSQVLVNQTGFLNETYIDIIPNI 115

Query: 119 KEKKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTT 178
                +                          + +     S          + + + +  
Sbjct: 116 VLTPELVAANPIAAD---------------CPSSDILCHESSVQGLPGISPDRLMETMLD 160

Query: 179 TIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQK 238
                         N +  +  +   + T  ++      +     + +    +       
Sbjct: 161 LGELYGNPELFANLNAAVENTALAAAEATQLTTKMGQLVDIAKLELGNFSASVDQNMNLF 220

Query: 239 VNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETS 298
            +++ +  +    +  + S   + + + + + T     + Q+++ L++   S + +    
Sbjct: 221 SSEMTQLSEQLERSMQEVSGAALQSANSLDQVTGDISALTQEVNALVATNRSTLLTT--- 277

Query: 299 AFLENIADSTSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINN 358
             L NI +++  +  +I+ +  +  + ++    +  +E +++N   +S+   ++   +NN
Sbjct: 278 --LNNINETSQELSVAIATLTPVIARFEQGEL-LTNLETLSANAVIASENLRDVSQSVNN 334

Query: 359 ISALKENNSLFKDAQRAMHTFRDTSEKINRYIPS--IGNNLQNFSQSGLNDIQNLVRKLQ 416
              +         A+  +   +  +  I        + ++L+     GL +I    ++L+
Sbjct: 335 PDNIILLQQTLDSARSTLQNMQKVTADIEDLTGDPRLRDSLRRIIN-GLGNILASTQELE 393

Query: 417 E------TVNHFDDCLNNFERNPQDIVW 438
                  T+       +  +     +++
Sbjct: 394 RQTAVAETLAPLSQAADAGDEKTMKLLF 421


>gi|91785390|ref|YP_560596.1| putative signal peptide protein, toluene tolerance Ttg2C-like
           [Burkholderia xenovorans LB400]
 gi|296159549|ref|ZP_06842373.1| Mammalian cell entry related domain protein [Burkholderia sp.
           Ch1-1]
 gi|91689344|gb|ABE32544.1| Putative signal peptide protein, toluene tolerance Ttg2C-like
           protein [Burkholderia xenovorans LB400]
 gi|295890257|gb|EFG70051.1| Mammalian cell entry related domain protein [Burkholderia sp.
           Ch1-1]
          Length = 181

 Score =  105 bits (259), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 26/122 (21%), Positives = 41/122 (33%), Gaps = 1/122 (0%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M+       VGLFVV       F        +         +     ++ GL   + V+ 
Sbjct: 1   MKKTALDFWVGLFVVLGFVALLFLALKAGNMSSLSFQATYPVKLKFDNIGGLKARAPVKS 60

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G+ VGR+  +  D      ++    +         T+A I T GL G  YI L      
Sbjct: 61  AGVTVGRVGEIGFDSNAY-QAVVTIDLDKQYQFPKDTSAKILTSGLLGEQYIGLEPGGDT 119

Query: 121 KK 122
           + 
Sbjct: 120 EM 121


>gi|114799224|ref|YP_761597.1| virulence factor Mce-like protein [Hyphomonas neptunium ATCC 15444]
 gi|114739398|gb|ABI77523.1| virulence factor Mce homolog [Hyphomonas neptunium ATCC 15444]
          Length = 317

 Score =  105 bits (259), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 29/131 (22%), Positives = 59/131 (45%), Gaps = 2/131 (1%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++  Y  +G  V+         + WL + ++++    +  I   G V  L    +VR+
Sbjct: 1   METRANYALIGGLVILAAALVAGFVLWLGQ-SEFNRDYKDYDIVFEGPVS-LEEGGAVRY 58

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            GI VG +  + +D+  P+   A+  +  +TP+   ++A+I+  G+ G T+I++S     
Sbjct: 59  IGIKVGEVATVRIDRADPSKVRARIRVSRETPIREDSSASIQLAGITGTTFIQISAGTGR 118

Query: 121 KKTIFQIATER 131
                      
Sbjct: 119 PLEARPGEPVP 129



 Score = 39.9 bits (90), Expect = 0.86,   Method: Composition-based stats.
 Identities = 21/189 (11%), Positives = 64/189 (33%), Gaps = 2/189 (1%)

Query: 253 FVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNMR 312
                 + +  +   R         G +     +     +    T   + +++ +  N+ 
Sbjct: 120 LEARPGEPVPVIPSERTLVDQIVAGGAQALGRANLTFDNVNKILTDENIASVSATLKNLE 179

Query: 313 SSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAEL--MSKINNISALKENNSLFK 370
            + + +        +  +T++ +    +    +S +F E    +  +   A  +   +  
Sbjct: 180 IATAKLAADDGLLDQASTTLDEVSRAAAAFEQASVEFQEFGNSADASLADAAADLKIVVA 239

Query: 371 DAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFE 430
           D +    +   T ++    + +    ++  +     +     ++L+  +N FD  L   E
Sbjct: 240 DIRSVAQSASGTLDRSAEAVAAATAIIEGPATETFQNAGLASKELRIMLNRFDRFLRELE 299

Query: 431 RNPQDIVWG 439
            NPQ ++ G
Sbjct: 300 SNPQSLLVG 308


>gi|170703433|ref|ZP_02894206.1| Mammalian cell entry related domain protein [Burkholderia ambifaria
           IOP40-10]
 gi|170131664|gb|EDT00219.1| Mammalian cell entry related domain protein [Burkholderia ambifaria
           IOP40-10]
          Length = 196

 Score =  105 bits (259), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 29/123 (23%), Positives = 47/123 (38%), Gaps = 3/123 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQY-DGPMAEVIIRIPGSVDGLSTDSSVR 59
           M+       VGLFVV       F    +   +     P   V ++   ++ GL   ++V+
Sbjct: 1   MKKTALDFWVGLFVVVGFLAVLFLALKVGNMSSLSFQPTYSVRMKF-DNIGGLKPRAAVK 59

Query: 60  FNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRK 119
             G+ VGR+  +  D      +L    +    P    ++A I T GL G  YI L     
Sbjct: 60  SAGVVVGRVKAIGFDSNTY-QALVTIDVDGQYPFPKDSSAKILTSGLLGEQYIGLDPGGD 118

Query: 120 EKK 122
            + 
Sbjct: 119 TEM 121


>gi|115350389|ref|YP_772228.1| hypothetical protein Bamb_0334 [Burkholderia ambifaria AMMD]
 gi|115280377|gb|ABI85894.1| Mammalian cell entry related domain protein [Burkholderia ambifaria
           AMMD]
          Length = 187

 Score =  105 bits (259), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 29/123 (23%), Positives = 47/123 (38%), Gaps = 3/123 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQY-DGPMAEVIIRIPGSVDGLSTDSSVR 59
           M+       VGLFVV       F    +   +     P   V ++   ++ GL   ++V+
Sbjct: 1   MKKTALDFWVGLFVVVGFLAVLFLALKVGNMSSLSFQPTYSVRMKF-DNIGGLKPRAAVK 59

Query: 60  FNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRK 119
             G+ VGR+  +  D      +L    +    P    ++A I T GL G  YI L     
Sbjct: 60  SAGVVVGRVKAIGFDSNTY-QALVTIDVDGQYPFPKDSSAKILTSGLLGEQYIGLDPGGD 118

Query: 120 EKK 122
            + 
Sbjct: 119 TEM 121


>gi|34495902|ref|NP_900117.1| ABC transporter substrate-binding protein [Chromobacterium
           violaceum ATCC 12472]
 gi|34101757|gb|AAQ58125.1| probable ABC transport system substrate-binding protein
           [Chromobacterium violaceum ATCC 12472]
          Length = 155

 Score =  105 bits (259), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 29/129 (22%), Positives = 45/129 (34%), Gaps = 1/129 (0%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M+       VG+FV   +    F    ++           V+     +V GL   + V+ 
Sbjct: 1   MKRSTIDLWVGIFVALGIAAVVFLSLKVANLTPQSASQTYVVYADFDNVGGLKVKAPVKE 60

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G+ VGR+  + LD +    +     I     L    +A+I T GL G  YI L     E
Sbjct: 61  AGVLVGRVSDIRLDPKTYR-ARVALNIDKQYQLSDDVSASILTSGLLGEQYIGLQQGGSE 119

Query: 121 KKTIFQIAT 129
                    
Sbjct: 120 NNLAPGGTI 128


>gi|167579646|ref|ZP_02372520.1| ABC transporter, periplasmic substrate-binding protein
           [Burkholderia thailandensis TXDOH]
          Length = 309

 Score =  105 bits (259), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 41/282 (14%), Positives = 102/282 (36%), Gaps = 5/282 (1%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K++    GLF +++L     ++YW +             +    +V GL  D++VR+
Sbjct: 1   MENKSHAFWAGLFTIALLAAIVGAVYWFNVDRTV---RVPYDLVSRSNVTGLFPDAAVRY 57

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G+ VG++  +  D+ +P   + + L+    P+  ST  ++  QG+ GI +++L     +
Sbjct: 58  RGLDVGKVQSIDFDRGHPGQIVIRILVDTHAPITRSTFGSLGFQGVTGIAFVQLDDTGAD 117

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHI--QKIIENIEKPLTT 178
              +   A    Q  M  +    +           +  + S   +    + + ++    +
Sbjct: 118 LAPLPTSAKAVAQIPMRPSLFDQLQQRGDVLLKQMEIAAKSVNEMLSPDMRDQLKATAAS 177

Query: 179 TIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQK 238
                + ++ +       + +M  T +   H+  + N        + +            
Sbjct: 178 MQHAADGVTQLSRQVEPALAQMPQTMEHVNHALSAANALVAPGGPLVTNLNRAGQALASM 237

Query: 239 VNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQK 280
            + + E       + +   + +   V D   T +       +
Sbjct: 238 NDTLAELSARVRYDTLPRFNALATNVGDASRTLKDVAGDVGR 279



 Score = 44.2 bits (101), Expect = 0.045,   Method: Composition-based stats.
 Identities = 22/173 (12%), Positives = 50/173 (28%), Gaps = 11/173 (6%)

Query: 268 RETTQTFQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNMRSSISAIREITDQRQK 327
            +            D L       +K  E +A   N   S        +    +      
Sbjct: 125 AKAVAQIPMRPSLFDQLQQRGDVLLKQMEIAAKSVNEMLSPDMRDQLKATAASMQHAADG 184

Query: 328 IISTINTIENITSNLNDSSQKFAELMSKINNISALKE-NNSLFKDAQRAMHTFRDTSEKI 386
           +      +E   + +  + +     +S  N + A      +    A +A+ +  DT  ++
Sbjct: 185 VTQLSRQVEPALAQMPQTMEHVNHALSAANALVAPGGPLVTNLNRAGQALASMNDTLAEL 244

Query: 387 NRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFERNPQDIVWG 439
           +  +              L     L   + +      D   +  RNP+ +++G
Sbjct: 245 SARVR----------YDTLPRFNALATNVGDASRTLKDVAGDVGRNPRSLLFG 287


>gi|317013232|gb|ADU83840.1| ABC transport system substrate binding protein [Helicobacter pylori
           Lithuania75]
          Length = 271

 Score =  104 bits (258), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 30/201 (14%), Positives = 76/201 (37%), Gaps = 3/201 (1%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME    YT +G      L      I WL      DG   E ++     + G++T+S + +
Sbjct: 1   MERHVNYTLIGGLFFLCLVCMVGFILWLGHLGLDDGKYYEYVVYTDKDLGGIATNSPINY 60

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            GI VG ++ +   ++         +I+    +   +   + ++G  G+ ++ L     E
Sbjct: 61  KGIQVGNVIKVGFAKDKVGVVRLDLMIKSSVKIRKDSKVAVSSRGFMGLKFLALEQSHNE 120

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
           +   F  + ++ +R +I          +   +   + +       + + +   +     +
Sbjct: 121 E---FYGSGDKGERILIFKEGLMDRLSVDANQAMQEVMKAIKNVNKILDDENVEKFKHIL 177

Query: 181 ANIETISTVLANNISHIDKMM 201
           A++  +   L +  +  D ++
Sbjct: 178 ASVNDLIANLDSRKTQFDSLI 198


>gi|152981713|ref|YP_001354987.1| ABC-type transport system involved in resistance to organic
           solvents, periplasmic component [Janthinobacterium sp.
           Marseille]
 gi|151281790|gb|ABR90200.1| ABC-type transport system involved in resistance to organic
           solvents, periplasmic component [Janthinobacterium sp.
           Marseille]
          Length = 157

 Score =  104 bits (258), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 26/117 (22%), Positives = 44/117 (37%), Gaps = 1/117 (0%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M+ K+    VGLFV+      FF        +         ++    ++ GL   + V+ 
Sbjct: 1   MQRKSLDLWVGLFVLLGAAALFFLAMKAGNMSSLSFEQVYPVVTRFDNIGGLKPRAPVKS 60

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTL 117
            G+ VGR+  +  D +    +     I         ++A I T GL G  Y+ L   
Sbjct: 61  AGVVVGRVADISFD-DKSYQATVTLNIESRYVFPKDSSAKILTSGLLGEQYVGLEPG 116


>gi|308272143|emb|CBX28750.1| hypothetical protein N47_L13480 [uncultured Desulfobacterium sp.]
          Length = 147

 Score =  104 bits (258), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 34/117 (29%), Positives = 52/117 (44%), Gaps = 3/117 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M+ ++  TSVG+F +  L    +    L +          V  +   SV GL   S V  
Sbjct: 1   MKKQSIETSVGIFFLIGLICVGYLTIKLGKMELLGDNTYTVKAKFK-SVSGLKQGSQVEM 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTL 117
            G+ +G I  ++LD++    +L K  I  D  L     A+I+T GL G  YI +S  
Sbjct: 60  AGVKIGTIDNVYLDKDD--RALVKLKINKDIILTDDVIASIKTSGLIGDKYISISPG 114


>gi|218439978|ref|YP_002378307.1| hypothetical protein PCC7424_3037 [Cyanothece sp. PCC 7424]
 gi|218172706|gb|ACK71439.1| Mammalian cell entry related domain protein [Cyanothece sp. PCC
           7424]
          Length = 479

 Score =  104 bits (258), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 53/423 (12%), Positives = 141/423 (33%), Gaps = 18/423 (4%)

Query: 10  VGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRFNGIPVGRIV 69
           VGLF +  L        WL     +     ++I+    +V GL   + V++ G+ VGR+ 
Sbjct: 12  VGLFALLGLVIFGGITIWLRG-GNWGQQSYQIIVEF-DNVAGLQLGAPVQYRGVQVGRLA 69

Query: 70  GLFLDQEYPNHSLAKALIRP-DTPLYPSTTATIRTQGLAGITYIELSTLR---KEKKTIF 125
            L   +       A   I   D  +    T      GL G   I+++       + K++ 
Sbjct: 70  ALKPREN---KVEALLEISSTDLVIPRDVTIQTSRYGLIGEPAIDITPKTLLSPQAKSLS 126

Query: 126 QIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTIANIET 185
            +  E     ++                T  +++ +  + +            ++   + 
Sbjct: 127 PLGEECKPDLILCDNTRIQGDSGGQLVETLTRLAQTYSNPEFFNNLNNAAKNASLTLKDV 186

Query: 186 ISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVNQILEN 245
                  +            V+ +   +        +  +       A+ L+    I E 
Sbjct: 187 SKLSKDFSTLSKSAQREIALVSRNFEQTTTAATQTANDASLFINNANAVVLENRRDINEA 246

Query: 246 IQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQK-------IDHLLSDFSSKMKSKETS 298
           IQ ++     +S  +      +    ++  ++  +       ++      +S M + +T 
Sbjct: 247 IQQTTLLMNNASQLIAENRQRISGAIESIDQMSDRLTLLATNLNQTALKINSTMDAADTE 306

Query: 299 AFLENIADSTSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINN 358
             ++N+    +N  +    +RE+++      + I T++    +   + +   ++ S ++ 
Sbjct: 307 KMVQNLEVVLTNAAAVSQELREVSETLNDP-TIILTLQQTLDSARVTFENTQKITSDVDE 365

Query: 359 ISALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQET 418
           +    E  S  +     +     +S+ + + + ++   L   ++     I+ L + +   
Sbjct: 366 LVGDPEFRSNLRRLVNGLSNLVSSSQALEQQMIAVQ-KLDEQAKIIAQQIEPLTQDIYCA 424

Query: 419 VNH 421
           V  
Sbjct: 425 VEE 427


>gi|167835252|ref|ZP_02462135.1| ABC transporter, periplasmic substrate-binding protein
           [Burkholderia thailandensis MSMB43]
          Length = 309

 Score =  104 bits (258), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 43/282 (15%), Positives = 102/282 (36%), Gaps = 5/282 (1%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K++    GLF +++L     ++YW +       P     +    +V GL  D++VR+
Sbjct: 1   MENKSHAFWAGLFTIALLAAIVGAVYWFNVDRTVRAP---YDLVSRSNVTGLFPDAAVRY 57

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G+ VG++  +  D+ +P   + + L+  + P+  ST  ++  QG+ GI +++L     +
Sbjct: 58  RGLDVGKVQSINFDRGHPGQIVIRILVDTNAPITRSTFGSLGFQGVTGIAFVQLDDTGAD 117

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHI--QKIIENIEKPLTT 178
              +   A    Q  M  +    +           +  + S   +   ++   ++    +
Sbjct: 118 LAPLPTSAKAVAQIPMRPSLFDQLQQRGDVLLKQMEIAAKSVNEMLSPEMRGQLKATAAS 177

Query: 179 TIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQK 238
                + I+ +       + +M  T      +  S N        + +            
Sbjct: 178 MQHAADGITQLSKQVEPALAQMPQTMAHVNRALGSANALVAPGGPLVANLNRAGQALASM 237

Query: 239 VNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQK 280
            + + E       + +   + +   V D   T +       +
Sbjct: 238 NDTLAELSARVRYDTLPRFNALATNVGDTSRTLKDVAGDVGR 279



 Score = 45.3 bits (104), Expect = 0.018,   Method: Composition-based stats.
 Identities = 23/173 (13%), Positives = 49/173 (28%), Gaps = 11/173 (6%)

Query: 268 RETTQTFQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNMRSSISAIREITDQRQK 327
            +            D L       +K  E +A   N   S        +    +      
Sbjct: 125 AKAVAQIPMRPSLFDQLQQRGDVLLKQMEIAAKSVNEMLSPEMRGQLKATAASMQHAADG 184

Query: 328 IISTINTIENITSNLNDSSQKFAELMSKINNISALKE-NNSLFKDAQRAMHTFRDTSEKI 386
           I      +E   + +  +       +   N + A      +    A +A+ +  DT  ++
Sbjct: 185 ITQLSKQVEPALAQMPQTMAHVNRALGSANALVAPGGPLVANLNRAGQALASMNDTLAEL 244

Query: 387 NRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFERNPQDIVWG 439
           +  +              L     L   + +T     D   +  RNP+ +++G
Sbjct: 245 SARVR----------YDTLPRFNALATNVGDTSRTLKDVAGDVGRNPRSLLFG 287


>gi|222823163|ref|YP_002574736.1| ABC transporter, periplasmic substrate-binding protein
           [Campylobacter lari RM2100]
 gi|222538384|gb|ACM63485.1| putative ABC transporter, periplasmic substrate-binding protein
           [Campylobacter lari RM2100]
          Length = 275

 Score =  104 bits (258), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 31/125 (24%), Positives = 55/125 (44%), Gaps = 2/125 (1%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++  Y  +G+FV  + F S F I W       +       I +  SV GLS  + V+F
Sbjct: 1   MENRANYILIGIFVSILFFISLFFIVWYGNLKD-EKTFKYYEIFMEESVAGLSVKAPVKF 59

Query: 61  NGIPVGRIVGLFLDQEYPN-HSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRK 119
            G+ VG +  + +D             +  +  +   T A+++ QG+ G  +I+L+    
Sbjct: 60  LGVDVGSVENISIDSSSNQLRVKILVKLDSNLVVKTDTYASLQIQGITGFKFIQLAGGSD 119

Query: 120 EKKTI 124
           E   +
Sbjct: 120 EASVL 124


>gi|242278701|ref|YP_002990830.1| mammalian cell entry related domain protein [Desulfovibrio
           salexigens DSM 2638]
 gi|242121595|gb|ACS79291.1| Mammalian cell entry related domain protein [Desulfovibrio
           salexigens DSM 2638]
          Length = 385

 Score =  104 bits (257), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 38/449 (8%), Positives = 133/449 (29%), Gaps = 73/449 (16%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M  K     +GLF++      F S+  +  + +      ++   +  SV+GL   S ++F
Sbjct: 1   MSRKTNPFRLGLFIIIGTI-LFVSVLAILGAGKIFEQSVKMETYLNESVNGLEVGSPIKF 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G+ +G +  +    ++               L  S    +   G       +    ++ 
Sbjct: 60  RGVKIGTVSQIGFVTDHY------------VDLKQSALRYVYLLGDLNHKMFKTKEGQEL 107

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
              +                                         +       +P++  +
Sbjct: 108 VHAL---------------------------------------KKEVDRGLRARPVSLGL 128

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
                +     + + +    +       +   + +  + +   + S+   ++ I+   + 
Sbjct: 129 TGQLFLEIDYVDPVKNPPLEIAWKPKHIYVPSAPSMMSKVESAVASISDTLEDINKANIA 188

Query: 241 QILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAF 300
           + +E+++  + +             D  E ++       + +  ++  +  +   E    
Sbjct: 189 EAIEDVRSVAQSMSTFLKN-----SDTGEISKRLTGTLTEAEKFIARVNQLLADPEVDNL 243

Query: 301 LENIADSTSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNIS 360
           + ++A +  N+R+ + +                 I     ++  +S+    +   +    
Sbjct: 244 MPDVAAAARNLRTVMESSS-------------GDIVAAMKDIRKASESAKNVTGGMEEYL 290

Query: 361 ALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLND---IQNLVRKLQE 417
           +  +      D    ++   + S +I        + L   + +       I+ ++  ++ 
Sbjct: 291 SGPKGKQTLADLSNTLNNISEASNRIKGAAARFESTLSRVNMTVAGQQGNIEAILDNVRR 350

Query: 418 TVNHFDDCLNNFERNPQDIVWGREKGSVK 446
            + +  +  N   + P  +++G       
Sbjct: 351 LMENLRELSNEARQYPSGVLFGDPPKKAP 379


>gi|15646073|ref|NP_208255.1| hypothetical protein HP1464 [Helicobacter pylori 26695]
 gi|254779976|ref|YP_003058083.1| ABC-type transport system, periplasmic component [Helicobacter
           pylori B38]
 gi|2314641|gb|AAD08505.1| conserved hypothetical secreted protein [Helicobacter pylori 26695]
 gi|254001889|emb|CAX30139.1| ABC-type transport system, periplasmic component [Helicobacter
           pylori B38]
          Length = 271

 Score =  104 bits (257), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 22/111 (19%), Positives = 45/111 (40%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME    YT +G      L      I WL      DG   E ++     + G++T+S + +
Sbjct: 1   MERHVNYTLIGGLFFLCLVCMVGFILWLGHLGLDDGKYYEYVVYTDKDLGGIATNSPINY 60

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITY 111
            GI VG ++ +   ++         +I+    +   +   + ++G  G+ +
Sbjct: 61  KGIQVGNVIKVGFAKDKVGVVRLDLMIKSSVKIRKDSKVAVSSRGFMGLKF 111


>gi|296284590|ref|ZP_06862588.1| ABC-type transport system periplasmic component [Citromicrobium
           bathyomarinum JL354]
          Length = 317

 Score =  104 bits (257), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 47/316 (14%), Positives = 116/316 (36%), Gaps = 10/316 (3%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++  +  VG   + +L      I W++   + D    E  I    SV GL+  SSV F
Sbjct: 1   METRANHVWVGAVTLLLLAALALFIVWIAGLGENDRK--EYDIFFKQSVAGLANGSSVSF 58

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G+PVG++  + L +  P     +  ++P+ P+   TTAT+++      T +     +  
Sbjct: 59  AGVPVGQVRDISLWETDPEFVRVRIAVKPEVPVLVGTTATVQSSFTGVSTILLDGARKGR 118

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRH-IQKIIENIEKPLTTT 179
                +         +I     G    ++NA    +++S  +      + ++ ++ L+  
Sbjct: 119 PPITCETTACPEGAPVIPPKAGGFGEILANAPLLLERLSTLTERLTMLLSDDNQRELSGI 178

Query: 180 IANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKV 239
           + N   ++  +A+    +   +           +    +   D           +   + 
Sbjct: 179 LRNTNRVTADVADATPQLKGAL------AEMQITLREASEALDSFERTTNSANELLNNEG 232

Query: 240 NQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQE-VGQKIDHLLSDFSSKMKSKETS 298
             + + ++ +     +++D +  T+   +   ++  E      +  L D  +  +S  + 
Sbjct: 233 ESLAKELRGTLQKANQAADTLNQTLEQAQPAVRSLNEKTLPSANATLEDLQATSRSLRSL 292

Query: 299 AFLENIADSTSNMRSS 314
                   ++  + S 
Sbjct: 293 TQRIEDKGASDLINSP 308


>gi|210135631|ref|YP_002302070.1| ABC transporter substrate binding protein [Helicobacter pylori P12]
 gi|210133599|gb|ACJ08590.1| ABC transporter substrate binding protein [Helicobacter pylori P12]
          Length = 271

 Score =  104 bits (257), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 22/111 (19%), Positives = 45/111 (40%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME    YT +G      L      I WL      DG   E ++     + G++T+S + +
Sbjct: 1   MERHVNYTLIGGLFFLCLVCMVGFILWLGHLGLDDGKYYEYVVYTDKDLGGIATNSPINY 60

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITY 111
            GI VG ++ +   ++         +I+    +   +   + ++G  G+ +
Sbjct: 61  KGIQVGNVIKVGFAKDKVGVVRLDLMIKSSVKIRKDSKVAVSSRGFMGLKF 111


>gi|221199882|ref|ZP_03572925.1| ABC transporter, periplasmic ligand binding protein [Burkholderia
           multivorans CGD2M]
 gi|221207450|ref|ZP_03580459.1| ABC transporter, periplasmic ligand binding protein [Burkholderia
           multivorans CGD2]
 gi|221172653|gb|EEE05091.1| ABC transporter, periplasmic ligand binding protein [Burkholderia
           multivorans CGD2]
 gi|221180121|gb|EEE12525.1| ABC transporter, periplasmic ligand binding protein [Burkholderia
           multivorans CGD2M]
          Length = 309

 Score =  104 bits (257), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 41/289 (14%), Positives = 109/289 (37%), Gaps = 11/289 (3%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K++    GLF + +      +++W +             +    +V GL  D++VRF
Sbjct: 1   MENKSHAFWAGLFTILLTLAIVGAVFWFNVDRTV---RVPYDLIARTNVTGLFPDAAVRF 57

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G+ VG++  +  D+ +P     + L+  D P+  ST  ++  QG+ GI +++L      
Sbjct: 58  RGLDVGKVQSIGFDRSHPGQIRIRILVDHDAPITQSTYGSLGFQGVTGIAFVQL---EDT 114

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
            + +  + +     A I   PS  +   S  +   +++  +++ + +++      +   +
Sbjct: 115 GRDLSPLPSSPKAIAQIPMRPSLFDQLQSRGDVLLRQLELAAKSVNELM---SPEMREQL 171

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
                     A+ ++ + K +         + ++      +             +L K  
Sbjct: 172 RATAESLQHAADGVTTLSKQLGPAVTALPETMTEVNRTMASANRLLQPNGPLVANLNKAG 231

Query: 241 QILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFS 289
              E +  + N+         +T+        +  +  +++  +  +  
Sbjct: 232 TAAEQVGTALNDLNARVQ--YDTLPRFNALAGSVGDASRQLKDVAGELG 278



 Score = 40.3 bits (91), Expect = 0.61,   Method: Composition-based stats.
 Identities = 26/264 (9%), Positives = 64/264 (24%), Gaps = 24/264 (9%)

Query: 196 HIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVNQILENIQVSSNNFVK 255
               +  T +V        N      D       +                Q+     V 
Sbjct: 26  FWFNVDRTVRVPYDLIARTNVTGLFPDAAVRFRGLDVGKVQSIGFDRSHPGQIRIRILVD 85

Query: 256 SSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNMRSSI 315
               +  + +              +++    D S    S +  A +         ++S  
Sbjct: 86  HDAPITQSTYGSLGFQGVTGIAFVQLEDTGRDLSPLPSSPKAIAQIPMRPSLFDQLQSRG 145

Query: 316 SAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNISALKENNSLFKDAQRA 375
             +    +   K ++ + +   +   L  +++        +  +S   +           
Sbjct: 146 DVLLRQLELAAKSVNELMSP-EMREQLRATAESLQHAADGVTTLSK--QLGPAVTALPET 202

Query: 376 MHTFRDTSEKINRYIPSIGNNLQNFSQSG--LNDIQNLVRKLQ----------------- 416
           M     T    NR +   G  + N +++G     +   +  L                  
Sbjct: 203 MTEVNRTMASANRLLQPNGPLVANLNKAGTAAEQVGTALNDLNARVQYDTLPRFNALAGS 262

Query: 417 --ETVNHFDDCLNNFERNPQDIVW 438
             +      D      RNP  +++
Sbjct: 263 VGDASRQLKDVAGELGRNPSSLLF 286


>gi|254251298|ref|ZP_04944616.1| ABC-type transport system periplasmic component [Burkholderia
           dolosa AUO158]
 gi|124893907|gb|EAY67787.1| ABC-type transport system periplasmic component [Burkholderia
           dolosa AUO158]
          Length = 309

 Score =  104 bits (257), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 42/282 (14%), Positives = 100/282 (35%), Gaps = 5/282 (1%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K++    GLF +++      +++W +             +    +V GL  D++VRF
Sbjct: 1   MENKSHAFWAGLFTIALTLAIAGAVFWFNVDRTV---RVPYDLIARTNVTGLFPDAAVRF 57

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G+ VG++  +  D+ +P     + L+  D P+  ST  ++  QG+ GI +++L    ++
Sbjct: 58  RGLDVGKVQSIGFDRSHPGQIRIRILVDQDAPITQSTYGSLGFQGVTGIAFVQLEDTGRD 117

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRH--IQKIIENIEKPLTT 178
              +     +  Q  M  +    I           ++ +         ++ E +     +
Sbjct: 118 LSPLPSSPKKIAQIPMRPSLFDQIQQRGGVLLRQLEQAAKGVNQLLSPEMREQLRATTES 177

Query: 179 TIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQK 238
                + ++T+       + ++  T      +  S NT       + S          Q 
Sbjct: 178 LQHAADGVTTLSKQLGPAVAELPQTMHEVNRAMASANTLLQPNGPLVSNLNKAGTAAEQV 237

Query: 239 VNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQK 280
              + +       + +   + +   V D     +       +
Sbjct: 238 GVALNDLNARVQYDTLPRFNALAGNVGDASRQLKDVAGELGR 279



 Score = 39.5 bits (89), Expect = 0.98,   Method: Composition-based stats.
 Identities = 26/264 (9%), Positives = 65/264 (24%), Gaps = 24/264 (9%)

Query: 196 HIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVNQILENIQVSSNNFVK 255
               +  T +V        N      D       +                Q+     V 
Sbjct: 26  FWFNVDRTVRVPYDLIARTNVTGLFPDAAVRFRGLDVGKVQSIGFDRSHPGQIRIRILVD 85

Query: 256 SSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNMRSSI 315
               +  + +              +++    D S    S +  A +         ++   
Sbjct: 86  QDAPITQSTYGSLGFQGVTGIAFVQLEDTGRDLSPLPSSPKKIAQIPMRPSLFDQIQQRG 145

Query: 316 SAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNISALKENNSLFKDAQRA 375
             +    +Q  K ++ + +   +   L  +++        +  +S   +      +  + 
Sbjct: 146 GVLLRQLEQAAKGVNQLLSP-EMREQLRATTESLQHAADGVTTLSK--QLGPAVAELPQT 202

Query: 376 MHTFRDTSEKINRYIPSIGNNLQNFSQSG---------------------LNDIQNLVRK 414
           MH         N  +   G  + N +++G                     L     L   
Sbjct: 203 MHEVNRAMASANTLLQPNGPLVSNLNKAGTAAEQVGVALNDLNARVQYDTLPRFNALAGN 262

Query: 415 LQETVNHFDDCLNNFERNPQDIVW 438
           + +      D      RNP  +++
Sbjct: 263 VGDASRQLKDVAGELGRNPSSLLF 286


>gi|311103420|ref|YP_003976273.1| Mce related family protein 1 [Achromobacter xylosoxidans A8]
 gi|310758109|gb|ADP13558.1| Mce related family protein 1 [Achromobacter xylosoxidans A8]
          Length = 165

 Score =  104 bits (257), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 29/128 (22%), Positives = 49/128 (38%), Gaps = 3/128 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQY-DGPMAEVIIRIPGSVDGLSTDSSVR 59
           M  +     VGLFV+       F        + +   P   +      +V GL   + V+
Sbjct: 1   MSREKTDFWVGLFVLLGAVALAFLALRAGNLSTFSFAPTYTLTANF-DNVGGLKVRAPVK 59

Query: 60  FNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRK 119
             G+ VGR+ G+  D +    ++    +         T+A+I T GL G  Y+ LS   +
Sbjct: 60  SAGVVVGRVAGISFD-DKTFQAVVSVNLETAYQFPKDTSASILTSGLLGEQYLGLSAGSE 118

Query: 120 EKKTIFQI 127
           E+      
Sbjct: 119 EENFADGG 126


>gi|329905879|ref|ZP_08274262.1| ABC-type transport system [Oxalobacteraceae bacterium IMCC9480]
 gi|327547450|gb|EGF32271.1| ABC-type transport system [Oxalobacteraceae bacterium IMCC9480]
          Length = 311

 Score =  103 bits (256), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 33/124 (26%), Positives = 57/124 (45%), Gaps = 3/124 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K++    G+F +++L        W +R            +    SV GL+  + VR+
Sbjct: 1   MENKSHALMAGIFTLALLVAGILLAMWFNRDRI---ERVPYEMATKLSVPGLNPQADVRY 57

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G+ VG++  +  D   P   L    +RPDTP+  ST   +  QG+ GI Y++L     +
Sbjct: 58  RGLDVGKVDEIIFDPNVPGQILVHISVRPDTPMTQSTYGVLGYQGVTGIAYVQLDDDGSK 117

Query: 121 KKTI 124
              +
Sbjct: 118 PVKL 121



 Score = 41.1 bits (93), Expect = 0.39,   Method: Composition-based stats.
 Identities = 22/174 (12%), Positives = 54/174 (31%), Gaps = 8/174 (4%)

Query: 271 TQTFQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNMRSSISAIREITDQRQKIIS 330
             + ++   +I+   S F +                   N   +      +      I  
Sbjct: 121 LTSSKQSLARIEMRPSLFDNLQTRGLVILQQTEALTLRLNRLLTPDNQAVMLGAFSDISK 180

Query: 331 TINTIENITSNLNDSSQKFAELMSKINNISALKENNSLFKDAQRAMHTFRDTSEKINR-- 388
               +E+I + L  +  +   L ++ +   A      L  D  + ++ F   + ++    
Sbjct: 181 AAIALESIPARLEPTLSRLPALTTQASGTLAS--IQRLSDDTGKLVNNFSGMATRLQAPD 238

Query: 389 ----YIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFERNPQDIVW 438
                +    + L + +      I  L  +   T++  +  L  F   PQ I++
Sbjct: 239 GTLDRLALTVDQLGSVAGRIELKILPLGDEASSTLHAVNRTLETFNNRPQSILF 292


>gi|308062728|gb|ADO04616.1| ABC transport system substrate binding protein [Helicobacter pylori
           Cuz20]
          Length = 271

 Score =  103 bits (256), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 28/201 (13%), Positives = 75/201 (37%), Gaps = 3/201 (1%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME    YT +G      L      I WL      DG   E ++     + G++T+S + +
Sbjct: 1   MERHVNYTLIGGLFFLCLVCMVGFILWLGHLGLEDGKYYEYVVYTDKDLGGIATNSPINY 60

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            GI VG ++ +   ++         +I+    +   +   + ++G  G+ ++ L     E
Sbjct: 61  KGIQVGNVIKVGFAKDKVGVVRLDLMIKSSVKIRKDSKVAVSSRGFMGLKFLALEQSHNE 120

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
           +   F  + ++ +R ++          +   +   + +       + + +   +     +
Sbjct: 121 E---FYGSGDKGERILLFKEGFMDRLSVDANQVMQEVMKAIKNVNKILDDENVEKFKHIL 177

Query: 181 ANIETISTVLANNISHIDKMM 201
            +++ +   L +     D ++
Sbjct: 178 VSVDDLIANLDSRKVQFDSLI 198


>gi|15612422|ref|NP_224075.1| hypothetical protein jhp1357 [Helicobacter pylori J99]
 gi|308183563|ref|YP_003927690.1| ABC transport system substrate binding protein [Helicobacter pylori
           PeCan4]
 gi|308185232|ref|YP_003929365.1| ABC transport system substrate binding protein [Helicobacter pylori
           SJM180]
 gi|4155969|gb|AAD06933.1| putative [Helicobacter pylori J99]
 gi|307638117|gb|ADN80567.1| ABC transporter periplasmic substrate-binding protein [Helicobacter
           pylori 908]
 gi|308061152|gb|ADO03048.1| ABC transport system substrate binding protein [Helicobacter pylori
           SJM180]
 gi|308065748|gb|ADO07640.1| ABC transport system substrate binding protein [Helicobacter pylori
           PeCan4]
 gi|317014878|gb|ADU82314.1| ABC transport system substrate binding protein [Helicobacter pylori
           Gambia94/24]
 gi|325996717|gb|ADZ52122.1| ABC transport system substrate binding protein [Helicobacter pylori
           2018]
          Length = 271

 Score =  103 bits (256), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 22/111 (19%), Positives = 45/111 (40%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME    YT +G      L      I WL      DG   E ++     + G++T+S + +
Sbjct: 1   MERHVNYTLIGGLFFLCLVCMVGFILWLGHLGLDDGKYYEYVVYTDKDLGGIATNSPINY 60

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITY 111
            GI VG ++ +   ++         +I+    +   +   + ++G  G+ +
Sbjct: 61  KGIQVGNVIKVGFAKDKVGVVRLDLMIKSSVKIRKDSKVAVSSRGFMGLKF 111


>gi|297380680|gb|ADI35567.1| ABC transport system substrate binding protein [Helicobacter pylori
           v225d]
          Length = 271

 Score =  103 bits (256), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 29/201 (14%), Positives = 75/201 (37%), Gaps = 3/201 (1%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME    YT +G      L      I WL      DG   E ++     + G++T+S + +
Sbjct: 1   MERHVNYTLIGGLFFLCLVCMVGFILWLGHLGLEDGKYYEYVVYTDKDLGGIATNSPINY 60

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            GI VG ++ +   ++         +I+    +   +   + ++G  G+ ++ L     E
Sbjct: 61  KGIQVGNVIKVGFAKDKVGVVRLDLMIKSSVKIRKDSKVAVSSRGFMGLKFLALEQSHNE 120

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
           +   F  + ++ +R +I          +   +   + +       + + +   +     +
Sbjct: 121 E---FYGSGDKGERILIFKEGFMDRLSVDANQVMQEVMKAIKNVNKILDDENVEKFKHIL 177

Query: 181 ANIETISTVLANNISHIDKMM 201
            +++ +   L +     D ++
Sbjct: 178 VSVDDLIANLDSRKVQFDSLI 198


>gi|74317916|ref|YP_315656.1| putative ABC transporter substrate-binding protein [Thiobacillus
           denitrificans ATCC 25259]
 gi|74057411|gb|AAZ97851.1| putative ABC transporter substrate-binding protein [Thiobacillus
           denitrificans ATCC 25259]
          Length = 155

 Score =  103 bits (256), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 26/117 (22%), Positives = 43/117 (36%), Gaps = 1/117 (0%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M        VGLFV++ +    F    +   +         ++    +V GL   + V+ 
Sbjct: 1   MNKTVLDLWVGLFVIAGIVALLFLALKVGSMSAVSASDTYEVVARFDNVGGLKPRAPVKS 60

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTL 117
            G+ VGR+  +  D E    +     +         ++A I T GL G  YI L   
Sbjct: 61  AGVVVGRVGEIRFDNESYEAA-VTLRLDKRYAFPKDSSAAIMTSGLLGEQYIGLEAG 116


>gi|94498320|ref|ZP_01304879.1| ABC transporter, periplasmic substrate-binding protein, putative
           [Sphingomonas sp. SKA58]
 gi|94422200|gb|EAT07242.1| ABC transporter, periplasmic substrate-binding protein, putative
           [Sphingomonas sp. SKA58]
          Length = 309

 Score =  103 bits (256), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 54/301 (17%), Positives = 109/301 (36%), Gaps = 11/301 (3%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME    Y  VG   +++L  +   + WL  S           I   G V GLS    V+F
Sbjct: 1   MERHANYALVGAASIALLIATLVFVVWLGGSA---KGSDSYQIVFHGPVRGLSVGGEVQF 57

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NGI VG I G+ LDQ  PN  +    +   TP+   + A+  +QG++G++ +++S     
Sbjct: 58  NGIKVGEIGGIRLDQRDPNRVITDIELTRGTPVREDSVASSESQGISGVSIVQISAGTPS 117

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
           K  +     +  +R +I + P+ ++  +          +++   + K++ +         
Sbjct: 118 KPLLK--TNDHGKRPVIPSKPNAMSSLLQGGGQVVASATEALSRVNKVLSDRNIANIGGA 175

Query: 181 ANIETISTVLANNISHIDKMMHTT------QVTPHSSDSKNTFNTITDLITSLDKMIKAI 234
                ++T        +     +               + +               I   
Sbjct: 176 IRDVRMTTAELAANRTMFAHAGSALAKLDRAADDIQGAASSVRQIADGDGKRAFADISQA 235

Query: 235 DLQKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKS 294
             +  + + E   V +    +S+D    T+ ++  T  T QE  + +D L+       + 
Sbjct: 236 ANELKSAVHEARGVIAKLDTQSADIGTTTIPNINATMLTLQETAESLDGLIRGIRQSPRE 295

Query: 295 K 295
            
Sbjct: 296 A 296


>gi|325527208|gb|EGD04597.1| mce related protein [Burkholderia sp. TJI49]
          Length = 309

 Score =  103 bits (256), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 41/289 (14%), Positives = 107/289 (37%), Gaps = 11/289 (3%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K++    GLF +++      +++W +             +    +V GL  D++VRF
Sbjct: 1   MENKSHAFWAGLFTIALTLAIAGTVFWFNVDRTV---RVPYDLIARTNVTGLFPDAAVRF 57

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G+ VG++  +  D+ +P     + L+  D P+  ST  ++  QG+ GI +++L      
Sbjct: 58  RGLDVGKVQSIGFDRTHPGQIRIRILVDHDAPITQSTYGSLGFQGVTGIAFVQL---EDT 114

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
            + +  + +     A I   PS  +      +   +++  +++   +++      +   +
Sbjct: 115 GRDLSPLPSSPKSIAQIPMRPSLFDQLQERGDVLLRQLELAAKSANQLM---SPEMREQL 171

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
                     A+ ++ + K +         +         +             +L K  
Sbjct: 172 RATAESMQHAADGVTTLSKQLGPAVAALPQTMHDVDRAMTSANTLLQPNGPLVSNLNKAG 231

Query: 241 QILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFS 289
              E + V+ N+         +T+        +  +  +++  +  +  
Sbjct: 232 TAAEQVGVALNDLNARVQ--YDTLPRFNALAGSVSDASRQLKDVAGELG 278



 Score = 41.5 bits (94), Expect = 0.32,   Method: Composition-based stats.
 Identities = 20/159 (12%), Positives = 39/159 (24%), Gaps = 11/159 (6%)

Query: 282 DHLLSDFSSKMKSKETSAFLENIADSTSNMRSSISAIREITDQRQKIISTINTIENITSN 341
           D L       ++  E +A   N   S        +    +      + +    +    + 
Sbjct: 139 DQLQERGDVLLRQLELAAKSANQLMSPEMREQLRATAESMQHAADGVTTLSKQLGPAVAA 198

Query: 342 LNDSSQKFAELMSKINNISALKE-NNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNF 400
           L  +       M+  N +        S    A  A          +N  +          
Sbjct: 199 LPQTMHDVDRAMTSANTLLQPNGPLVSNLNKAGTAAEQVGVALNDLNARVQ--------- 249

Query: 401 SQSGLNDIQNLVRKLQETVNHFDDCLNNFERNPQDIVWG 439
               L     L   + +      D      RNP  +++G
Sbjct: 250 -YDTLPRFNALAGSVSDASRQLKDVAGELGRNPSSLLFG 287


>gi|16329641|ref|NP_440369.1| hypothetical protein sll1002 [Synechocystis sp. PCC 6803]
 gi|1652124|dbj|BAA17049.1| ycf22 [Synechocystis sp. PCC 6803]
          Length = 456

 Score =  103 bits (256), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 64/436 (14%), Positives = 128/436 (29%), Gaps = 45/436 (10%)

Query: 10  VGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRFNGIPVGRIV 69
           VGLF +  LF     + WL     +  P  EV+++      GL    +VR+ G+PVGR+ 
Sbjct: 12  VGLFALLGLFIIGGIVLWLRG-GAFGNPGYEVLVQF-DDASGLQVGGAVRYRGVPVGRVA 69

Query: 70  GLFLDQEYPNHSLAKALIRP-DTPLYPSTTATIRTQGLAGITYIELSTLRKEKKTIFQIA 128
            L          LA+  I      +       I   GL G   I++   R+  +    I 
Sbjct: 70  KLIPGSNG---ILAQLEISSTQLRIPADVQVEISRYGLLGEAAIDMIPDRQLSEAALAID 126

Query: 129 TERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTIANIETIST 188
                 A         +     A                  E +     T  +     + 
Sbjct: 127 PLSADCAESDKILCDGDELEGQAGTQLTNSMARLAQAYSEPEFVADINATVKSANLAAAR 186

Query: 189 VLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVNQILENIQV 248
           + A +           Q       +        D  + L   +  +       I   I+ 
Sbjct: 187 IAAMSAEITALSKTANQQVRGFERTSEAIAKAADNASLLTSRVDQVVQTNQGYINRTIEE 246

Query: 249 SSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAFLENIADST 308
           +S   V  +  V         T ++ +   + +  +  +  + + +        +     
Sbjct: 247 ASLLMVNLNQLVGENRAQFNLTLKSIETTNRDLQAIGQEIQTAVGTINHGLAAIDTQ--- 303

Query: 309 SNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNISALKENNSL 368
                                        +T++L    +  A   + I  IS    + +L
Sbjct: 304 ----------------------------KVTNDLALLMENAAVTSNNIRQISNDLNDPTL 335

Query: 369 FKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNN 428
               Q+ +   R T E   +    +     +   +  N+++ LV  L + V+  ++  + 
Sbjct: 336 MLTLQQTLDAARLTFENAQKITSDVEQLTGD--PAFRNNLRKLVDGLGQLVSSTENLQDR 393

Query: 429 ------FERNPQDIVW 438
                  ER+ Q + +
Sbjct: 394 VYTAHTLERSGQQLRF 409


>gi|172061851|ref|YP_001809503.1| hypothetical protein BamMC406_2810 [Burkholderia ambifaria MC40-6]
 gi|171994368|gb|ACB65287.1| Mammalian cell entry related domain protein [Burkholderia ambifaria
           MC40-6]
          Length = 311

 Score =  103 bits (256), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 43/282 (15%), Positives = 103/282 (36%), Gaps = 5/282 (1%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K++    GLF +++      +++W +             +    +V GL  D++VRF
Sbjct: 1   MENKSHAFWAGLFTIALTLAIAGTVFWFNVDRTV---RVPYDLLARTNVTGLFPDAAVRF 57

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G+ VG++  +  D+ +P     + L+  D P+  ST  ++  QG+ GI +++L    ++
Sbjct: 58  RGLDVGKVQSIGFDRTHPGQIRIRILVDRDAPITQSTYGSLGFQGVTGIAFVQLEDTGRD 117

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSR--HIQKIIENIEKPLTT 178
              +        Q  M  +    I           ++ ++S+      ++ E +     +
Sbjct: 118 LAPLPSSPKSIAQIPMRPSLFDQIQERGDVLLRQLEQAAESANALMSPEMREQLRATAES 177

Query: 179 TIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQK 238
                +  +T+       +  +  T      +  S NT       + S      +   Q 
Sbjct: 178 LQHAADGAATLSKQLAPAVAALPQTMHQVDRAMASANTLLQPNGPLVSNLNKAGSAAEQV 237

Query: 239 VNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQK 280
              + +       + +   + + ++V D     +       +
Sbjct: 238 GVALNDLNARVQYDTLPRFNTLADSVGDASRQLKDVAGELGR 279



 Score = 43.0 bits (98), Expect = 0.10,   Method: Composition-based stats.
 Identities = 17/169 (10%), Positives = 47/169 (27%), Gaps = 2/169 (1%)

Query: 271 TQTFQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNMRSSISAIREITDQRQKIIS 330
             +  +   +I    S F    +  +        A  ++N   S     ++    + +  
Sbjct: 121 LPSSPKSIAQIPMRPSLFDQIQERGDVLLRQLEQAAESANALMSPEMREQLRATAESLQH 180

Query: 331 TINTIENITSNLNDSSQKFAELMSKINNISALKENNSLFKDAQRAMHTFRDTSEKINRYI 390
             +    ++  L  +     + M +++   A      L +     +           +  
Sbjct: 181 AADGAATLSKQLAPAVAALPQTMHQVDRAMASANT--LLQPNGPLVSNLNKAGSAAEQVG 238

Query: 391 PSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFERNPQDIVWG 439
            ++ +         L     L   + +      D      RNP  +++G
Sbjct: 239 VALNDLNARVQYDTLPRFNTLADSVGDASRQLKDVAGELGRNPSSLLFG 287


>gi|187925541|ref|YP_001897183.1| hypothetical protein Bphyt_3569 [Burkholderia phytofirmans PsJN]
 gi|187716735|gb|ACD17959.1| Mammalian cell entry related domain protein [Burkholderia
           phytofirmans PsJN]
          Length = 186

 Score =  103 bits (256), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 28/117 (23%), Positives = 43/117 (36%), Gaps = 3/117 (2%)

Query: 2   ESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQY-DGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ++      VGLFVV       F        +     P   V ++   ++ GL   + V+ 
Sbjct: 3   KTAALDFWVGLFVVLGFVALLFLALKAGNMSSLSFQPTYPVKLKF-DNIGGLKARAPVKS 61

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTL 117
            G+ VGR+  +  D      +L    +         T+A I T GL G  YI L   
Sbjct: 62  AGVTVGRVASIGFDSNAY-QALVTIDLDKQYQFPKDTSAKILTSGLLGEQYIGLEPG 117


>gi|115352999|ref|YP_774838.1| hypothetical protein Bamb_2948 [Burkholderia ambifaria AMMD]
 gi|115282987|gb|ABI88504.1| Mammalian cell entry related domain protein [Burkholderia ambifaria
           AMMD]
          Length = 310

 Score =  103 bits (256), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 43/282 (15%), Positives = 103/282 (36%), Gaps = 5/282 (1%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K++    GLF +++      +++W +             +    +V GL  D++VRF
Sbjct: 1   MENKSHAFWAGLFTIALTLAIAGTVFWFNVDRTV---RVPYDLLARTNVTGLFPDAAVRF 57

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G+ VG++  +  D+ +P     + L+  D P+  ST  ++  QG+ GI +++L    ++
Sbjct: 58  RGLDVGKVQSIGFDRTHPGQIRIRILVDRDAPITQSTYGSLGFQGVTGIAFVQLEDTGRD 117

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSR--HIQKIIENIEKPLTT 178
              +        Q  M  +    I           ++ ++S+      ++ E +     +
Sbjct: 118 LAPLPSSPKSIAQIPMRPSLFDQIQERGDVLLRQLEQAAESANALMSPEMREQLRATAES 177

Query: 179 TIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQK 238
                +  +T+       +  +  T      +  S NT       + S      +   Q 
Sbjct: 178 LQHAADGAATLSKQLAPAVAALPQTMHQVDRAMASANTLLQPNGPLVSNLNKAGSAAEQV 237

Query: 239 VNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQK 280
              + +       + +   + + ++V D     +       +
Sbjct: 238 GVALNDLNARVQYDTLPRFNTLADSVGDASRQLKDVAGELGR 279



 Score = 43.0 bits (98), Expect = 0.10,   Method: Composition-based stats.
 Identities = 17/169 (10%), Positives = 47/169 (27%), Gaps = 2/169 (1%)

Query: 271 TQTFQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNMRSSISAIREITDQRQKIIS 330
             +  +   +I    S F    +  +        A  ++N   S     ++    + +  
Sbjct: 121 LPSSPKSIAQIPMRPSLFDQIQERGDVLLRQLEQAAESANALMSPEMREQLRATAESLQH 180

Query: 331 TINTIENITSNLNDSSQKFAELMSKINNISALKENNSLFKDAQRAMHTFRDTSEKINRYI 390
             +    ++  L  +     + M +++   A      L +     +           +  
Sbjct: 181 AADGAATLSKQLAPAVAALPQTMHQVDRAMASANT--LLQPNGPLVSNLNKAGSAAEQVG 238

Query: 391 PSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFERNPQDIVWG 439
            ++ +         L     L   + +      D      RNP  +++G
Sbjct: 239 VALNDLNARVQYDTLPRFNTLADSVGDASRQLKDVAGELGRNPSSLLFG 287


>gi|171322066|ref|ZP_02910938.1| Mammalian cell entry related domain protein [Burkholderia ambifaria
           MEX-5]
 gi|171092628|gb|EDT37932.1| Mammalian cell entry related domain protein [Burkholderia ambifaria
           MEX-5]
          Length = 311

 Score =  103 bits (256), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 43/282 (15%), Positives = 104/282 (36%), Gaps = 5/282 (1%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K++    GLF +++      +++W +             +    +V GL  D++VRF
Sbjct: 1   MENKSHAFWAGLFTIALTLAIAGTVFWFNVDRTV---RVPYDLLARTNVTGLFPDAAVRF 57

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G+ VG++  +  D+ +P     + L+  D P+  ST  ++  QG+ GI +++L    ++
Sbjct: 58  RGLDVGKVQSIGFDRTHPGQIRIRILVDRDAPITQSTYGSLGFQGVTGIAFVQLEDTGRD 117

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSR--HIQKIIENIEKPLTT 178
              +        Q  M  +    I           ++ ++S+      ++ E +     +
Sbjct: 118 LAPLPSSPKAIAQIPMRPSLFDQIQERGDVLLRQLEQAAESANALMSPEMREQLRATAES 177

Query: 179 TIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQK 238
                +  +T+       +  +  T      +  S NT       + S      +   Q 
Sbjct: 178 LQHAADGAATLSKQLAPAVAALPQTMHEVNRAMASANTLLQPNGPLVSNLNKAGSAAEQV 237

Query: 239 VNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQK 280
              + +       + +   + + ++V D  +  +       +
Sbjct: 238 GVALNDLNSRVQYDTLPRFNALASSVGDASQQLKDVAGELGR 279



 Score = 42.6 bits (97), Expect = 0.12,   Method: Composition-based stats.
 Identities = 18/169 (10%), Positives = 47/169 (27%), Gaps = 2/169 (1%)

Query: 271 TQTFQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNMRSSISAIREITDQRQKIIS 330
             +  +   +I    S F    +  +        A  ++N   S     ++    + +  
Sbjct: 121 LPSSPKAIAQIPMRPSLFDQIQERGDVLLRQLEQAAESANALMSPEMREQLRATAESLQH 180

Query: 331 TINTIENITSNLNDSSQKFAELMSKINNISALKENNSLFKDAQRAMHTFRDTSEKINRYI 390
             +    ++  L  +     + M ++N   A      L +     +           +  
Sbjct: 181 AADGAATLSKQLAPAVAALPQTMHEVNRAMASANT--LLQPNGPLVSNLNKAGSAAEQVG 238

Query: 391 PSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFERNPQDIVWG 439
            ++ +         L     L   + +      D      RNP  +++G
Sbjct: 239 VALNDLNSRVQYDTLPRFNALASSVGDASQQLKDVAGELGRNPSSLLFG 287


>gi|261840138|gb|ACX99903.1| ABC transport system substrate binding protein [Helicobacter pylori
           52]
          Length = 271

 Score =  103 bits (255), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 22/111 (19%), Positives = 45/111 (40%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME    YT +G      L      I WL      DG   E ++     + G++T+S + +
Sbjct: 1   MERHVNYTLIGGLFFLCLVCMVGFILWLGHLGLDDGKYYEYVVYTDKDLGGIATNSPINY 60

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITY 111
            GI VG ++ +   ++         +I+    +   +   + ++G  G+ +
Sbjct: 61  KGIQVGNVIKVGFAKDKVGVVRLDLMIKSSVKIRKDSKVAVSSRGFMGLKF 111



 Score = 44.9 bits (103), Expect = 0.029,   Method: Composition-based stats.
 Identities = 13/136 (9%), Positives = 45/136 (33%), Gaps = 2/136 (1%)

Query: 304 IADSTSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNISALK 363
             +   +  S  +        +          +              +L++ ++  S   
Sbjct: 135 FKEGLMDRLSGDANQAVQEVMKAIKNVNRILDDENVEKFKHILASIDDLIANLD--SRKV 192

Query: 364 ENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFD 423
           + ++L K+A   + +  + +  +++ +     + +      +   Q  +R +   V    
Sbjct: 193 QFDALIKNANNLVSSANNVALNVDKRLKEGQYDFKAMFTPLIMQAQLSLRNIDNFVEKGS 252

Query: 424 DCLNNFERNPQDIVWG 439
             ++ F+ NP   ++G
Sbjct: 253 ALIDKFDANPYKTIFG 268


>gi|319761113|ref|YP_004125050.1| mammalian cell entry related domain protein [Alicycliphilus
           denitrificans BC]
 gi|330822971|ref|YP_004386274.1| Mammalian cell entry related domain-containing protein
           [Alicycliphilus denitrificans K601]
 gi|317115674|gb|ADU98162.1| Mammalian cell entry related domain protein [Alicycliphilus
           denitrificans BC]
 gi|329308343|gb|AEB82758.1| Mammalian cell entry related domain protein [Alicycliphilus
           denitrificans K601]
          Length = 325

 Score =  103 bits (255), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 35/183 (19%), Positives = 73/183 (39%), Gaps = 6/183 (3%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K++  + G+FV+ +         WL+R            +    SV GL   + VR+
Sbjct: 1   MENKSHALAAGIFVIVVAALLAGLGMWLTRDQ---TAYQIYELSSKDSVSGLQPQAPVRY 57

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G+ VG++  +  D E P + L +  +    P+  +T AT+  QG+ G+ +++L      
Sbjct: 58  KGVAVGKVTRIGFDPEAPGNVLIRIAVNTTAPISTTTFATLGYQGVTGLAHVQLDDADA- 116

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
              + Q A   +    +    S  +           ++  ++  I  ++ +  +    T 
Sbjct: 117 --PLPQPAPGASGLPRLPLQTSTFSQVAEQGPAIMAQVQQATERINTLLGDENQQRFATA 174

Query: 181 ANI 183
              
Sbjct: 175 LQQ 177



 Score = 45.7 bits (105), Expect = 0.016,   Method: Composition-based stats.
 Identities = 17/182 (9%), Positives = 51/182 (28%), Gaps = 5/182 (2%)

Query: 258 DQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNMRSSISA 317
            ++        +  +    +  ++       ++ +  +    F   +    +   S    
Sbjct: 129 PRLPLQTSTFSQVAEQGPAIMAQVQQATERINTLLGDENQQRFATALQQLGAAAGSIDQL 188

Query: 318 IREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNISALKENNSLFKDAQRAMH 377
           +R + +     +          +   D+ Q    L    ++ +   +     + A RA++
Sbjct: 189 VRHLDNTVSTRLDPALAGVPALTQ--DAQQTLHALRQAGSSAAGAADE---VRQAVRALN 243

Query: 378 TFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFERNPQDIV 437
                  +I     S+      F +  L  +     +                 NPQ ++
Sbjct: 244 AEGGALAEIASGAKSLTTAADRFGRVTLPSLNRAADETARAARRLGRTATGINDNPQSLI 303

Query: 438 WG 439
           +G
Sbjct: 304 YG 305


>gi|134279684|ref|ZP_01766396.1| ABC transporter, periplasmic substrate-binding protein
           [Burkholderia pseudomallei 305]
 gi|167736873|ref|ZP_02409647.1| ABC transporter, periplasmic substrate-binding protein
           [Burkholderia pseudomallei 14]
 gi|134248884|gb|EBA48966.1| ABC transporter, periplasmic substrate-binding protein
           [Burkholderia pseudomallei 305]
          Length = 309

 Score =  103 bits (255), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 42/289 (14%), Positives = 105/289 (36%), Gaps = 11/289 (3%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K++    GLF +++L     ++YW +             +    +V GL  D++VR+
Sbjct: 1   MENKSHAFWAGLFTIALLGAIVGAVYWFNVDRTV---RVPYDLVSRSNVTGLFPDAAVRY 57

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G+ VG++  +  D+ +P   + + L+  + P+  ST  ++  QG+ GI +++L     +
Sbjct: 58  RGLDVGKVQSINFDRGHPGQIVIRILVDTNAPITRSTFGSLGFQGVTGIAFVQLDDTGAD 117

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
              +   A      A I   PS  +      +   K++  +++    + E +   +   +
Sbjct: 118 LAPLPTSAK---AVAQIPMRPSLFDQLQQRGDVLLKQMEIAAK---SVNEMLSPAMRDQL 171

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
                     A+ ++ + + +         +         +             +L +  
Sbjct: 172 KATAASMQHAADGVTQLSRQVEPALARMPQTMEHVNRALSSANALVAPGGPLVANLNRAG 231

Query: 241 QILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFS 289
           Q L ++  +            +T+           +  + +  +  D  
Sbjct: 232 QALASMNDTLAELSARVR--YDTLPRFNALATNVGDASRTLKDVAGDVG 278



 Score = 44.2 bits (101), Expect = 0.041,   Method: Composition-based stats.
 Identities = 22/173 (12%), Positives = 51/173 (29%), Gaps = 11/173 (6%)

Query: 268 RETTQTFQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNMRSSISAIREITDQRQK 327
            +            D L       +K  E +A   N   S +      +    +      
Sbjct: 125 AKAVAQIPMRPSLFDQLQQRGDVLLKQMEIAAKSVNEMLSPAMRDQLKATAASMQHAADG 184

Query: 328 IISTINTIENITSNLNDSSQKFAELMSKINNISALKE-NNSLFKDAQRAMHTFRDTSEKI 386
           +      +E   + +  + +     +S  N + A      +    A +A+ +  DT  ++
Sbjct: 185 VTQLSRQVEPALARMPQTMEHVNRALSSANALVAPGGPLVANLNRAGQALASMNDTLAEL 244

Query: 387 NRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFERNPQDIVWG 439
           +  +              L     L   + +      D   +  RNP+ +++G
Sbjct: 245 SARVR----------YDTLPRFNALATNVGDASRTLKDVAGDVGRNPRSLLFG 287


>gi|221069467|ref|ZP_03545572.1| Mammalian cell entry related domain protein [Comamonas testosteroni
           KF-1]
 gi|220714490|gb|EED69858.1| Mammalian cell entry related domain protein [Comamonas testosteroni
           KF-1]
          Length = 315

 Score =  103 bits (255), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 34/128 (26%), Positives = 65/128 (50%), Gaps = 3/128 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K++  + G+FV+ +         WL+R N+         +     V GL   ++VR+
Sbjct: 1   MENKSHAMAAGIFVLVVAALLAGLAVWLTRDNR---EYQLYEMSTKDGVSGLQPQATVRY 57

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G+PVG++V +  D + P + L +  +  DTP+ P+T A +  QG+ G+ +I+L    + 
Sbjct: 58  KGVPVGKVVRIGFDPQIPGNVLIRIAVGEDTPVTPATYAQLGYQGVTGLAHIQLDDDSRA 117

Query: 121 KKTIFQIA 128
            + +    
Sbjct: 118 SQPLKPGP 125



 Score = 41.5 bits (94), Expect = 0.33,   Method: Composition-based stats.
 Identities = 20/214 (9%), Positives = 61/214 (28%), Gaps = 12/214 (5%)

Query: 228 DKMIKAIDLQKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSD 287
                 +  Q V  +        +   +      + +  +   +     +  +   LL  
Sbjct: 92  PATYAQLGYQGVTGLAHIQLDDDSRASQPLKPGPSGLPRLPMKSSPLNMLADQGPVLLER 151

Query: 288 FSSKMKSKETSAFLENIADSTSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQ 347
                +        +N    ++ + +  +A   I D  + +  T      +T++ + + Q
Sbjct: 152 VDEISRRLNAMLGEDNQKRVSAALDNIAAASGGIKDLAETMNKTAKDFPQLTADAHQTLQ 211

Query: 348 KFAELMSKINNISALKENNSLFKDAQRAMHTFRDT---SEKINRYIPSIGNNLQNFSQSG 404
              +  +             +  D Q+ +          ++I     ++    ++  +S 
Sbjct: 212 SLTKAGNA---------ATGVATDLQQTVRKVNAPDGPLQQIAEGTQALSQAAESLGRST 262

Query: 405 LNDIQNLVRKLQETVNHFDDCLNNFERNPQDIVW 438
           L  +      +             F  NPQ +++
Sbjct: 263 LPRMNGAADDVSRAARTMGAAAGRFNDNPQSVIY 296


>gi|161523585|ref|YP_001578597.1| hypothetical protein Bmul_0405 [Burkholderia multivorans ATCC
           17616]
 gi|189351645|ref|YP_001947273.1| putative ABC transporter substrate-binding protein [Burkholderia
           multivorans ATCC 17616]
 gi|221211090|ref|ZP_03584069.1| ABC transporter, periplasmic ligand binding protein [Burkholderia
           multivorans CGD1]
 gi|160341014|gb|ABX14100.1| Mammalian cell entry related domain protein [Burkholderia
           multivorans ATCC 17616]
 gi|189335667|dbj|BAG44737.1| putative ABC transport system substrate-binding protein
           [Burkholderia multivorans ATCC 17616]
 gi|221168451|gb|EEE00919.1| ABC transporter, periplasmic ligand binding protein [Burkholderia
           multivorans CGD1]
          Length = 309

 Score =  103 bits (255), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 34/176 (19%), Positives = 79/176 (44%), Gaps = 6/176 (3%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K++    GLF + +      +++W +             +    +V GL  D++VRF
Sbjct: 1   MENKSHAFWAGLFTILLTLAIVGAVFWFNVDRTV---RVPYDLIARTNVTGLFPDAAVRF 57

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G+ VG++  +  D+ +P     + L+  D P+  ST  ++  QG+ GI +++L      
Sbjct: 58  RGLDVGKVQSIGFDRSHPGQIRIRILVDQDAPITQSTYGSLGFQGVTGIAFVQL---EDT 114

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPL 176
            + +  + +     A I   PS  +   S  +   +++  +++ + +++    +  
Sbjct: 115 GRDLSPLPSSPKAIAQIPMRPSLFDQLQSRGDVLLRQLELAAKSVNELMSPEMREQ 170



 Score = 39.1 bits (88), Expect = 1.6,   Method: Composition-based stats.
 Identities = 27/264 (10%), Positives = 65/264 (24%), Gaps = 24/264 (9%)

Query: 196 HIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVNQILENIQVSSNNFVK 255
               +  T +V        N      D       +                Q+     V 
Sbjct: 26  FWFNVDRTVRVPYDLIARTNVTGLFPDAAVRFRGLDVGKVQSIGFDRSHPGQIRIRILVD 85

Query: 256 SSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNMRSSI 315
               +  + +              +++    D S    S +  A +         ++S  
Sbjct: 86  QDAPITQSTYGSLGFQGVTGIAFVQLEDTGRDLSPLPSSPKAIAQIPMRPSLFDQLQSRG 145

Query: 316 SAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNISALKENNSLFKDAQRA 375
             +    +   K ++ + +   +   L  +++        +  +S   +           
Sbjct: 146 DVLLRQLELAAKSVNELMSP-EMREQLRATAESLQHAADGVTTLSK--QLGPAVTALPET 202

Query: 376 MHTFRDTSEKINRYIPSIGNNLQNFSQSG--LNDIQNLVRKLQ----------------- 416
           M     T    NR +   G  + N +++G     +   +  L                  
Sbjct: 203 MTEVNRTMASANRLLQPNGPLVANLNKAGTAAEQVGTALNDLNARVQYDTLPRFNALAGS 262

Query: 417 --ETVNHFDDCLNNFERNPQDIVW 438
             +    F D      RNP  +++
Sbjct: 263 VGDASRQFKDVAGELGRNPSSLLF 286


>gi|325519292|gb|EGC98731.1| hypothetical protein B1M_40158 [Burkholderia sp. TJI49]
          Length = 159

 Score =  103 bits (255), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 26/122 (21%), Positives = 43/122 (35%), Gaps = 1/122 (0%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M+       VGLFVV       F    +   +         +     ++ GL   ++V+ 
Sbjct: 3   MKKTALDFWVGLFVVVGFLAVLFLALKVGNMSSLSFQPTYAVRMKFDNIGGLKPRAAVKS 62

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G+ VGR+  +  D      +L    +         ++A I T GL G  YI L      
Sbjct: 63  AGVVVGRVKSIGFDTNTY-QALVTIDLDGQYQFPKDSSAKILTSGLLGEQYIGLEPGGDT 121

Query: 121 KK 122
           + 
Sbjct: 122 EM 123


>gi|53718043|ref|YP_107029.1| mce related protein [Burkholderia pseudomallei K96243]
 gi|53724607|ref|YP_101913.1| ABC transporter periplasmic substrate-binding protein [Burkholderia
           mallei ATCC 23344]
 gi|67642418|ref|ZP_00441175.1| ABC transporter, periplasmic substrate-binding protein
           [Burkholderia mallei GB8 horse 4]
 gi|76812149|ref|YP_332028.1| ABC transporter periplasmic substrate-binding protein [Burkholderia
           pseudomallei 1710b]
 gi|121600461|ref|YP_991581.1| ABC transporter, periplasmic substrate-binding protein
           [Burkholderia mallei SAVP1]
 gi|124386612|ref|YP_001027346.1| ABC transporter, periplasmic substrate-binding protein
           [Burkholderia mallei NCTC 10229]
 gi|126439252|ref|YP_001057486.1| ABC transporter, periplasmic substrate-binding protein
           [Burkholderia pseudomallei 668]
 gi|126448984|ref|YP_001082716.1| ABC transporter, periplasmic substrate-binding protein
           [Burkholderia mallei NCTC 10247]
 gi|126454456|ref|YP_001064735.1| ABC transporter, periplasmic substrate-binding protein
           [Burkholderia pseudomallei 1106a]
 gi|167004398|ref|ZP_02270156.1| ABC transporter, periplasmic substrate-binding protein
           [Burkholderia mallei PRL-20]
 gi|167717854|ref|ZP_02401090.1| ABC transporter, periplasmic substrate-binding protein
           [Burkholderia pseudomallei DM98]
 gi|167813978|ref|ZP_02445658.1| ABC transporter, periplasmic substrate-binding protein
           [Burkholderia pseudomallei 91]
 gi|167822499|ref|ZP_02453970.1| ABC transporter, periplasmic substrate-binding protein
           [Burkholderia pseudomallei 9]
 gi|167844080|ref|ZP_02469588.1| ABC transporter, periplasmic substrate-binding protein
           [Burkholderia pseudomallei B7210]
 gi|167892584|ref|ZP_02479986.1| ABC transporter, periplasmic substrate-binding protein
           [Burkholderia pseudomallei 7894]
 gi|167901081|ref|ZP_02488286.1| ABC transporter, periplasmic substrate-binding protein
           [Burkholderia pseudomallei NCTC 13177]
 gi|167909301|ref|ZP_02496392.1| ABC transporter, periplasmic substrate-binding protein
           [Burkholderia pseudomallei 112]
 gi|167917333|ref|ZP_02504424.1| ABC transporter, periplasmic substrate-binding protein
           [Burkholderia pseudomallei BCC215]
 gi|217419794|ref|ZP_03451300.1| ABC transporter, periplasmic substrate-binding protein
           [Burkholderia pseudomallei 576]
 gi|226193726|ref|ZP_03789329.1| ABC transporter, periplasmic substrate-binding protein
           [Burkholderia pseudomallei Pakistan 9]
 gi|237810637|ref|YP_002895088.1| ABC transporter, periplasmic substrate-binding protein
           [Burkholderia pseudomallei MSHR346]
 gi|242314483|ref|ZP_04813499.1| ABC transporter, periplasmic substrate-binding protein
           [Burkholderia pseudomallei 1106b]
 gi|254176977|ref|ZP_04883634.1| ABC transporter, periplasmic substrate-binding protein
           [Burkholderia mallei ATCC 10399]
 gi|254181996|ref|ZP_04888593.1| ABC transporter, periplasmic substrate-binding protein
           [Burkholderia pseudomallei 1655]
 gi|254187925|ref|ZP_04894437.1| ABC transporter, periplasmic substrate-binding protein
           [Burkholderia pseudomallei Pasteur 52237]
 gi|254196753|ref|ZP_04903177.1| ABC transporter, periplasmic substrate-binding protein
           [Burkholderia pseudomallei S13]
 gi|254202026|ref|ZP_04908390.1| ABC transporter, periplasmic substrate-binding protein
           [Burkholderia mallei FMH]
 gi|254207357|ref|ZP_04913708.1| ABC transporter, periplasmic substrate-binding protein
           [Burkholderia mallei JHU]
 gi|254261934|ref|ZP_04952988.1| ABC transporter, periplasmic substrate-binding protein
           [Burkholderia pseudomallei 1710a]
 gi|254295955|ref|ZP_04963412.1| ABC transporter, periplasmic substrate-binding protein
           [Burkholderia pseudomallei 406e]
 gi|254357614|ref|ZP_04973888.1| ABC transporter, periplasmic substrate-binding protein
           [Burkholderia mallei 2002721280]
 gi|52208457|emb|CAH34391.1| mce related protein [Burkholderia pseudomallei K96243]
 gi|52428030|gb|AAU48623.1| ABC transporter, periplasmic substrate-binding protein
           [Burkholderia mallei ATCC 23344]
 gi|76581602|gb|ABA51077.1| ABC transporter, periplasmic substrate-binding protein
           [Burkholderia pseudomallei 1710b]
 gi|121229271|gb|ABM51789.1| ABC transporter, periplasmic substrate-binding protein
           [Burkholderia mallei SAVP1]
 gi|124294632|gb|ABN03901.1| ABC transporter, periplasmic substrate-binding protein
           [Burkholderia mallei NCTC 10229]
 gi|126218745|gb|ABN82251.1| ABC transporter, periplasmic substrate-binding protein
           [Burkholderia pseudomallei 668]
 gi|126228098|gb|ABN91638.1| ABC transporter, periplasmic substrate-binding protein
           [Burkholderia pseudomallei 1106a]
 gi|126241854|gb|ABO04947.1| ABC transporter, periplasmic substrate-binding protein
           [Burkholderia mallei NCTC 10247]
 gi|147747920|gb|EDK54996.1| ABC transporter, periplasmic substrate-binding protein
           [Burkholderia mallei FMH]
 gi|147752899|gb|EDK59965.1| ABC transporter, periplasmic substrate-binding protein
           [Burkholderia mallei JHU]
 gi|148026678|gb|EDK84763.1| ABC transporter, periplasmic substrate-binding protein
           [Burkholderia mallei 2002721280]
 gi|157805734|gb|EDO82904.1| ABC transporter, periplasmic substrate-binding protein
           [Burkholderia pseudomallei 406e]
 gi|157935605|gb|EDO91275.1| ABC transporter, periplasmic substrate-binding protein
           [Burkholderia pseudomallei Pasteur 52237]
 gi|160698018|gb|EDP87988.1| ABC transporter, periplasmic substrate-binding protein
           [Burkholderia mallei ATCC 10399]
 gi|169653496|gb|EDS86189.1| ABC transporter, periplasmic substrate-binding protein
           [Burkholderia pseudomallei S13]
 gi|184212534|gb|EDU09577.1| ABC transporter, periplasmic substrate-binding protein
           [Burkholderia pseudomallei 1655]
 gi|217397098|gb|EEC37114.1| ABC transporter, periplasmic substrate-binding protein
           [Burkholderia pseudomallei 576]
 gi|225934304|gb|EEH30288.1| ABC transporter, periplasmic substrate-binding protein
           [Burkholderia pseudomallei Pakistan 9]
 gi|237503443|gb|ACQ95761.1| ABC transporter, periplasmic substrate-binding protein
           [Burkholderia pseudomallei MSHR346]
 gi|238523567|gb|EEP87005.1| ABC transporter, periplasmic substrate-binding protein
           [Burkholderia mallei GB8 horse 4]
 gi|242137722|gb|EES24124.1| ABC transporter, periplasmic substrate-binding protein
           [Burkholderia pseudomallei 1106b]
 gi|243060280|gb|EES42466.1| ABC transporter, periplasmic substrate-binding protein
           [Burkholderia mallei PRL-20]
 gi|254220623|gb|EET10007.1| ABC transporter, periplasmic substrate-binding protein
           [Burkholderia pseudomallei 1710a]
          Length = 309

 Score =  103 bits (255), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 41/282 (14%), Positives = 103/282 (36%), Gaps = 5/282 (1%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K++    GLF +++L     ++YW +             +    +V GL  D++VR+
Sbjct: 1   MENKSHAFWAGLFTIALLGAIVGAVYWFNVDRTV---RVPYDLVSRSNVTGLFPDAAVRY 57

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G+ VG++  +  D+ +P   + + L+  + P+  ST  ++  QG+ GI +++L     +
Sbjct: 58  RGLDVGKVQSINFDRGHPGQIVIRILVDTNAPITRSTFGSLGFQGVTGIAFVQLDDTGAD 117

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHI--QKIIENIEKPLTT 178
              +   A    Q  M  +    +           +  + S   +   ++ + ++    +
Sbjct: 118 LAPLPTSAKAVAQIPMRPSLFDQLQQRGDVLLKQMEIAAKSVNEMLSPEMRDQLKATAAS 177

Query: 179 TIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQK 238
                + ++ +       + +M  T +    +  S N        + +            
Sbjct: 178 MQHAADGVTQLSRQVEPALARMPQTMEHVNRALSSANALVAPGGPLVANLNRAGQALASM 237

Query: 239 VNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQK 280
            + + E       + +   + +   V D   T +       +
Sbjct: 238 NDTLAELSARVRYDTLPRFNALATNVGDASRTLKDVAGDVGR 279



 Score = 44.9 bits (103), Expect = 0.029,   Method: Composition-based stats.
 Identities = 22/173 (12%), Positives = 50/173 (28%), Gaps = 11/173 (6%)

Query: 268 RETTQTFQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNMRSSISAIREITDQRQK 327
            +            D L       +K  E +A   N   S        +    +      
Sbjct: 125 AKAVAQIPMRPSLFDQLQQRGDVLLKQMEIAAKSVNEMLSPEMRDQLKATAASMQHAADG 184

Query: 328 IISTINTIENITSNLNDSSQKFAELMSKINNISALKE-NNSLFKDAQRAMHTFRDTSEKI 386
           +      +E   + +  + +     +S  N + A      +    A +A+ +  DT  ++
Sbjct: 185 VTQLSRQVEPALARMPQTMEHVNRALSSANALVAPGGPLVANLNRAGQALASMNDTLAEL 244

Query: 387 NRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFERNPQDIVWG 439
           +  +              L     L   + +      D   +  RNP+ +++G
Sbjct: 245 SARVR----------YDTLPRFNALATNVGDASRTLKDVAGDVGRNPRSLLFG 287


>gi|91786143|ref|YP_547095.1| hypothetical protein Bpro_0232 [Polaromonas sp. JS666]
 gi|91695368|gb|ABE42197.1| Mammalian cell entry related protein [Polaromonas sp. JS666]
          Length = 310

 Score =  103 bits (255), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 34/135 (25%), Positives = 61/135 (45%), Gaps = 3/135 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K +  + G FV+ +         WL+R N          +    SV GL   ++VRF
Sbjct: 1   MENKAHAMAAGAFVLVVTALLVMLAVWLTRDN---TQRNLYEMSTGESVSGLQPQAAVRF 57

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G+PVG++  +  D +   + L +  I    P+  ST AT+ +QG+ G+ +I+L      
Sbjct: 58  RGVPVGKVELIGFDTKVKGNVLIRVSIDRSAPVTKSTFATVASQGVTGLGFIQLDDDGSS 117

Query: 121 KKTIFQIATERNQRA 135
            + +     +  +  
Sbjct: 118 PERLVPNDEDPPRIP 132



 Score = 48.8 bits (113), Expect = 0.002,   Method: Composition-based stats.
 Identities = 15/137 (10%), Positives = 45/137 (32%), Gaps = 8/137 (5%)

Query: 310 NMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKI-----NNISALKE 364
              S+        + +  + S I  +     ++N  ++     ++ +     +    LK 
Sbjct: 153 EQASTRLNKLLSDENQAAVTSAITQLGEAAGSINRVARGLEPTVATLPGLSRDATVTLKS 212

Query: 365 NNSLFKDAQRAMHTFRDTSEKINRYIP---SIGNNLQNFSQSGLNDIQNLVRKLQETVNH 421
             +   D              +++      ++   ++ FS   L  +  +  +   T+  
Sbjct: 213 VKTAADDVSTTATRLNAKGGTLDKLSDGGTALAAGVETFSAGTLPKLGEVADETARTMRQ 272

Query: 422 FDDCLNNFERNPQDIVW 438
               +N  + NPQ +++
Sbjct: 273 LRRTVNAVDDNPQSLIF 289


>gi|206558709|ref|YP_002229469.1| hypothetical protein BCAL0303 [Burkholderia cenocepacia J2315]
 gi|198034746|emb|CAR50613.1| putative membrane protein [Burkholderia cenocepacia J2315]
          Length = 186

 Score =  103 bits (255), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 28/123 (22%), Positives = 46/123 (37%), Gaps = 3/123 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQY-DGPMAEVIIRIPGSVDGLSTDSSVR 59
           M+       VGLFVV       F    +   +     P   V ++   ++ GL   ++V+
Sbjct: 3   MKKTALDFWVGLFVVVGFLAVLFLALKVGNMSSLSFQPTYSVRMKF-DNIGGLKPRAAVK 61

Query: 60  FNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRK 119
             G+ VGR+  +  D      +L    +         ++A I T GL G  YI L     
Sbjct: 62  SAGVVVGRVKSIGFDTNTY-QALVTIDVDGQYQFPKDSSAKILTSGLLGEQYIGLDPGGD 120

Query: 120 EKK 122
            + 
Sbjct: 121 TEM 123


>gi|121998897|ref|YP_001003684.1| hypothetical protein Hhal_2118 [Halorhodospira halophila SL1]
 gi|121590302|gb|ABM62882.1| Mammalian cell entry related domain protein [Halorhodospira
           halophila SL1]
          Length = 151

 Score =  103 bits (254), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 28/120 (23%), Positives = 45/120 (37%), Gaps = 2/120 (1%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M  +     VG+FV   L         +S   +   P    +     +V GL   + V  
Sbjct: 1   MSQRLVEIWVGVFVAIGLAAMMVLALQVSGLTELRQPPGYYVTAKFDNVGGLREKAPVSM 60

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDT-PLYPSTTATIRTQGLAGITYIELSTLRK 119
            G+ VGR+  + LD E  + +  +  I      +   + A I T GL G  Y+ L    +
Sbjct: 61  AGVRVGRVEEIRLDPES-HQAEVRLRINERFGAIPADSAAAIYTAGLLGEQYVGLEPGWE 119


>gi|107023831|ref|YP_622158.1| hypothetical protein Bcen_2284 [Burkholderia cenocepacia AU 1054]
 gi|116690917|ref|YP_836540.1| hypothetical protein Bcen2424_2899 [Burkholderia cenocepacia
           HI2424]
 gi|254247080|ref|ZP_04940401.1| Mce4/Rv3499c/MTV023.06c protein [Burkholderia cenocepacia PC184]
 gi|105894020|gb|ABF77185.1| Mammalian cell entry related protein [Burkholderia cenocepacia AU
           1054]
 gi|116649006|gb|ABK09647.1| Mammalian cell entry related domain protein [Burkholderia
           cenocepacia HI2424]
 gi|124871856|gb|EAY63572.1| Mce4/Rv3499c/MTV023.06c protein [Burkholderia cenocepacia PC184]
          Length = 309

 Score =  103 bits (254), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 33/176 (18%), Positives = 77/176 (43%), Gaps = 6/176 (3%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K++    GLF +++      +++W +             +    +V GL  D++VRF
Sbjct: 1   MENKSHAFWAGLFTIALTLAIAGTVFWFNVDRTV---RVPYDLLARTNVTGLFPDAAVRF 57

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G+ VG++  +  D+ +P     + L+  D P+  ST  ++  QG+ GI +++L      
Sbjct: 58  RGLDVGKVQSIGFDRTHPGQIRIRILVDHDAPITQSTYGSLGFQGVTGIAFVQL---EDT 114

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPL 176
            + +  + +     A I   PS  +      +   +++  +++    ++    +  
Sbjct: 115 GRDLSPLPSSPKAIAQIPMRPSLFDQIQERGDVLLRQLELAAKSANALMSPEMREQ 170



 Score = 41.1 bits (93), Expect = 0.34,   Method: Composition-based stats.
 Identities = 22/226 (9%), Positives = 56/226 (24%), Gaps = 2/226 (0%)

Query: 214 KNTFNTITDLITSLDKMIKAIDLQKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQT 273
           K              ++   +D            +        +   +           +
Sbjct: 64  KVQSIGFDRTHPGQIRIRILVDHDAPITQSTYGSLGFQGVTGIAFVQLEDTGRDLSPLPS 123

Query: 274 FQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNMRSSISAIREITDQRQKIISTIN 333
             +   +I    S F    +  +       +A  ++N   S     ++    + +    +
Sbjct: 124 SPKAIAQIPMRPSLFDQIQERGDVLLRQLELAAKSANALMSPEMREQLRATAESLQHAAD 183

Query: 334 TIENITSNLNDSSQKFAELMSKINNISALKENNSLFKDAQRAMHTFRDTSEKINRYIPSI 393
               +T  L  +     E M ++N   A      L +     +           +   ++
Sbjct: 184 GAATLTKQLGPAVTALPETMHEVNRAMASANT--LLQPNGPLVSNLNKAGTAAEQVGVAL 241

Query: 394 GNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFERNPQDIVWG 439
                      L     L   + +      D      RNP+ +++G
Sbjct: 242 NGLNARVQYDTLPRFNALADSVGDASRQLKDVAGELGRNPRSLLFG 287


>gi|159028612|emb|CAO90615.1| unnamed protein product [Microcystis aeruginosa PCC 7806]
          Length = 458

 Score =  103 bits (254), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 51/431 (11%), Positives = 133/431 (30%), Gaps = 24/431 (5%)

Query: 10  VGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRFNGIPVGRIV 69
           +GL +++      + + WLS  + + G         P +V G+   + V + G+ +G++ 
Sbjct: 19  IGLMLLASGGILIWFVTWLSNFS-FGGRSYRASFLFP-NVGGMMVGTRVGYRGVRIGQVT 76

Query: 70  GLFLDQEYPNHSLAKALIRP-DTPLYPSTTATIRTQGLAGITYIELSTLRKEKKTIFQIA 128
            +  + E       +  I P D  +  ++       GL G T I+++            A
Sbjct: 77  AITPEPEG---VAVEVEISPADRLIPSNSLIEAIQSGLVGETTIDITP---------LQA 124

Query: 129 TERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTIANIETIST 188
                      +P+     I    +  +  S  + +           L +    +    +
Sbjct: 125 LPVGGVKEPPLSPNCNGEVIICNGSRLQGQSALNVNTLIRSLLRISNLVSDPDMVAGFRS 184

Query: 189 VLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVNQILENIQV 248
                 + +  +   +     +        T+  + + +  +     +      L +   
Sbjct: 185 FTQRAANALGGLDRFSGEATTALSEVRRSGTLGKVNSGMRSLESLPQVSGSLDRLSSDLS 244

Query: 249 SSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAFLENIADST 308
                 + +  ++ ++            + +    LL    +  + +      +N   +T
Sbjct: 245 GVGGLSQEATTLLRSLQGSGGLRNLDATLVEARKTLLLVGETTEELRVFLGANQNRLIAT 304

Query: 309 SNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNISALKENNSL 368
            +   + S   + T      I T      I  NLN  S    +L   + N +A   + + 
Sbjct: 305 LDSIKTTSDRLQTTLAALDPILTQVQKSQIIDNLNTISANAVKLSENLGNFTAYLSDPAT 364

Query: 369 FKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNN 428
               Q+ + + R     + +    +     N           L +++   +      +++
Sbjct: 365 VVTLQQLLDSSRAAFANLQKITSDVDEITGN---------PQLRQEIIRLIQGLSRLVSS 415

Query: 429 FERNPQDIVWG 439
            E+  Q+   G
Sbjct: 416 SEQLQQEFAQG 426


>gi|170734242|ref|YP_001766189.1| hypothetical protein Bcenmc03_2908 [Burkholderia cenocepacia MC0-3]
 gi|169817484|gb|ACA92067.1| Mammalian cell entry related domain protein [Burkholderia
           cenocepacia MC0-3]
          Length = 309

 Score =  103 bits (254), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 33/176 (18%), Positives = 77/176 (43%), Gaps = 6/176 (3%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K++    GLF +++      +++W +             +    +V GL  D++VRF
Sbjct: 1   MENKSHAFWAGLFTIALTLAIAGTVFWFNVDRTV---RVPYDLLARTNVTGLFPDAAVRF 57

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G+ VG++  +  D+ +P     + L+  D P+  ST  ++  QG+ GI +++L      
Sbjct: 58  RGLDVGKVQSIGFDRTHPGQIRIRILVDHDAPITQSTYGSLGFQGVTGIAFVQL---EDT 114

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPL 176
            + +  + +     A I   PS  +      +   +++  +++    ++    +  
Sbjct: 115 GRDLAPLPSSPKAIAQIPMRPSLFDQIQERGDVLLRQLELAAKSANALMSPEMREQ 170



 Score = 41.5 bits (94), Expect = 0.32,   Method: Composition-based stats.
 Identities = 22/226 (9%), Positives = 56/226 (24%), Gaps = 2/226 (0%)

Query: 214 KNTFNTITDLITSLDKMIKAIDLQKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQT 273
           K              ++   +D            +        +   +           +
Sbjct: 64  KVQSIGFDRTHPGQIRIRILVDHDAPITQSTYGSLGFQGVTGIAFVQLEDTGRDLAPLPS 123

Query: 274 FQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNMRSSISAIREITDQRQKIISTIN 333
             +   +I    S F    +  +       +A  ++N   S     ++    + +    +
Sbjct: 124 SPKAIAQIPMRPSLFDQIQERGDVLLRQLELAAKSANALMSPEMREQLRATAESLQHAAD 183

Query: 334 TIENITSNLNDSSQKFAELMSKINNISALKENNSLFKDAQRAMHTFRDTSEKINRYIPSI 393
               +T  L  +     E M ++N   A      L +     +           +   ++
Sbjct: 184 GAATLTKQLGPAVTALPETMHEVNRAMASANT--LLQPNGPLVSNLNKAGTAAEQVGVAL 241

Query: 394 GNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFERNPQDIVWG 439
                      L     L   + +      D      RNP+ +++G
Sbjct: 242 NGLNARVQYDTLPRFNALADSVGDASRQLKDVAGELGRNPRSLLFG 287


>gi|30249903|ref|NP_841973.1| mce related protein [Nitrosomonas europaea ATCC 19718]
 gi|30180940|emb|CAD85866.1| mce related protein [Nitrosomonas europaea ATCC 19718]
          Length = 301

 Score =  102 bits (253), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 45/288 (15%), Positives = 115/288 (39%), Gaps = 10/288 (3%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++ +  + GLF++ +   +  ++ W SR +         ++   G+V GL+ ++SVR+
Sbjct: 1   MENRAHALAAGLFILLLGVATVMAVKWFSRDSV--SYNHYFLVSAGGAVSGLNPEASVRY 58

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G+ VG++  ++ D+E   + + +  +  +  L     A + +QG+ G+TYIEL+     
Sbjct: 59  RGVNVGKVEEIYFDRENIRNIIVRIAVNHNVVLPGDIYAQLASQGITGLTYIELND---- 114

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
                    E          P   +   + +++  + + +S+  I++I   + +   T I
Sbjct: 115 ----DVADAETKPLQNEARIPLRSSLIKTLSDSLEEILKNSNMAIRQISNLLNEQNQTHI 170

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
           ++I +       +   +   +     T     S+ T           +       L +  
Sbjct: 171 SSILSHLEQAVQHYDTLTGQLQKGLQTLPQLSSELTSTFKQTRQVMENTSQVLQKLNQQQ 230

Query: 241 QILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDF 288
            +++N+   S    ++   +  T   + ++     ++   ++      
Sbjct: 231 GLVDNLTQGSLEMTRTLTSLNETGVAITQSAHKLDQLLNLLEDHPQSL 278



 Score = 44.2 bits (101), Expect = 0.040,   Method: Composition-based stats.
 Identities = 25/135 (18%), Positives = 54/135 (40%), Gaps = 4/135 (2%)

Query: 308 TSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNISALKENNS 367
            SNM     +       +  I S ++ +E    + +  + +  + +  +  +S   E  S
Sbjct: 150 NSNMAIRQISNLLNEQNQTHISSILSHLEQAVQHYDTLTGQLQKGLQTLPQLS--SELTS 207

Query: 368 LFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQ--SGLNDIQNLVRKLQETVNHFDDC 425
            FK  ++ M       +K+N+    + N  Q   +    L  +      + ++ +  D  
Sbjct: 208 TFKQTRQVMENTSQVLQKLNQQQGLVDNLTQGSLEMTRTLTSLNETGVAITQSAHKLDQL 267

Query: 426 LNNFERNPQDIVWGR 440
           LN  E +PQ +V+G+
Sbjct: 268 LNLLEDHPQSLVFGK 282


>gi|85707663|ref|ZP_01038729.1| ABC-type transport system periplasmic component [Erythrobacter sp.
           NAP1]
 gi|85689197|gb|EAQ29200.1| ABC-type transport system periplasmic component [Erythrobacter sp.
           NAP1]
          Length = 315

 Score =  102 bits (253), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 43/301 (14%), Positives = 90/301 (29%), Gaps = 12/301 (3%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++  +  VG   +++L      I W++R NQ D    E  I    SV GL+  S V +
Sbjct: 1   METRANHLWVGAVTLALLAAMAAFIVWIARLNQGDVN--EYDIFYAQSVSGLAQGSQVAY 58

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQ----------GLAGIT 110
            G+PVG++V + L ++ P     +  +R + P+   TTATI++           G  G  
Sbjct: 59  AGVPVGQVVDIALSEDDPEFVRVRIRVRDEVPILIGTTATIQSSFTGVSTILLDGARGGA 118

Query: 111 YIELSTLRKEKKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIE 170
                      +    I  +      +      +   ++        +            
Sbjct: 119 PAITCDTTACPEGRPVIPPKDGGINALLNNAPLLLERLATLTENLNILLGPENQDNLRGI 178

Query: 171 NIEKPLTTTIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKM 230
                  T                  I        +    + +++T   I      L + 
Sbjct: 179 LANSNRLTNELADAAPRLEGTFAEFEIALREAGEALDAFETATRSTDQLINQEGPLLAEE 238

Query: 231 IKAIDLQKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSS 290
           ++                  +    +      T+     T +  +   + +  +     +
Sbjct: 239 LRGTLRSANEAAAALAATLEDTRPAARQLREGTLPAAEATLRDLRSTSRSLRAITEQIET 298

Query: 291 K 291
           +
Sbjct: 299 Q 299


>gi|206559097|ref|YP_002229857.1| mce related protein [Burkholderia cenocepacia J2315]
 gi|198035134|emb|CAR51008.1| mce related protein [Burkholderia cenocepacia J2315]
          Length = 309

 Score =  102 bits (253), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 41/289 (14%), Positives = 105/289 (36%), Gaps = 11/289 (3%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K++    GLF +++      +++W +             +    +V GL  D++VRF
Sbjct: 1   MENKSHAFWAGLFTIALTLAIAGTVFWFNVDRTV---RVPYDLLARTNVTGLFPDAAVRF 57

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G+ VG++  +  D+ +P     + L+  D P+  ST  ++  QG+ GI +++L      
Sbjct: 58  RGLDVGKVQSIGFDRTHPGQIRIRILVDHDAPITQSTYGSLGFQGVTGIAFVQL---EDT 114

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
            + +  + +     A I   PS  +      +   +++  +++    ++      +   +
Sbjct: 115 GRDLSPLPSSPKAIAQIPMRPSLFDQIQERGDVLLRQLELAAKSANALM---SPEMREQL 171

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
                     A+  + + K +         +  +      +             +L K  
Sbjct: 172 RATAESLQHAADGAATLTKQLGPAVTALPETMHEVNRAMASANTLMQPNGPLVSNLNKAG 231

Query: 241 QILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFS 289
              E + V+ N          +T+        +  +  +++  +  +  
Sbjct: 232 TAAEQVGVALNGLNARVQ--YDTLPRFNALADSVGDASRQLKDVAGELG 278



 Score = 41.1 bits (93), Expect = 0.35,   Method: Composition-based stats.
 Identities = 22/226 (9%), Positives = 56/226 (24%), Gaps = 2/226 (0%)

Query: 214 KNTFNTITDLITSLDKMIKAIDLQKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQT 273
           K              ++   +D            +        +   +           +
Sbjct: 64  KVQSIGFDRTHPGQIRIRILVDHDAPITQSTYGSLGFQGVTGIAFVQLEDTGRDLSPLPS 123

Query: 274 FQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNMRSSISAIREITDQRQKIISTIN 333
             +   +I    S F    +  +       +A  ++N   S     ++    + +    +
Sbjct: 124 SPKAIAQIPMRPSLFDQIQERGDVLLRQLELAAKSANALMSPEMREQLRATAESLQHAAD 183

Query: 334 TIENITSNLNDSSQKFAELMSKINNISALKENNSLFKDAQRAMHTFRDTSEKINRYIPSI 393
               +T  L  +     E M ++N   A      L +     +           +   ++
Sbjct: 184 GAATLTKQLGPAVTALPETMHEVNRAMASANT--LMQPNGPLVSNLNKAGTAAEQVGVAL 241

Query: 394 GNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFERNPQDIVWG 439
                      L     L   + +      D      RNP+ +++G
Sbjct: 242 NGLNARVQYDTLPRFNALADSVGDASRQLKDVAGELGRNPRSLLFG 287


>gi|78067710|ref|YP_370479.1| ABC transporter, periplasmic ligand binding protein [Burkholderia
           sp. 383]
 gi|77968455|gb|ABB09835.1| ABC transporter, periplasmic ligand binding protein [Burkholderia
           sp. 383]
          Length = 309

 Score =  102 bits (253), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 33/176 (18%), Positives = 77/176 (43%), Gaps = 6/176 (3%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K++    GLF +++      +++W +             +    +V GL  D++VRF
Sbjct: 1   MENKSHAFWAGLFTIALTLAIAGTVFWFNVDRTV---RVPYDLLARTNVTGLFPDAAVRF 57

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G+ VG++  +  D+ +P     + L+  D P+  ST  ++  QG+ GI +++L      
Sbjct: 58  RGLDVGKVQSIGFDRSHPGQIRIRILVDHDAPITQSTYGSLGFQGVTGIAFVQL---EDT 114

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPL 176
            + +  + +     A I   PS  +      +   +++  +++    ++    +  
Sbjct: 115 GRDLAPLPSSTKAIAQIPMRPSLFDQIQERGDVLLRQLELAAKSANALMSPEMREQ 170



 Score = 40.7 bits (92), Expect = 0.56,   Method: Composition-based stats.
 Identities = 22/226 (9%), Positives = 56/226 (24%), Gaps = 2/226 (0%)

Query: 214 KNTFNTITDLITSLDKMIKAIDLQKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQT 273
           K              ++   +D            +        +   +           +
Sbjct: 64  KVQSIGFDRSHPGQIRIRILVDHDAPITQSTYGSLGFQGVTGIAFVQLEDTGRDLAPLPS 123

Query: 274 FQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNMRSSISAIREITDQRQKIISTIN 333
             +   +I    S F    +  +       +A  ++N   S     ++    + +    +
Sbjct: 124 STKAIAQIPMRPSLFDQIQERGDVLLRQLELAAKSANALMSPEMREQLRATAESLQHAAD 183

Query: 334 TIENITSNLNDSSQKFAELMSKINNISALKENNSLFKDAQRAMHTFRDTSEKINRYIPSI 393
               +T  L  +     E M ++N   A      L +     +           +   ++
Sbjct: 184 GATTLTKQLGPAVTALPETMHEVNRAMASANT--LLQPNGPLVSNLNKAGTAAEQIGVAL 241

Query: 394 GNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFERNPQDIVWG 439
                      L     L   + +      D      RNP+ +++G
Sbjct: 242 NGLNARVQYDTLPRFNALAGSVGDASRQLKDVAGELGRNPRSLLFG 287


>gi|293602879|ref|ZP_06685318.1| ABC superfamily ATP binding cassette transporter, binding protein
           [Achromobacter piechaudii ATCC 43553]
 gi|292818673|gb|EFF77715.1| ABC superfamily ATP binding cassette transporter, binding protein
           [Achromobacter piechaudii ATCC 43553]
          Length = 167

 Score =  102 bits (253), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 26/118 (22%), Positives = 46/118 (38%), Gaps = 3/118 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQY-DGPMAEVIIRIPGSVDGLSTDSSVR 59
           M  +     VGLFV+       F        + +   P   +      +V GL   ++V+
Sbjct: 3   MSREKTDFWVGLFVLLGAVALAFLALRAGNLSTFSFAPTYTLSANF-DNVGGLKPRAAVK 61

Query: 60  FNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTL 117
             G+ VGR+  +  D +    ++    +         T+A+I T GL G  Y+ L+  
Sbjct: 62  SAGVVVGRVSSITFD-DKTFQAVVSVNLEKAYQFPKDTSASILTSGLLGEQYLGLTAG 118


>gi|119945390|ref|YP_943070.1| hypothetical protein Ping_1679 [Psychromonas ingrahamii 37]
 gi|119863994|gb|ABM03471.1| Mammalian cell entry related domain protein [Psychromonas
           ingrahamii 37]
          Length = 298

 Score =  102 bits (253), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 58/306 (18%), Positives = 113/306 (36%), Gaps = 9/306 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           MESK  YT VGLFVV ++       +WL+R +          + +  SV GL+TD++V++
Sbjct: 1   MESKINYTIVGLFVVILMTALLSITFWLTRQHG-QQSYDTYFVHLLESVAGLNTDATVKY 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G+ VG +V + L  + P        I  +T +   TTA +   G+ G+ YIEL  + KE
Sbjct: 60  RGVDVGSVVRIGLKVDNPEVVELLIKINQNTAIKTDTTAALNFYGITGLAYIELEGIDKE 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
              +  +     +  +I + PS +     +    ++K  ++  +I +++ +        +
Sbjct: 120 AALLKSV---NGEIPVIPSRPSTLRRIDQSLSKLAEKSIETLENINRLLNDKNINNVELL 176

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
                             + +    V   +  +  +       I+     ++ +      
Sbjct: 177 LFESKELLKDLRVQLKGIRTLVDNGVVMENKIAATSEKISAASIS-----VQRMADNLEK 231

Query: 241 QILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAF 300
                 Q  S     +   +   + D+   T T Q   Q I    +D   K         
Sbjct: 232 NTTGLSQEMSRGMHANFSALNLLLSDLDILTGTLQTTLQDIKDSPADLLFKRTQANPGPG 291

Query: 301 LENIAD 306
            +   +
Sbjct: 292 EDGYYE 297


>gi|78064991|ref|YP_367760.1| ABC transporter, inner membrane subunit [Burkholderia sp. 383]
 gi|77965736|gb|ABB07116.1| ABC transporter, inner membrane subunit [Burkholderia sp. 383]
          Length = 184

 Score =  102 bits (252), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 26/122 (21%), Positives = 43/122 (35%), Gaps = 1/122 (0%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M+       VGLFVV       F    +   +         +     ++ GL   ++V+ 
Sbjct: 1   MKKTALDFWVGLFVVVGFLAVLFLALKVGNMSSLSFQPTYSVKMKFDNIGGLKPRAAVKS 60

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G+ VGR+  +  D      +L    +         ++A I T GL G  YI L      
Sbjct: 61  AGVVVGRVKTIGFDTNTY-QALVTIDVDGQYQFPKDSSAKILTSGLLGEQYIGLDPGGDT 119

Query: 121 KK 122
           + 
Sbjct: 120 EM 121


>gi|73542804|ref|YP_297324.1| hypothetical protein Reut_A3120 [Ralstonia eutropha JMP134]
 gi|72120217|gb|AAZ62480.1| Mammalian cell entry related [Ralstonia eutropha JMP134]
          Length = 173

 Score =  102 bits (252), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 25/117 (21%), Positives = 43/117 (36%), Gaps = 1/117 (0%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M+       VGLFVV+      F    +   + +       +     ++ GL   + V+ 
Sbjct: 1   MKKSALDFWVGLFVVAGFVALLFLALKVGNMSAFTFQETYAVEARFDNIGGLKPRAPVKS 60

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTL 117
            G+ VGR+  +  D +    +     +         ++A I T GL G  YI L   
Sbjct: 61  AGVVVGRVAAIRFD-DKTYQATVVMNLEKQYQFPKDSSAKILTSGLLGEQYIGLEAG 116


>gi|114330859|ref|YP_747081.1| hypothetical protein Neut_0853 [Nitrosomonas eutropha C91]
 gi|114307873|gb|ABI59116.1| Mammalian cell entry related domain protein [Nitrosomonas eutropha
           C91]
          Length = 159

 Score =  102 bits (252), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 26/122 (21%), Positives = 47/122 (38%), Gaps = 1/122 (0%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M+       VGLFV++ +         +     +    + V++    ++ GL   + V+ 
Sbjct: 1   MQRTMMDFWVGLFVMAGIGALLILGLKVGNLTDFQTDKSYVLVGNFENIGGLKVRAPVKS 60

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G+ VGR+  +  D +  +       +         T A+I T GL G  YI L     E
Sbjct: 61  AGVVVGRVTDIQFDVQTYDAV-VTMKVDTRYRFPKDTFASILTSGLLGEQYIGLLPGGDE 119

Query: 121 KK 122
           + 
Sbjct: 120 EM 121


>gi|258593365|emb|CBE69704.1| putative Mce family protein [NC10 bacterium 'Dutch sediment']
          Length = 319

 Score =  102 bits (252), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 40/329 (12%), Positives = 107/329 (32%), Gaps = 15/329 (4%)

Query: 1   MESKNYY--TSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSV 58
           M  +  +    VG+FV+ +L      +  +   ++       +      +++GL+  + V
Sbjct: 1   MAEREQWMRLRVGIFVLGLLTLFIVFVLTIGSRSRIFERHYTLHA-FFSNIEGLNVGAPV 59

Query: 59  RFNGIPVGRIVGLFLDQE-YPNHSLAKALIRPDT--PLYPSTTATIRTQGLAGITYIELS 115
           R  G  VG +  +   ++           +       +   + A+I T GL G   +EL+
Sbjct: 60  RLAGTSVGSVDDITFSKDLASKKIRVTMSLDARLQDRIREDSIASIETVGLVGDKVLELT 119

Query: 116 TLRKEKKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKP 175
               +K T+   AT  +      A            +   + +++  +    + + +   
Sbjct: 120 VGSPDKPTLPPGATIASVDPPDYA---------KLLQKGDQIVNNVVKISDALNQLVGGG 170

Query: 176 LTTTIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAID 235
                 ++          +S I++         +   S N    ++D   +L ++   + 
Sbjct: 171 GAEARQDLAKGIASFNRIMSEIEQGTGLLHALVYEKRSGNILKELSDTTVALQQLAHLMK 230

Query: 236 LQKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSK 295
             +  + L ++  +          +  T  +++  +    +    +  L+ D +      
Sbjct: 231 QFQNQKGLAHVLFADPRAESIMADLDQTSKNLKSVSGRLAQGEGTLGALIDDPTLYEDLS 290

Query: 296 ETSAFLENIADSTSNMRSSISAIREITDQ 324
                        S +RS+  +   +  Q
Sbjct: 291 SLLRGANRSRILRSLIRSTRRSGAPVEPQ 319


>gi|300702839|ref|YP_003744440.1| ABC transporter periplasmic-binding protein [Ralstonia solanacearum
           CFBP2957]
 gi|299070501|emb|CBJ41796.1| putative ABC-type transporter, periplasmic binding component
           [Ralstonia solanacearum CFBP2957]
          Length = 171

 Score =  102 bits (252), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 25/118 (21%), Positives = 42/118 (35%), Gaps = 3/118 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQY-DGPMAEVIIRIPGSVDGLSTDSSVR 59
           M        VGLFV+  +    F        + +      +V      ++ GL   + V+
Sbjct: 1   MRKSLLDFWVGLFVLVGIIALLFLALKAGNMSSFSFAKTYQVRAAF-DNIGGLKVRAPVK 59

Query: 60  FNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTL 117
             G+ VGR+  +  D +    +     +         T+A I T GL G  Y+ L   
Sbjct: 60  SAGVVVGRVSQILFD-DKSYQATVVIDMDQRYQFPKDTSAKILTSGLLGEQYVGLEPG 116


>gi|300690219|ref|YP_003751214.1| ABC-type transporter periplasmic binding component [Ralstonia
           solanacearum PSI07]
 gi|299077279|emb|CBJ49905.1| putative ABC-type transporter, periplasmic binding component
           [Ralstonia solanacearum PSI07]
          Length = 172

 Score =  102 bits (252), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 25/118 (21%), Positives = 42/118 (35%), Gaps = 3/118 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQY-DGPMAEVIIRIPGSVDGLSTDSSVR 59
           M        VGLFV+  +    F        + +      +V      ++ GL   + V+
Sbjct: 1   MRKSLLDFWVGLFVLVGIIALLFLALKAGNMSSFSFAKTYQVRAAF-DNIGGLKVRAPVK 59

Query: 60  FNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTL 117
             G+ VGR+  +  D +    +     +         T+A I T GL G  Y+ L   
Sbjct: 60  SAGVVVGRVSQILFD-DKSYQATVVLDMDQRYQFPKDTSAKILTSGLLGEQYVGLEPG 116


>gi|291613161|ref|YP_003523318.1| mammalian cell entry related domain protein [Sideroxydans
           lithotrophicus ES-1]
 gi|291583273|gb|ADE10931.1| Mammalian cell entry related domain protein [Sideroxydans
           lithotrophicus ES-1]
          Length = 153

 Score =  102 bits (252), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 32/123 (26%), Positives = 47/123 (38%), Gaps = 3/123 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYD-GPMAEVIIRIPGSVDGLSTDSSVR 59
           ME       VG+FVV+ +         +   + Y+     ++      +V GL   +SVR
Sbjct: 1   MERTTLDLWVGVFVVAGIAALVVLALKVGNLSTYNVSESYQLQAHFT-NVGGLKPTASVR 59

Query: 60  FNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRK 119
             G+ VGR+  + LD      +     I         T A I T GL G  YI L     
Sbjct: 60  SAGVLVGRVTSIVLDTNSYE-ARVTMSIDKRYQFPKDTFANILTSGLLGEQYIGLVPGGD 118

Query: 120 EKK 122
           +K 
Sbjct: 119 DKM 121


>gi|91774595|ref|YP_544351.1| hypothetical protein Mfla_0239 [Methylobacillus flagellatus KT]
 gi|91708582|gb|ABE48510.1| Mammalian cell entry related protein [Methylobacillus flagellatus
           KT]
          Length = 164

 Score =  102 bits (252), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 29/122 (23%), Positives = 44/122 (36%), Gaps = 1/122 (0%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME       VG+FV + +   F     +   N         +     ++  L   + V+ 
Sbjct: 1   MERTTIDLWVGVFVAAGIAALFGLALKVGNFNSATLGETYSVTGAFENIGSLKPRAPVKS 60

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G+ VGR+  +  D E    +L    +    P    T A I T GL G  YI L     +
Sbjct: 61  AGVVVGRVDAIRFDPETYE-ALVTVKVDKRYPFPKDTFANIYTAGLLGEQYIGLEAGGDD 119

Query: 121 KK 122
           K 
Sbjct: 120 KM 121


>gi|300313363|ref|YP_003777455.1| organic solvents resistance ABC transporter periplasmic protein
           [Herbaspirillum seropedicae SmR1]
 gi|300076148|gb|ADJ65547.1| ABC-type transport system involved in resistance to organic
           solvents, periplasmic component protein [Herbaspirillum
           seropedicae SmR1]
          Length = 158

 Score =  102 bits (252), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 28/154 (18%), Positives = 56/154 (36%), Gaps = 4/154 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQ--YDGPMAEVIIRIPGSVDGLSTDSSV 58
           M+ K+    VG+FV+  +    F        +   +      +      ++ GL + ++V
Sbjct: 1   MQRKSLDAWVGIFVLLGVAALVFLALKAGNMSSMSFGQKTYTIKASF-DNIGGLKSRAAV 59

Query: 59  RFNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLR 118
           +  G+ VGR+  +  D +    ++    +         ++A I T GL G  YI +    
Sbjct: 60  KSAGVVVGRVDSIRFD-DQTFRAVVSLNMDESYKFPKDSSAKILTSGLLGEQYIGIEPGG 118

Query: 119 KEKKTIFQIATERNQRAMITATPSGINYFISNAE 152
                      +  Q A++     G   +   AE
Sbjct: 119 DTANLASGDTIKMTQSAIVLENLIGQFLYSKAAE 152


>gi|172059408|ref|YP_001807060.1| hypothetical protein BamMC406_0343 [Burkholderia ambifaria MC40-6]
 gi|171991925|gb|ACB62844.1| Mammalian cell entry related domain protein [Burkholderia ambifaria
           MC40-6]
          Length = 187

 Score =  102 bits (252), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 28/123 (22%), Positives = 46/123 (37%), Gaps = 3/123 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQY-DGPMAEVIIRIPGSVDGLSTDSSVR 59
           M+       VGLFVV       F    +   +     P   V ++   ++ GL   ++V+
Sbjct: 1   MKKTALDFWVGLFVVVGFLAVLFLALKVGNMSSLSFQPTYSVRMKF-DNIGGLKPRAAVK 59

Query: 60  FNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRK 119
             G+ VGR+  +  D      +L    +         ++A I T GL G  YI L     
Sbjct: 60  SAGVVVGRVKAIGFDTNTY-QALVTIDVDGQYQFPKDSSAKILTSGLLGEQYIGLDPGGD 118

Query: 120 EKK 122
            + 
Sbjct: 119 TEM 121


>gi|325998311|gb|ADZ50519.1| putative ABC transporter periplasmic substrate-binding protein
           [Helicobacter pylori 2017]
          Length = 271

 Score =  102 bits (252), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 22/111 (19%), Positives = 45/111 (40%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME    YT +G      L      I WL      DG   E ++     + G++T+S + +
Sbjct: 1   MERHVNYTLIGGLFFLCLVCMVGFILWLGPLGFDDGEDYEYVVYTDKDLGGIATNSPINY 60

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITY 111
            GI VG ++ +   ++         +I+    +   +   + ++G  G+ +
Sbjct: 61  KGIQVGNVIKVGFAKDKVGVVRLDLMIKSSVKIRKDSKVAVSSRGFMGLKF 111


>gi|317485265|ref|ZP_07944146.1| hypothetical protein HMPREF0179_01499 [Bilophila wadsworthia 3_1_6]
 gi|316923556|gb|EFV44761.1| hypothetical protein HMPREF0179_01499 [Bilophila wadsworthia 3_1_6]
          Length = 147

 Score =  102 bits (252), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 28/129 (21%), Positives = 48/129 (37%), Gaps = 3/129 (2%)

Query: 5   NYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRFNGIP 64
           +   +VG FV+  L    +    L R   +      +      SV GL   + V   G+ 
Sbjct: 4   SKEAAVGFFVMLGLVCVAYLTVKLGRMEVFHSEGYVLTASF-NSVSGLRPGAEVEIAGVR 62

Query: 65  VGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKEKKTI 124
           VGR+  + LD + P     +  +  +  L     A+++T GL G  YI L       + +
Sbjct: 63  VGRVKSIRLDDKQPRAV-VELQLGDNVHLTDDVIASVKTSGLIGDKYISLEPGGS-GEPL 120

Query: 125 FQIATERNQ 133
                  + 
Sbjct: 121 KNGDEITDT 129


>gi|167585310|ref|ZP_02377698.1| ABC transporter, periplasmic ligand binding protein [Burkholderia
           ubonensis Bu]
          Length = 308

 Score =  101 bits (251), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 33/176 (18%), Positives = 76/176 (43%), Gaps = 6/176 (3%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K++    GLF +++      +++W +             +    +V GL  D++VRF
Sbjct: 1   MENKSHAFWAGLFTIALTLAIAGAVFWFNVDRAV---RIPYDLIARTNVTGLFPDAAVRF 57

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G+ VG++  +  D+  P     + L+  D P+  ST  ++  QG+ GI +++L     +
Sbjct: 58  RGLDVGKVQSIGFDRSRPGQIRIRILVDKDAPITQSTFGSLGFQGVTGIAFVQLDDTGTD 117

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPL 176
              +    +     A I   PS  +      +   +++  +++   +++    +  
Sbjct: 118 LSPL---PSSVKAVAQIPMHPSLFDQIQQRGDVLLRQLELAAKSANELMSPEMREQ 170



 Score = 37.2 bits (83), Expect = 5.8,   Method: Composition-based stats.
 Identities = 22/178 (12%), Positives = 53/178 (29%), Gaps = 20/178 (11%)

Query: 280 KIDHLLSDFSSKMKSKETSAFLENIADSTSNMRSSISAIREITDQRQKIISTINTIENIT 339
           ++D   +D S    S +  A +         ++     +    +   K  + + +   + 
Sbjct: 110 QLDDTGTDLSPLPSSVKAVAQIPMHPSLFDQIQQRGDVLLRQLELAAKSANELMSP-EMR 168

Query: 340 SNLNDSSQKFAELMSKINNIS-----ALKENNSLFKDAQRAMHTFRDTSE-------KIN 387
             L  +++           +S     A+        +  RAM +     +        +N
Sbjct: 169 EQLRATAESLQHAADGAATLSKQLGPAVAALPGTMHEVNRAMASANSLLQPNGPLIANLN 228

Query: 388 RY---IPSIGNNLQNFSQS----GLNDIQNLVRKLQETVNHFDDCLNNFERNPQDIVW 438
           +       IG+ L   +       L     L   + +      D      RNP+ +++
Sbjct: 229 KAGTAAEHIGDALNELNARVQYDTLPRFNALAASVGDASRQLKDVAGELGRNPRSLLF 286


>gi|238918532|ref|YP_002932046.1| hypothetical protein NT01EI_0582 [Edwardsiella ictaluri 93-146]
 gi|238868100|gb|ACR67811.1| conserved hypothetical protein [Edwardsiella ictaluri 93-146]
          Length = 177

 Score =  101 bits (251), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 28/136 (20%), Positives = 53/136 (38%), Gaps = 2/136 (1%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M++K     VGLF++  L  + F    ++            +     +V GL   S V+ 
Sbjct: 1   MQTKKAEVWVGLFMLIALCAAIFLCLQVANVKSLGSAPTYRLYATFDNVGGLKARSPVKI 60

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDT-PLYPSTTATIRTQGLAGITYIELSTLRK 119
            G+ +GR+  + LD +          I      +  +++  IRT GL G  Y+ L+   +
Sbjct: 61  GGVVIGRVAEISLDPQTY-LPRVAMDIDRRYNHIPDTSSLAIRTSGLLGEQYLALNVGFE 119

Query: 120 EKKTIFQIATERNQRA 135
           + +    I  +     
Sbjct: 120 DPEMGTAILKDGGTIQ 135


>gi|108801579|ref|YP_641776.1| virulence factor MCE-like protein [Mycobacterium sp. MCS]
 gi|119870733|ref|YP_940685.1| virulence factor Mce family protein [Mycobacterium sp. KMS]
 gi|108771998|gb|ABG10720.1| Mammalian cell entry [Mycobacterium sp. MCS]
 gi|119696822|gb|ABL93895.1| virulence factor Mce family protein [Mycobacterium sp. KMS]
          Length = 344

 Score =  101 bits (251), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 40/308 (12%), Positives = 96/308 (31%), Gaps = 6/308 (1%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M+ +    +VG+F V++L  +   +          G               L     VR 
Sbjct: 1   MKREGNLLNVGIFTVAMLLVAAMLVVVFGEFRFASGNSYH--ANFTE-ASRLKAGQDVRI 57

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G+PVG +  + L+ +          +     LY ST A +R + L G  Y+E+ +   E
Sbjct: 58  AGVPVGTVTDIKLNDDNT--VDVAFDVHNKYQLYTSTRAVVRYENLVGDRYLEIISGPGE 115

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
            + +   +T   Q          +   +            +      +IE ++       
Sbjct: 116 LRKLPPGSTIPKQNTQPALDLDALLGGLRPVLKGLDGAKVNEL-SSAVIELLQGQGGALA 174

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
             + T  +   N  +    +            + +      D      + +     Q  +
Sbjct: 175 NLLATTGSFSQNLAARDQLIGDVITNLNTVLGTVDEKGAQFDASVDRLQQLITGLAQGRD 234

Query: 241 QILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAF 300
            I   I+  +      ++ +  +   ++   +  + + Q++D   +D +  ++    +  
Sbjct: 235 PIAGAIEPLAAAENDLTEMLKASRRPLQGVIENARPLAQRLDERKADVNKVIEPLAENYL 294

Query: 301 LENIADST 308
             N   + 
Sbjct: 295 RLNALGAY 302


>gi|95928282|ref|ZP_01311030.1| Mammalian cell entry related [Desulfuromonas acetoxidans DSM 684]
 gi|95135553|gb|EAT17204.1| Mammalian cell entry related [Desulfuromonas acetoxidans DSM 684]
          Length = 148

 Score =  101 bits (251), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 30/121 (24%), Positives = 50/121 (41%), Gaps = 2/121 (1%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M+  N    VGLF++       +    L   + +D     V  R  GSV GL   +SV+ 
Sbjct: 1   MKRFNLEIVVGLFMLLGFASVVYLSVKLGDVSLFDNDHYRVKARF-GSVSGLKLGASVQI 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G+ +G++  + LD +  +       I+    L     A++RT G+ G  YI +      
Sbjct: 60  GGVDIGKVATISLDPKSYDAV-VALDIKNGIELQDDCIASVRTSGIIGDRYISILPGGSP 118

Query: 121 K 121
            
Sbjct: 119 M 119


>gi|34558308|ref|NP_908123.1| ABC transporter permease [Wolinella succinogenes DSM 1740]
 gi|34484027|emb|CAE11023.1| conserved hypothetical protein-Permease component of an
           ABC-transporter [Wolinella succinogenes]
          Length = 298

 Score =  101 bits (251), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 30/117 (25%), Positives = 54/117 (46%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++  YT VG F ++ +      ++W+ R  +         +       G+   + VRF
Sbjct: 1   MENRLSYTLVGGFFIACMVAMALFVWWIGRYGEDREAYRPYYLLTKELQSGIKKQTPVRF 60

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTL 117
            GIPVG + G    +E+      +  +  + P+   + A I +QGL+GI+YI +   
Sbjct: 61  QGIPVGFVRGFDFSKEHSGWIEIELWVEQEIPIKRDSLAVIESQGLSGISYIAIKQG 117


>gi|149925792|ref|ZP_01914056.1| Mammalian cell entry related protein [Limnobacter sp. MED105]
 gi|149825909|gb|EDM85117.1| Mammalian cell entry related protein [Limnobacter sp. MED105]
          Length = 157

 Score =  101 bits (251), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 22/116 (18%), Positives = 40/116 (34%), Gaps = 1/116 (0%)

Query: 2   ESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRFN 61
           ++      VGLFV+       F        + +       +     ++ GL   + V+  
Sbjct: 3   KNTAVDFWVGLFVLIGALALVFLALKAGNLSSFTTGDQYRVTAEFDNIGGLKPRAPVKSA 62

Query: 62  GIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTL 117
           G+ VGR+  + LD            +         ++A I T GL G  Y+ +   
Sbjct: 63  GVTVGRVANINLDPVTFRAV-VALDLEEGFEFPKDSSARILTSGLLGEQYVGIEAG 117


>gi|187927278|ref|YP_001897765.1| Mammalian cell entry related domain-containing protein [Ralstonia
           pickettii 12J]
 gi|309780022|ref|ZP_07674775.1| signal peptide protein [Ralstonia sp. 5_7_47FAA]
 gi|187724168|gb|ACD25333.1| Mammalian cell entry related domain protein [Ralstonia pickettii
           12J]
 gi|308921192|gb|EFP66836.1| signal peptide protein [Ralstonia sp. 5_7_47FAA]
          Length = 322

 Score =  101 bits (251), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 46/325 (14%), Positives = 115/325 (35%), Gaps = 6/325 (1%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K +    GLF + ++ F   ++ W +R      P     +    +V+GL+  +SV++
Sbjct: 1   MENKAHAFLAGLFTIGLIIFIGLAVMWFNRDQTVRLP---YDVVTRSTVNGLNPQASVKY 57

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G+ VG++  +  D + P   + + L+  D P+  +T   +  QG+ G+ Y++L     +
Sbjct: 58  RGLDVGKVDSIRFDDKVPGQIVVRVLVDKDAPITTTTYGRLAYQGVTGLAYVQLDDRGFD 117

Query: 121 KKTIFQIAT---ERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLT 177
                         ++        +G    +    +      D + +   I+ + E    
Sbjct: 118 NSKRAPSPVRLATSDKDPARIRMEAGFLDELDKRGDQMLSKLDQTLNSLSIMFDDEHRQQ 177

Query: 178 TTIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQ 237
            T +      T+ A +           ++   + +  +T      L  SL      +   
Sbjct: 178 VTASLQSFQKTMDAYSTLAQQAEPTMRRLPQIADNLDSTLVATRKLTQSLSDPKGPLMST 237

Query: 238 KVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKET 297
                 +    + +    ++     T+  +    +  ++  +  DH ++DF+++ +S   
Sbjct: 238 LSGAGTDLTAATQSMQSAANVLTYETLPQLNGFAREARQAVRGFDHAVTDFNARPQSVLF 297

Query: 298 SAFLENIADSTSNMRSSISAIREIT 322
                      +   +  +      
Sbjct: 298 GPAPGAPDPGETGFTAPAARASAQP 322



 Score = 47.2 bits (109), Expect = 0.005,   Method: Composition-based stats.
 Identities = 27/172 (15%), Positives = 61/172 (35%), Gaps = 12/172 (6%)

Query: 268 RETTQTFQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNMRSSISAIREITDQRQK 327
           R       E+ ++ D +LS     + S       E+    T++++S    +   +   Q+
Sbjct: 139 RMEAGFLDELDKRGDQMLSKLDQTLNSLSIMFDDEHRQQVTASLQSFQKTMDAYSTLAQQ 198

Query: 328 IISTINTIENITSNLNDSSQKFAELMSKINNISALKENNSLFKDAQRAMHTFRDTSEKIN 387
              T+  +  I  NL+ +     +L   +++                 M T       + 
Sbjct: 199 AEPTMRRLPQIADNLDSTLVATRKLTQSLSDPKG------------PLMSTLSGAGTDLT 246

Query: 388 RYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFERNPQDIVWG 439
               S+ +     +   L  +    R+ ++ V  FD  + +F   PQ +++G
Sbjct: 247 AATQSMQSAANVLTYETLPQLNGFAREARQAVRGFDHAVTDFNARPQSVLFG 298


>gi|220933919|ref|YP_002512818.1| Mammalian cell entry related domain protein [Thioalkalivibrio sp.
           HL-EbGR7]
 gi|219995229|gb|ACL71831.1| Mammalian cell entry related domain protein [Thioalkalivibrio sp.
           HL-EbGR7]
          Length = 152

 Score =  101 bits (251), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 30/130 (23%), Positives = 52/130 (40%), Gaps = 2/130 (1%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M ++    +VG+FV   +   F     +S  ++Y       +     ++ GL   + V  
Sbjct: 1   MTTRTIEITVGIFVALGVAALFMLAMQVSNISEYRNSDGYTVSAYFTNIGGLKVRAPVTV 60

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTP-LYPSTTATIRTQGLAGITYIELSTLRK 119
           +G+ VGR+  +  D E    +  +  I  D   L   T A+I T GL G  YI L    +
Sbjct: 61  SGVRVGRVTAIRYDPERY-QARVEITIGADHDYLPTDTQASIYTAGLLGEQYIALEPGGE 119

Query: 120 EKKTIFQIAT 129
           ++        
Sbjct: 120 DEVLAQGGEI 129


>gi|187479776|ref|YP_787801.1| virulence protein transporter [Bordetella avium 197N]
 gi|115424363|emb|CAJ50916.1| putative virulence protein transporter [Bordetella avium 197N]
          Length = 162

 Score =  101 bits (251), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 24/128 (18%), Positives = 49/128 (38%), Gaps = 3/128 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQY-DGPMAEVIIRIPGSVDGLSTDSSVR 59
           M  +     VGLFV+       F        + +   P  E+      ++ GL   + V+
Sbjct: 1   MSREKTDFWVGLFVLLGALSLIFLALRAGNLSSFSFTPTYELTADF-DNIGGLKVRAPVK 59

Query: 60  FNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRK 119
             G+ VGR+  +  + +    ++    +         ++A+I T GL G  YI ++   +
Sbjct: 60  SAGVVVGRVSNISFN-DQTFQAVVTMKLETPFKFPSDSSASILTSGLLGEQYIGVTPGSE 118

Query: 120 EKKTIFQI 127
           ++      
Sbjct: 119 DENFADGG 126


>gi|109948192|ref|YP_665420.1| ABC transport system substrate-binding protein [Helicobacter
           acinonychis str. Sheeba]
 gi|109715413|emb|CAK00421.1| ABC transport system substrate-binding protein [Helicobacter
           acinonychis str. Sheeba]
          Length = 271

 Score =  101 bits (251), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 28/123 (22%), Positives = 50/123 (40%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME    YT +G      L F    I WL      DG     ++     + G++T+S + +
Sbjct: 1   MERHVNYTLIGGLFFLCLIFMVGFILWLGHVGLDDGKYHRYVVYTDKDLGGIATNSPISY 60

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            GI VG +V +   ++         +I+    +   +   + +QGL G+ Y+ L     E
Sbjct: 61  KGIQVGNVVKVGFAKDKVGVVRLDLMIKNSVKIRKDSKVVVSSQGLMGLKYLSLEQSHNE 120

Query: 121 KKT 123
           +  
Sbjct: 121 EFY 123


>gi|264676424|ref|YP_003276330.1| periplasmic protein [Comamonas testosteroni CNB-2]
 gi|262206936|gb|ACY31034.1| putative periplasmic protein [Comamonas testosteroni CNB-2]
          Length = 315

 Score =  101 bits (250), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 34/128 (26%), Positives = 64/128 (50%), Gaps = 3/128 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K++  + G+FV+ +         WL+R N+         +     V GL   ++VR+
Sbjct: 1   MENKSHAMAAGIFVLVVATLLAGLAVWLTRDNR---EYQLYEMSTKDGVSGLQPQATVRY 57

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G+PVG++V +  D +   + L +  +  DTP+ P+T A +  QG+ G+ +I+L    K 
Sbjct: 58  KGVPVGKVVRIGFDPQISGNVLIRIAVGEDTPVTPATYAQLGYQGVTGLAHIQLDDDSKS 117

Query: 121 KKTIFQIA 128
            + +    
Sbjct: 118 SQPLKPGP 125



 Score = 44.5 bits (102), Expect = 0.037,   Method: Composition-based stats.
 Identities = 20/170 (11%), Positives = 52/170 (30%), Gaps = 12/170 (7%)

Query: 273 TFQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNMRSSISAIREITDQRQKIISTI 332
               +  +   LL       +   +    +N    +  + +  +A   I D  + +  T 
Sbjct: 137 PLNMLADQGPVLLERVDEISRRLNSMLGEDNQKRVSVALDNIAAASGGIKDLAETMNKTA 196

Query: 333 NTIENITSNLNDSSQKFAELMSKINNISALKENNSLFKDAQRAMHTFRDT---SEKINRY 389
                IT++ + + Q   +  +             +  D Q+ +          ++I   
Sbjct: 197 KDFPQITADAHQTLQSLTKAGNA---------ATGVATDLQQTVRKVNAPDGPLQQIAEG 247

Query: 390 IPSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFERNPQDIVWG 439
             ++    ++  +S L  +      +             F  NPQ +++G
Sbjct: 248 TQALSQAAESLGRSTLPRMNGAADDVSRAARSMGAAAGRFNDNPQSVIYG 297


>gi|206603560|gb|EDZ40040.1| Putative ABC transporter [Leptospirillum sp. Group II '5-way CG']
          Length = 518

 Score =  101 bits (250), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 49/392 (12%), Positives = 115/392 (29%), Gaps = 58/392 (14%)

Query: 7   YTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRFNGIPVG 66
              +G F+V  +  +          +        +      SVDGL   ++VR  G+ VG
Sbjct: 6   EAKLGFFIVVAILVAVGLTLRFGHFHLTPKGSYRIYADF-RSVDGLEKGTAVRIAGVRVG 64

Query: 67  RIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKEKKTIFQ 126
            +  + L       +  + +I     L       I + G  G  YIEL   +  K  I +
Sbjct: 65  EVTDITL--RSSGMAHVEMMIFDGLKLPADIHPVIFSNGFLGKLYIELVPGKSAKPIIRK 122

Query: 127 IATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTIANIETI 186
                  R     + S +++                                        
Sbjct: 123 NQFFPTHRNGQEQSGSYLSFSWFL------------------------------------ 146

Query: 187 STVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVNQILENI 246
                         + +    P    +  +  T         + + +         L   
Sbjct: 147 ------PFPAWGDPLPSQPGAPVPGPALPSSKTEDPGYVQPGQTLASPGETVSVNRLVRK 200

Query: 247 QVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAFLENIAD 306
                + +K+    +      ++ T+  ++    +  L  +            F +N+ D
Sbjct: 201 LNRIADDIKAITGALRRAMGNQKGTEDLKKTLDNLKVLTDNLRE---------FTKNLKD 251

Query: 307 STSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINN----ISAL 362
            +  +   + +I    DQ    +  +   +++   ++ ++     +++KI++    I  L
Sbjct: 252 KSPAILKKVDSIATKIDQGVGTVGQLVNNKDLYKKVDSAAGHLDSILAKIDSGQGTIGQL 311

Query: 363 KENNSLFKDAQRAMHTFRDTSEKINRYIPSIG 394
             N  L+ +    +  F D S K ++ +  + 
Sbjct: 312 VNNPDLYNNLNATLKKFSDLSHKSDQMVLDVS 343


>gi|238028750|ref|YP_002912981.1| Mce-like protein [Burkholderia glumae BGR1]
 gi|237877944|gb|ACR30277.1| Mce related protein [Burkholderia glumae BGR1]
          Length = 316

 Score =  101 bits (250), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 31/128 (24%), Positives = 59/128 (46%), Gaps = 3/128 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K++    GLF + +L      ++W +       P     +    +V GL  D+ VR+
Sbjct: 1   MENKSHAFWAGLFAIGLLLAIVAVVFWFNVDRTVRIP---YDLVARTNVTGLYPDADVRY 57

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G+ VG++  +  D  +P     + L+  D P+  ST  T+  QG+ GI +++L     +
Sbjct: 58  RGLDVGKVASIHFDHAHPGEISIRILVDHDAPITRSTFGTLGFQGVTGIAFVQLDDTGHD 117

Query: 121 KKTIFQIA 128
              +   +
Sbjct: 118 LAPLPSSS 125



 Score = 51.1 bits (119), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 22/180 (12%), Positives = 62/180 (34%), Gaps = 4/180 (2%)

Query: 265 HDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNMRSSISAIREITDQ 324
               +            D L       +K  E +A   N   S        + +  +   
Sbjct: 122 PSSSKAVAQIPLHPSLFDQLQQRGDVLLKQFEVAASSVNALLSPEMREQLRATVASMQQA 181

Query: 325 RQKIISTINTIENITSNLNDSSQKFAELMSKINNISALKENNSL-FKDAQRAMHTFRDTS 383
              + +   ++E +T+ L +++++    ++  + + A     ++    A +A        
Sbjct: 182 ADGVTTLTRSLEPVTAQLPETTRRLNRALASADALIAPNGPVAVNLDRAGKAAEQAGTAL 241

Query: 384 EKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFERNPQDIVWGREKG 443
             +++ +  +  +++      L  + +L   L +T     +      RNP+ +++G   G
Sbjct: 242 ASMDQTLSELNASVR---YETLPRVNSLSSNLGDTSRTVREVAGEIGRNPRSLLFGTSAG 298


>gi|269137864|ref|YP_003294564.1| hypothetical protein ETAE_0506 [Edwardsiella tarda EIB202]
 gi|267983524|gb|ACY83353.1| conserved hypothetical protein [Edwardsiella tarda EIB202]
 gi|304557917|gb|ADM40581.1| Uncharacterized ABC transporter, periplasmic component YrbD
           [Edwardsiella tarda FL6-60]
          Length = 177

 Score =  101 bits (250), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 28/136 (20%), Positives = 53/136 (38%), Gaps = 2/136 (1%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M++K     VGLF++  L  + F    ++            +     +V GL   S V+ 
Sbjct: 1   MQTKKAEVWVGLFMLIALCAAVFLCLQVANVKSLGSEPTYRLYATFDNVGGLKARSPVKI 60

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDT-PLYPSTTATIRTQGLAGITYIELSTLRK 119
            G+ +GR+  + LD +          I      +  +++  IRT GL G  Y+ L+   +
Sbjct: 61  GGVVIGRVAEISLDPQTY-LPRVAMDIDQRYNHIPDTSSLAIRTSGLLGEQYLALNVGFE 119

Query: 120 EKKTIFQIATERNQRA 135
           + +    I  +     
Sbjct: 120 DPEMGTAILKDGGTIQ 135


>gi|113866163|ref|YP_724652.1| ABC-type transporter, periplasmic component [Ralstonia eutropha
           H16]
 gi|113524939|emb|CAJ91284.1| ABC-type transporter, periplasmic component [Ralstonia eutropha
           H16]
          Length = 313

 Score =  101 bits (250), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 40/296 (13%), Positives = 102/296 (34%), Gaps = 11/296 (3%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K++    G+F + +     F+I+W S  +          +    +V+GL     V++
Sbjct: 2   MENKSHAFLAGVFTIGLAVLVLFAIFWFSTDHAV---RVPYDLITRSTVNGLQPQGDVKY 58

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G+ VG++  +  D + P   + +  +  DTP+  +T  T+  QG+ GI Y++L      
Sbjct: 59  RGLAVGKVESIKFDPQVPGQIIVRVNVNKDTPITRTTYGTLGFQGVTGIAYVQLDDSATH 118

Query: 121 KKTIFQIATERNQR------AMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEK 174
             T        + +                    S        ++  +   Q        
Sbjct: 119 DGTTASPPLPTSPKAVARIAMRPGFFEELEKRGDSLLTQVETMMASLNDMFQGANRAELM 178

Query: 175 PLTTTIANIETISTVLANNISHIDKMMHTTQVTPHS--SDSKNTFNTITDLITSLDKMIK 232
               ++       + L++++      +       ++    ++     + +   ++ + + 
Sbjct: 179 AAIRSVRKTAEDYSRLSDSLGPAANRLPKVTENLNATLESTRRLTQELANPNGTVMRTVD 238

Query: 233 AIDLQKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDF 288
           ++              +     ++  Q+     D R+T +TF+    + +   S  
Sbjct: 239 SVGRDLQGAASSVQSAAGTFSEETLPQLNGLARDARQTARTFERAAGQFNESPSSV 294


>gi|329913018|ref|ZP_08275866.1| Uncharacterized ABC transporter, periplasmic component YrbD
           [Oxalobacteraceae bacterium IMCC9480]
 gi|327545455|gb|EGF30662.1| Uncharacterized ABC transporter, periplasmic component YrbD
           [Oxalobacteraceae bacterium IMCC9480]
          Length = 157

 Score =  101 bits (250), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 27/118 (22%), Positives = 45/118 (38%), Gaps = 3/118 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQY-DGPMAEVIIRIPGSVDGLSTDSSVR 59
           M+ K+    VGLFV+      FF        +         V +R   ++ GL   + V+
Sbjct: 1   MQRKSLDLWVGLFVLLGAAALFFLAMKAGNLSSLSFAQTYPVTMRF-DNIGGLKPRAPVK 59

Query: 60  FNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTL 117
             G+ VGR+  +  + +    +     +         ++A I T GL G  YI L   
Sbjct: 60  SAGVVVGRVADIAFN-DQRFQASVTVNMETRYKFPKDSSAKILTSGLLGEQYIGLEPG 116


>gi|134297085|ref|YP_001120820.1| hypothetical protein Bcep1808_2994 [Burkholderia vietnamiensis G4]
 gi|134140242|gb|ABO55985.1| Mammalian cell entry related domain protein [Burkholderia
           vietnamiensis G4]
          Length = 309

 Score =  101 bits (250), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 33/176 (18%), Positives = 78/176 (44%), Gaps = 6/176 (3%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K++    GLF +++      +++W +             +    +V GL  D++VRF
Sbjct: 1   MENKSHAFWAGLFTIALTLAIAGTVFWFNVDRTV---RVPYDLLARTNVTGLFPDAAVRF 57

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G+ VG++  +  D+ +P     + L+  D P+  ST  ++  QG+ GI +++L      
Sbjct: 58  RGLDVGKVQSIGFDRTHPGQIRIRILVDHDAPITQSTYGSLGFQGVTGIAFVQL---EDT 114

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPL 176
            + +  + +     A I   PS  +      +   +++  +++   +++    +  
Sbjct: 115 GRDLAPLPSSSKSIAQIPMRPSLFDQIQERGDVLLRQLEQAAKSANELMSPEMRAQ 170



 Score = 40.7 bits (92), Expect = 0.55,   Method: Composition-based stats.
 Identities = 20/176 (11%), Positives = 44/176 (25%), Gaps = 11/176 (6%)

Query: 265 HDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNMRSSISAIREITDQ 324
               ++           D +       ++  E +A   N   S       ++    +   
Sbjct: 122 PSSSKSIAQIPMRPSLFDQIQERGDVLLRQLEQAAKSANELMSPEMRAQLLATAASLQHA 181

Query: 325 RQKIISTINTIENITSNLNDSSQKFAELMSKINNISALKE-NNSLFKDAQRAMHTFRDTS 383
                +    +E   + L D+  +    M+  N +        +    A  A        
Sbjct: 182 ADGAAALSKQLEPAVAALPDTMHQVDRAMASANTLLQPNGPLVANLNKAGSAAEQVGVAL 241

Query: 384 EKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFERNPQDIVWG 439
             +N  +              L     L   + +      D      RNP  +++G
Sbjct: 242 NDLNARVQ----------YDTLPRFNALAGSVGDASRQLKDVAGELGRNPSSLLFG 287


>gi|167587706|ref|ZP_02380094.1| ABC transporter, periplasmic substrate-binding protein
           [Burkholderia ubonensis Bu]
          Length = 175

 Score =  101 bits (250), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 25/117 (21%), Positives = 42/117 (35%), Gaps = 1/117 (0%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M+       VGLFVV       F    +   +         +     ++ GL   ++V+ 
Sbjct: 3   MKKTALDFWVGLFVVVGFLAVLFLALKVGNMSSLSLQPTYAVKMKFDNIGGLKPRAAVKS 62

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTL 117
            G+ VGR+  +  D      +L    +         ++A I T GL G  Y+ L   
Sbjct: 63  AGVVVGRVQAIGFDTNTY-QALVTIDLDKQYQFPKDSSAKILTSGLLGEQYVGLEPG 118


>gi|261344895|ref|ZP_05972539.1| toluene tolerance ABC transporter, periplasmic substrate-binding
           protein [Providencia rustigianii DSM 4541]
 gi|282567035|gb|EFB72570.1| toluene tolerance ABC transporter, periplasmic substrate-binding
           protein [Providencia rustigianii DSM 4541]
          Length = 170

 Score =  101 bits (250), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 29/134 (21%), Positives = 54/134 (40%), Gaps = 2/134 (1%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M+SK     VG F++  +    F    ++            +     +V GL   S V+ 
Sbjct: 1   MQSKKSEIWVGCFMLLAIAAIVFLCLKVADLKSIGSQSTYQVSAPFENVGGLKVGSPVKV 60

Query: 61  NGIPVGRIVGLFLDQEYPN-HSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRK 119
            G+ +GR+  + LD++          L   D  +  S++ +IRT GL G  YI ++    
Sbjct: 61  GGVVIGRVASISLDKKNYVPEVKIDLLSEYD-NIPDSSSLSIRTSGLLGEQYIAMNIGPD 119

Query: 120 EKKTIFQIATERNQ 133
           ++     I  +  +
Sbjct: 120 DEDMGIAILKDGGR 133


>gi|299065475|emb|CBJ36644.1| putative ABC-type transporter, periplasmic binding component
           [Ralstonia solanacearum CMR15]
          Length = 173

 Score =  101 bits (250), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 25/118 (21%), Positives = 42/118 (35%), Gaps = 3/118 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQY-DGPMAEVIIRIPGSVDGLSTDSSVR 59
           M        VGLFV+  L    F        + +      +V      ++ GL   + V+
Sbjct: 1   MRKSLLDFWVGLFVLVGLIALLFLALKAGNMSAFSFAKTYQVRAAF-DNIGGLKVRAPVK 59

Query: 60  FNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTL 117
             G+ VGR+  +  D +    +     +         ++A I T GL G  Y+ L   
Sbjct: 60  SAGVVVGRVSQILFD-DKSYQATVVLDMDQRYQFPKDSSAKILTSGLLGEQYVGLEPG 116


>gi|289549156|ref|YP_003474144.1| hypothetical protein Thal_1386 [Thermocrinis albus DSM 14484]
 gi|289182773|gb|ADC90017.1| Mammalian cell entry related domain protein [Thermocrinis albus DSM
           14484]
          Length = 515

 Score =  101 bits (250), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 41/294 (13%), Positives = 86/294 (29%), Gaps = 5/294 (1%)

Query: 5   NYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRFNGIP 64
           +    VGL VV +     F I        +        +     V GLS  S VR  GI 
Sbjct: 4   SNEAKVGLLVVIVAMSLAFVILIFGEIPFFKPATKTYRVYF-DDVAGLSKGSEVRVAGIK 62

Query: 65  VGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKEKKTI 124
            G +  + L             +  D  LY + TA I T GL G  Y+ +     E   +
Sbjct: 63  SGTVKSVRL---KDGKVEVVLEVYRDVTLYRNATAYIGTLGLMGDKYLSVDPGTPEAGVL 119

Query: 125 FQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTIANIE 184
            +    R  +              +         +  +   +   +         +    
Sbjct: 120 EEGGVIRYTQGYADTDRLIREMTAAAEAMKLMAQNFQTILAENREDIRALVQNMEMLTRH 179

Query: 185 TISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVNQILE 244
               V+ N  +    +     +  H + +          +    + + + + + +   + 
Sbjct: 180 LDQMVVENRENVRASLTGIRLLVEHLNRTLPQTLASVQRLADTLEAMASENREDIKVAVR 239

Query: 245 NIQVSSNNFVKSSDQVINTVHDVRETTQT-FQEVGQKIDHLLSDFSSKMKSKET 297
           N++  S +   S   ++  ++ +     T   E  Q +  +  + +   K    
Sbjct: 240 NLRELSEDLRSSLPTLVAQLNQLSANLNTVVTENRQDLRTISENLAESSKKLNL 293


>gi|17547679|ref|NP_521081.1| signal peptide protein [Ralstonia solanacearum GMI1000]
 gi|17429983|emb|CAD16667.1| probable signal peptide protein [Ralstonia solanacearum GMI1000]
          Length = 173

 Score =  101 bits (250), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 25/118 (21%), Positives = 42/118 (35%), Gaps = 3/118 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQY-DGPMAEVIIRIPGSVDGLSTDSSVR 59
           M        VGLFV+  L    F        + +      +V      ++ GL   + V+
Sbjct: 1   MRKSLLDFWVGLFVLVGLIALLFLALKAGNMSAFSFAKTYQVRAAF-DNIGGLKVRAPVK 59

Query: 60  FNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTL 117
             G+ VGR+  +  D +    +     +         ++A I T GL G  Y+ L   
Sbjct: 60  SAGVVVGRVSQILFD-DKSYQATVVLDMDQRYQFPKDSSAKILTSGLLGEQYVGLEPG 116


>gi|299533749|ref|ZP_07047121.1| putative periplasmic protein [Comamonas testosteroni S44]
 gi|298718298|gb|EFI59283.1| putative periplasmic protein [Comamonas testosteroni S44]
          Length = 315

 Score =  101 bits (249), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 34/128 (26%), Positives = 64/128 (50%), Gaps = 3/128 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K++  + G+FV+ +         WL+R N+         +     V GL   ++VR+
Sbjct: 1   MENKSHAMAAGIFVLVVATLLAGLAVWLTRDNR---EYQLYEMSTKDGVSGLQPQATVRY 57

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G+PVG++V +  D +   + L +  +  DTP+ P+T A +  QG+ G+ +I+L    K 
Sbjct: 58  KGVPVGKVVRIGFDPQISGNVLIRIAVGEDTPVTPATYAQLGYQGVTGLAHIQLDDDSKS 117

Query: 121 KKTIFQIA 128
            + +    
Sbjct: 118 SQPLKPGP 125



 Score = 44.2 bits (101), Expect = 0.040,   Method: Composition-based stats.
 Identities = 20/170 (11%), Positives = 52/170 (30%), Gaps = 12/170 (7%)

Query: 273 TFQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNMRSSISAIREITDQRQKIISTI 332
               +  +   LL       +   +    +N    +  + +  +A   I D  + +  T 
Sbjct: 137 PLNMLADQGPVLLERVDEISRRLNSMLGEDNQKRVSVALDNIAAASGGIKDLAETMNKTA 196

Query: 333 NTIENITSNLNDSSQKFAELMSKINNISALKENNSLFKDAQRAMHTFRDT---SEKINRY 389
                IT++ + + Q   +  +             +  D Q+ +          ++I   
Sbjct: 197 KDFPQITADAHQTLQSLTKAGNA---------ATGVATDLQQTVRKVNAPDGPLQQIAEG 247

Query: 390 IPSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFERNPQDIVWG 439
             ++    ++  +S L  +      +             F  NPQ +++G
Sbjct: 248 TQALSQAAESLGRSTLPRMNGAADDVSRAARSMGAAAGRFNDNPQSVIYG 297


>gi|225851011|ref|YP_002731245.1| mce related protein [Persephonella marina EX-H1]
 gi|225646722|gb|ACO04908.1| mce related protein [Persephonella marina EX-H1]
          Length = 514

 Score =  101 bits (249), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 48/362 (13%), Positives = 111/362 (30%), Gaps = 14/362 (3%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M ++     VGLFV+ I     +          +     +  I     V+GLS  + V+ 
Sbjct: 1   MNTQ---LKVGLFVLIISGIFAYLTIAF-NDRGFGQDTQDYYIYFNM-VEGLSKGADVQV 55

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G+ VGR+  +       +    K  IR D PLY +  A IRT GL G  Y+ +     +
Sbjct: 56  KGVKVGRVEDIVF---KNSIVEVKVSIRKDVPLYKNAVAYIRTLGLMGDKYVYIDPGTPD 112

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISN------AENTSKKISDSSRHIQKIIENIEK 174
              + + A  R  +   +A  +  +            +N +K I + +         +  
Sbjct: 113 AGKLPEKAIIRKGQVFTSAEEAFSSAADVAKKVEILVDNLNKAIEEGNLTELIRRIRVLA 172

Query: 175 PLTTTIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAI 234
             T  +                +      T +    +        +  +       I+ +
Sbjct: 173 EHTDQLVQENRRDLRRTIENVRVITDNLRTHLPELIAKLDRITTHLEAITGDNRDDIREL 232

Query: 235 DLQKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKS 294
                   +   + +           +     V E  +  +   +KI          +  
Sbjct: 233 VKNLKETSVALKEKTPKVLEDIDQAALQVRDTVGENREDIRSAVEKIKDASLKLDRILAK 292

Query: 295 KETSAFLENIADSTSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMS 354
            +          +  ++ ++++   +   +  K+I+       + +  +  ++     ++
Sbjct: 293 IDEGKGTIGKLVNEDDLYNNVNEGVKSFAKPFKVINRSKLDIKLYAETHTGNEDVKAGIA 352

Query: 355 KI 356
            I
Sbjct: 353 AI 354


>gi|166366297|ref|YP_001658570.1| hypothetical protein MAE_35560 [Microcystis aeruginosa NIES-843]
 gi|166088670|dbj|BAG03378.1| hypothetical protein MAE_35560 [Microcystis aeruginosa NIES-843]
          Length = 463

 Score =  101 bits (249), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 53/431 (12%), Positives = 134/431 (31%), Gaps = 24/431 (5%)

Query: 10  VGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRFNGIPVGRIV 69
           +GL +++      + I WLS  + + G         P +V G+   + V + G+ +G++ 
Sbjct: 19  IGLMLLTSGGILIWFIAWLSNFS-FGGRSYRASFLFP-NVGGMMVGTRVGYRGVRIGQVT 76

Query: 70  GLFLDQEYPNHSLAKALIRP-DTPLYPSTTATIRTQGLAGITYIELSTLRKEKKTIFQIA 128
            +  + E       +  I P D  +  ++       GL G T I+++            A
Sbjct: 77  AITPEPEG---VAVEVEISPADRLIPSNSLIEAIQSGLVGETTIDITP---------LQA 124

Query: 129 TERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTIANIETIST 188
                      +P+     I    +  +  S  + +           L +    +    +
Sbjct: 125 LPVGGVKEPPLSPNCNGEVIICNGSRLQGQSALNVNTLIRSLLRISNLVSDPDMVAGFRS 184

Query: 189 VLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVNQILENIQV 248
                 + +  +   +     +        T+  + + +  +     +      L +   
Sbjct: 185 FTQRAANALGGLDRFSGEATTALSEVRRSGTLGKVNSGMRSLESLPQVSGSLDRLSSDLS 244

Query: 249 SSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAFLENIADST 308
                 + +  ++ ++            + +    LL    +  + +   A  +N   +T
Sbjct: 245 GVGGLSQEATTLLRSLQGSGGLRNLDATLVEARKTLLLVGETTEELRVFLAANQNRLIAT 304

Query: 309 SNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNISALKENNSL 368
            +   + S   + T      I T      I  NLN  S    +L   + N +A   + + 
Sbjct: 305 LDSIKTTSDRLQTTLAALDPILTQVQKSQIIENLNTISANAVKLSENLGNFTAYLSDPAT 364

Query: 369 FKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNN 428
               Q+ + + R     + +    +     N           L +++   +      +++
Sbjct: 365 VVTLQQLLDSSRAAFANLQKITSDVDEITGN---------PQLRQEIIRLIQGLSRLVSS 415

Query: 429 FERNPQDIVWG 439
            E+  Q+   G
Sbjct: 416 SEQLQQEFAQG 426


>gi|83748207|ref|ZP_00945234.1| toluene tolerance protein TTG2C [Ralstonia solanacearum UW551]
 gi|207744517|ref|YP_002260909.1| hypothetical protein RSIPO_02727 [Ralstonia solanacearum IPO1609]
 gi|83725175|gb|EAP72326.1| toluene tolerance protein TTG2C [Ralstonia solanacearum UW551]
 gi|206595923|emb|CAQ62850.1| conserved hypothetical protein [Ralstonia solanacearum IPO1609]
          Length = 172

 Score =  101 bits (249), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 24/118 (20%), Positives = 42/118 (35%), Gaps = 3/118 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQY-DGPMAEVIIRIPGSVDGLSTDSSVR 59
           M        VGLFV+  +    F        + +      +V      ++ GL   + V+
Sbjct: 1   MRKSLLDFWVGLFVLVGIIALLFLALKAGNMSSFSFAKTYQVRAAF-DNIGGLKVRAPVK 59

Query: 60  FNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTL 117
             G+ VGR+  +  D +    +     +         ++A I T GL G  Y+ L   
Sbjct: 60  SAGVVVGRVSQILFD-DKSYQATVVLDMDQRYQFPKDSSAKILTSGLLGEQYVGLEPG 116


>gi|134294507|ref|YP_001118242.1| hypothetical protein Bcep1808_0395 [Burkholderia vietnamiensis G4]
 gi|134137664|gb|ABO53407.1| Mammalian cell entry related domain protein [Burkholderia
           vietnamiensis G4]
          Length = 188

 Score =  101 bits (249), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 27/123 (21%), Positives = 47/123 (38%), Gaps = 3/123 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQY-DGPMAEVIIRIPGSVDGLSTDSSVR 59
           M+       VGLFVV+      F    +   +     P   V ++   ++ GL   ++V+
Sbjct: 3   MKKTALDFWVGLFVVAGFLAVLFLALKVGNMSSLSFQPTYSVRMKF-DNIGGLKPRAAVK 61

Query: 60  FNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRK 119
             G+ VGR+  +  D      ++    +         ++A I T GL G  YI L     
Sbjct: 62  SAGVVVGRVKSVGFDTNTY-QAVVTIDVDGQYQFPKDSSAKILTSGLLGEQYIGLDPGGD 120

Query: 120 EKK 122
            + 
Sbjct: 121 TEM 123


>gi|124516680|gb|EAY58188.1| putative ABC transporter [Leptospirillum rubarum]
          Length = 518

 Score =  101 bits (249), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 49/392 (12%), Positives = 116/392 (29%), Gaps = 58/392 (14%)

Query: 7   YTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRFNGIPVG 66
              +G F+V  +  +          +        +      SVDGL   ++VR  G+ VG
Sbjct: 6   EAKLGFFIVVAILVAVGLTLRFGHFHLTPKGSYRIYADF-RSVDGLEKGTAVRIAGVRVG 64

Query: 67  RIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKEKKTIFQ 126
            +  + L       +  + +I     L       I + G  G  YIEL   +  K  I +
Sbjct: 65  EVTDITL--RSSGMAHVEMMIFDGLKLPADIHPVIFSNGFLGKLYIELVPGKSAKPIIKK 122

Query: 127 IATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTIANIETI 186
                 +R     + S +++                                        
Sbjct: 123 NQFFPTRRERQEQSGSHLSFSWFL------------------------------------ 146

Query: 187 STVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVNQILENI 246
                         + +         S  +  T         + + +         L   
Sbjct: 147 ------PSPVWGDPLPSQPGASVPGPSLPSSKTEDPGYVQPGQTLASPGETVSVNRLVRK 200

Query: 247 QVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAFLENIAD 306
                + +K+    +      ++ T+  ++    +  L  +            F +N+ D
Sbjct: 201 LNRIADDIKAITGALRRAMGNKKGTEDLKKTLDNLKVLTDNLRD---------FTKNLKD 251

Query: 307 STSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINN----ISAL 362
            +  +   + +I    DQ    +  +   +++ + ++ ++     +++KI++    I  L
Sbjct: 252 KSPAILKKVDSIATKIDQGVGTVGQLVNNKDLYNKVDSAAGHLDSILAKIDSGQGTIGQL 311

Query: 363 KENNSLFKDAQRAMHTFRDTSEKINRYIPSIG 394
             N  L+ +    +  F D S K ++ +  + 
Sbjct: 312 VNNPDLYNNLNATLKKFSDLSHKSDQMVLDVS 343


>gi|293394225|ref|ZP_06638525.1| toluene tolerance ABC superfamily ATP binding cassette transporter,
           binding protein [Serratia odorifera DSM 4582]
 gi|291423203|gb|EFE96432.1| toluene tolerance ABC superfamily ATP binding cassette transporter,
           binding protein [Serratia odorifera DSM 4582]
          Length = 183

 Score =  101 bits (249), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 27/146 (18%), Positives = 53/146 (36%), Gaps = 2/146 (1%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M++K     VG F++  L    F    ++            I     ++ GL   S V+ 
Sbjct: 1   MQTKKSEIWVGAFMLIALCAIIFICLQVANVKSIGNEPTYRIYATFDNIGGLKPRSPVKI 60

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDT-PLYPSTTATIRTQGLAGITYIELSTLRK 119
            G+ +GR+  + LD +          I+     +  +++  IRT GL G  Y+ L+   +
Sbjct: 61  GGVVIGRVADIALDPKTYTP-RVALDIQDKYDQIPDTSSLAIRTSGLLGEQYLALNVGFE 119

Query: 120 EKKTIFQIATERNQRAMITATPSGIN 145
           +      I  +        +     +
Sbjct: 120 DPDMGTSILKDGGTIQDTKSAMVLED 145


>gi|299068159|emb|CBJ39378.1| putative ABC-type transporter, periplasmic component (resistance to
           organic solvents) [Ralstonia solanacearum CMR15]
          Length = 330

 Score =  101 bits (249), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 39/308 (12%), Positives = 108/308 (35%), Gaps = 16/308 (5%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++ +    GLF + ++ F   ++ W +R      P     +    +V+GLS  ++V++
Sbjct: 1   MENRAHAFLAGLFTIGLVIFIALAVVWFNRDQTVRLP---YEVVTRSTVNGLSPQAAVKY 57

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G+ VG++  +  D + P   + + L+  D P+  +T   +  QG+ G+ Y++       
Sbjct: 58  RGLDVGKVDSIRFDDKVPGQIIVRVLVDKDAPITTTTYGRLAYQGVTGLAYVQ------- 110

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
              +     E  +R +        N   +     +  + +  +   +++  I++ L++  
Sbjct: 111 ---LDDRGYEGGRREVNRTRLETSNQHPARIAMEAGFLDELDKRGDQMLARIDQTLSSLS 167

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
           A  +         ++ +     T       +            I        +   +   
Sbjct: 168 ALFDDEHRQ--ALMAAMQSFRGTMDSYNALARQAEPTMRRLPQIADNLDATLSATRRLSQ 225

Query: 241 QILENIQVSSNNFVKSSDQVINTVHDVRETTQTF-QEVGQKIDHLLSDFSSKMKSKETSA 299
            + +           + + + +    ++  T     E   +++    +    ++S + + 
Sbjct: 226 SLSDPKGPLMGTLASAGNDLSSASQSMQAATSVLANETLPQLNGFTREARQAVRSFDHAV 285

Query: 300 FLENIADS 307
              N    
Sbjct: 286 ADFNTRPQ 293



 Score = 48.8 bits (113), Expect = 0.002,   Method: Composition-based stats.
 Identities = 24/184 (13%), Positives = 58/184 (31%), Gaps = 12/184 (6%)

Query: 261 INTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNMRSSISAIRE 320
                 +        E+ ++ D +L+     + S       E+     + M+S    +  
Sbjct: 132 NQHPARIAMEAGFLDELDKRGDQMLARIDQTLSSLSALFDDEHRQALMAAMQSFRGTMDS 191

Query: 321 ITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNISALKENNSLFKDAQRAMHTFR 380
                ++   T+  +  I  NL+ +      L   +++                 M T  
Sbjct: 192 YNALARQAEPTMRRLPQIADNLDATLSATRRLSQSLSDPKG------------PLMGTLA 239

Query: 381 DTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFERNPQDIVWGR 440
                ++    S+       +   L  +    R+ ++ V  FD  + +F   PQ +++G 
Sbjct: 240 SAGNDLSSASQSMQAATSVLANETLPQLNGFTREARQAVRSFDHAVADFNTRPQSVLFGP 299

Query: 441 EKGS 444
              +
Sbjct: 300 APAT 303


>gi|207721839|ref|YP_002252277.1| hypothetical protein RSMK02119 [Ralstonia solanacearum MolK2]
 gi|206587006|emb|CAQ17590.1| conserved hypothetical protein [Ralstonia solanacearum MolK2]
          Length = 172

 Score =  100 bits (248), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 24/118 (20%), Positives = 42/118 (35%), Gaps = 3/118 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQY-DGPMAEVIIRIPGSVDGLSTDSSVR 59
           M        VGLFV+  +    F        + +      +V      ++ GL   + V+
Sbjct: 1   MRKSLLDFWVGLFVLVGIIALLFLALKAGNMSSFSFAKTYQVRAAF-DNIGGLKVRAPVK 59

Query: 60  FNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTL 117
             G+ VGR+  +  D +    +     +         ++A I T GL G  Y+ L   
Sbjct: 60  SAGVVVGRVSQILFD-DKSYQATVVLDMDQRYQFPKDSSAKILTSGLLGEQYVGLEPG 116


>gi|188532481|ref|YP_001906278.1| hypothetical protein ETA_03240 [Erwinia tasmaniensis Et1/99]
 gi|188027523|emb|CAO95370.1| Putative membrane protein [Erwinia tasmaniensis Et1/99]
          Length = 186

 Score =  100 bits (248), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 26/146 (17%), Positives = 53/146 (36%), Gaps = 2/146 (1%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M++K     VG F++  L    F    ++            +     +V GL   S V+ 
Sbjct: 1   MQTKKSEIWVGAFLLLALCAIIFLCLRVTDLKSLGSVTTWKLYATFDNVGGLKPGSPVKV 60

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDT-PLYPSTTATIRTQGLAGITYIELSTLRK 119
            G+ +GR+  + LD +  +       I      +  +++  +RT GL G  Y+ L+    
Sbjct: 61  GGVVIGRVSDITLDAKNYSP-KVSMDIDDRYNNIPDTSSLAVRTSGLLGEQYLALNIGFD 119

Query: 120 EKKTIFQIATERNQRAMITATPSGIN 145
           + +    I  +        +     +
Sbjct: 120 DPEMGTAILKDGGTIQDTKSAMVLED 145


>gi|325266929|ref|ZP_08133600.1| ABC superfamily ATP binding cassette transporter, binding protein
           [Kingella denitrificans ATCC 33394]
 gi|324981670|gb|EGC17311.1| ABC superfamily ATP binding cassette transporter, binding protein
           [Kingella denitrificans ATCC 33394]
          Length = 164

 Score =  100 bits (248), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 24/118 (20%), Positives = 43/118 (36%), Gaps = 2/118 (1%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRI-PGSVDGLSTDSSVR 59
           M+       VGLFV+  +       +  +      G      +      + GL   + ++
Sbjct: 1   MKKSILEFWVGLFVLLGVAALGVLAFQAAGGKSMGGGAQTYTVYASFDDIGGLKPQAPIK 60

Query: 60  FNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTL 117
             G+ VGR+  + LD +    +  +  +         ++A I T GL G  YI L   
Sbjct: 61  TAGVLVGRVESIELDPKNF-QAKVRMSLDKKYAFSVDSSAKILTSGLLGEQYIGLEQG 117


>gi|251771478|gb|EES52055.1| putative ABC transporter [Leptospirillum ferrodiazotrophum]
          Length = 525

 Score =  100 bits (248), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 43/353 (12%), Positives = 112/353 (31%), Gaps = 13/353 (3%)

Query: 7   YTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRFNGIPVG 66
            T +G FV+  +    F    LS                  SVDGL   + V   G+ VG
Sbjct: 6   ETRLGFFVLLAVGTLVFLSLRLSHHTMKPEHSYAFYAEF-RSVDGLEKGTDVEVAGVKVG 64

Query: 67  RIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKEKKTIFQ 126
            +  + L      H+  + L+     +     A I + G  G  Y+E+       +    
Sbjct: 65  EVDSITLGP--SGHARVRMLVDKKVVIPADARAVIFSNGFLGKMYVEIEPGPSRIRPHLD 122

Query: 127 IATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTIANIETI 186
            + +          P    +        +  ++ ++               ++ A   + 
Sbjct: 123 PSRD----------PENSGFLKKIFGALAPSLAFAAPQEGVPPTVTAPASNSSSAPAPSS 172

Query: 187 STVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVNQILENI 246
            +          +++    +    +              + D    +  L+      E  
Sbjct: 173 PSSGEVASPSPGEVLPGGTLAAKGTTVSVNRLIKKLNKVADDISAVSHSLKASIGTAEGK 232

Query: 247 QVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAFLENIAD 306
           +          +   N     +   ++  ++ +K+D + +   + + +  +     +  +
Sbjct: 233 EEIRRTLRHLDELTKNLRDFSKTLKESSPDILKKVDSIATKIDNGVGTIGSLVNKNDAYE 292

Query: 307 STSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNI 359
           S ++  + +++I E  D  Q  I  +    ++  NL+ + +K + + +K + +
Sbjct: 293 SANSSLAHLNSILEKIDDGQGTIGKLVNNPDVYDNLSKTLKKLSGVTNKADRM 345


>gi|309782893|ref|ZP_07677613.1| mce family protein [Ralstonia sp. 5_7_47FAA]
 gi|308918317|gb|EFP63994.1| mce family protein [Ralstonia sp. 5_7_47FAA]
          Length = 175

 Score =  100 bits (248), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 23/117 (19%), Positives = 44/117 (37%), Gaps = 1/117 (0%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M        VGLFV+  +    F        + +       +     ++ GL   + V+ 
Sbjct: 1   MRKSVLDFWVGLFVLVGIIALLFLALKAGNMSSFSFAKTYQVKAAFDNIGGLKVRAPVKS 60

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTL 117
           +G+ VGR+  +  D +    ++A   +         ++A + T GL G  YI +   
Sbjct: 61  SGVVVGRVSQILFD-DKSYQAIAVLDMDQRYQFPKDSSAKVLTSGLLGEQYIGIEPG 116


>gi|222109466|ref|YP_002551730.1| mammalian cell entry related domain-containing protein [Acidovorax
           ebreus TPSY]
 gi|221728910|gb|ACM31730.1| Mammalian cell entry related domain protein [Acidovorax ebreus
           TPSY]
          Length = 325

 Score =  100 bits (248), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 29/113 (25%), Positives = 58/113 (51%), Gaps = 3/113 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K++  + G+FV+++         WL+R            +    SV GL   ++VR+
Sbjct: 1   MENKSHALAAGIFVIAVAALLAGLGMWLTRDQ---TDYQLYELSSKDSVSGLQPQAAVRY 57

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIE 113
            G+ VG++  +  D +   + L +  +  D P+ P+T AT+  QG+ G+ +++
Sbjct: 58  KGVAVGKVTHIGFDPQVAGNVLIRIAVNADAPISPTTFATLGYQGVTGLAHVQ 110



 Score = 50.3 bits (117), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 30/241 (12%), Positives = 60/241 (24%), Gaps = 12/241 (4%)

Query: 199 KMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVNQILENIQVSSNNFVKSSD 258
            ++    V   +  S  TF T+     +    ++  D +                   S 
Sbjct: 77  NVLIRIAVNADAPISPTTFATLGYQGVTGLAHVQLDDAEAPLPAPPPGASGLPRLPLHSS 136

Query: 259 QVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNMRSSISAI 318
                           QE  Q+I+ LL D + +  S       +         R   + +
Sbjct: 137 SFSQLAEQGPAILGQVQEATQRINTLLGDENQQRFSTALKQLGDAAGSIDQLARRLDNTV 196

Query: 319 REITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNISALKENNSLFKDAQRAMHT 378
               D     +  +      T      +   A   +                 A R +  
Sbjct: 197 TTRLDPALAGVPPLVQDTQQTLQALRQAGSSAATAAN------------DVSQAIRTLQA 244

Query: 379 FRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFERNPQDIVW 438
                ++I     S+      F +  L  I +   +            +    NPQ +++
Sbjct: 245 EGGALDEIAAGAKSLAGAADRFGRVTLPRINHAADETARAARRLGRTASGINDNPQSLIY 304

Query: 439 G 439
           G
Sbjct: 305 G 305


>gi|59802416|ref|YP_209128.1| hypothetical protein NGO2118 [Neisseria gonorrhoeae FA 1090]
 gi|59719311|gb|AAW90716.1| conserved hypothetical protein [Neisseria gonorrhoeae FA 1090]
 gi|317165513|gb|ADV09054.1| hypothetical protein NGTW08_2103 [Neisseria gonorrhoeae
           TCDC-NG08107]
          Length = 187

 Score =  100 bits (248), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 27/118 (22%), Positives = 46/118 (38%), Gaps = 2/118 (1%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRI-PGSVDGLSTDSSVR 59
           M+       VGLFV+       F  + ++    + G      +    G + GL  ++ V+
Sbjct: 24  MKKNILEFWVGLFVLIGAAAVAFLAFRVAGGAAFGGSDKTYAVYADFGDIGGLKVNAPVK 83

Query: 60  FNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTL 117
             G+ VGR+  + LD +    +  +  +          +A I T GL G  YI L   
Sbjct: 84  SAGVLVGRVGAIGLDPKSY-QARVRLDLDGKYQFSSDVSAQILTSGLLGEQYIGLQQG 140


>gi|298506723|gb|ADI85446.1| conserved hypothetical protein [Geobacter sulfurreducens KN400]
          Length = 331

 Score =  100 bits (248), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 34/320 (10%), Positives = 87/320 (27%), Gaps = 17/320 (5%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M  K     +G FV+  +  +   +     S +      + ++   GSV GLS  + V F
Sbjct: 1   MSIKANKALIGAFVLGAICLAVAGVAVFG-SGKLFSSTKKFVMYFDGSVKGLSVGAPVVF 59

Query: 61  NGIPVGRIVGLFLDQ---EYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTL 117
            G+ VG +V + L     +        A I  D        A           Y      
Sbjct: 60  RGVKVGSVVDIVLQGNLRDMTFKVPVVAEIELDRLNMTDGAA-------NSTDYYRPLID 112

Query: 118 RKEKKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLT 177
           R  +  +   +    Q           ++            +   +         E    
Sbjct: 113 RGLRAQLQTQSLLTGQLM------VDFDFHPDKPARFVSDATGYPQIPTIPSTAEELAQK 166

Query: 178 TTIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQ 237
                +  +       +  +++++++  +             +  L+ ++D+ +  +   
Sbjct: 167 LEELPLRQLLERANAAVGGLERLLNSPHMQETPRSLNLAAADMRTLLKNIDREVALLSAD 226

Query: 238 KVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKET 297
               I        +       +       ++   +T  E    +  L     +   +   
Sbjct: 227 ARGAIGAATSTIRHADRVLDFEEGAPAETMKNLNETLAEARTSLRTLDETLDAVRSAASD 286

Query: 298 SAFLENIADSTSNMRSSISA 317
              L  +  +  ++  +  +
Sbjct: 287 ERSLYQLRHALKDLGEASRS 306



 Score = 56.9 bits (134), Expect = 7e-06,   Method: Composition-based stats.
 Identities = 20/215 (9%), Positives = 67/215 (31%), Gaps = 9/215 (4%)

Query: 238 KVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKET 297
           +   +L    +   +F         +         T     +++   L +   +   +  
Sbjct: 120 QTQSLLTGQLMVDFDFHPDKPARFVSDATGYPQIPTIPSTAEELAQKLEELPLRQLLERA 179

Query: 298 SAFLENIADSTSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKI- 356
           +A +  +    ++     +                N    +     D+        S I 
Sbjct: 180 NAAVGGLERLLNSPHMQETPRSLNLAAADMRTLLKNIDREVALLSADARGAIGAATSTIR 239

Query: 357 --NNISALKENN--SLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLV 412
             + +   +E       K+    +   R +   ++  + ++ +   +  +  L  +++ +
Sbjct: 240 HADRVLDFEEGAPAETMKNLNETLAEARTSLRTLDETLDAVRSAASD--ERSLYQLRHAL 297

Query: 413 RKLQETVNHFDDCLNNFERNPQDIVWGREKGSVKI 447
           + L E        ++  +R+P+ ++ G  K +V+ 
Sbjct: 298 KDLGEASRSLGSLVDYLDRHPEALLRG--KPTVEE 330


>gi|218507224|ref|ZP_03505102.1| putative ABC transporter, substrate-binding protein [Rhizobium etli
           Brasil 5]
          Length = 197

 Score =  100 bits (248), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 44/192 (22%), Positives = 89/192 (46%), Gaps = 3/192 (1%)

Query: 258 DQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNMRSSISA 317
            +   T     +  +  Q+   ++D L++               +   D+ + + S    
Sbjct: 2   QKFDETATTFNDFGKQAQDTLDRVDTLVAQIDPAKLKGSVDDISQATKDARAAVASIRDV 61

Query: 318 IREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNISALKENN-SLFKDAQRAM 376
              ++ +++ I  TI  +  + + LN +S +   ++ K++ +         +   A+ A 
Sbjct: 62  ANTVSGRQKDIDQTIQDVSQLANKLNSASTRIDGILIKVDALLGTDNTQFDVRASARDAG 121

Query: 377 HTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFERNPQDI 436
              R  ++ +N  I  I +NLQ FS  GL D+Q LV  ++ TVN+ +D + NF+RNPQ +
Sbjct: 122 ILSRKVADNLNSRIGPIADNLQKFSSGGLRDVQTLVNDMRGTVNNLNDTITNFDRNPQRL 181

Query: 437 VWGREKGSVKIY 448
           ++G +  +VK Y
Sbjct: 182 IFGGD--TVKQY 191


>gi|319761580|ref|YP_004125517.1| mammalian cell entry related domain protein [Alicycliphilus
           denitrificans BC]
 gi|330823448|ref|YP_004386751.1| Mammalian cell entry related domain-containing protein
           [Alicycliphilus denitrificans K601]
 gi|317116141|gb|ADU98629.1| Mammalian cell entry related domain protein [Alicycliphilus
           denitrificans BC]
 gi|329308820|gb|AEB83235.1| Mammalian cell entry related domain protein [Alicycliphilus
           denitrificans K601]
          Length = 162

 Score =  100 bits (248), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 29/133 (21%), Positives = 46/133 (34%), Gaps = 1/133 (0%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M+       VGLFV+       F     +   Q +     VI     ++ GL   ++VR 
Sbjct: 1   MQHSKNDIWVGLFVLLGGAALVFLALQSANLLQLNFRSGYVITARFDNIGGLKPKAAVRS 60

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G+ VGR+  +  D +    +     I         ++  I T GL G  YI +    +E
Sbjct: 61  AGVVVGRVQSISFD-DKTYQARVALEIEKRYAFPKDSSLKILTSGLLGDQYIGIEPGAEE 119

Query: 121 KKTIFQIATERNQ 133
                       Q
Sbjct: 120 DNLADGSMVTNTQ 132


>gi|322834660|ref|YP_004214687.1| Mammalian cell entry related domain protein [Rahnella sp. Y9602]
 gi|321169861|gb|ADW75560.1| Mammalian cell entry related domain protein [Rahnella sp. Y9602]
          Length = 188

 Score =  100 bits (248), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 26/123 (21%), Positives = 52/123 (42%), Gaps = 1/123 (0%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M++K     VG F++  L    F    ++            I     ++ GL + S V+ 
Sbjct: 1   MQTKKSEIWVGAFLIIALIAVIFLCLKVADIRSIGSDPTYRISADFDNIGGLKSGSPVKV 60

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G+ +GR+  + LD+ Y          + +  +  ++T  IRT GL G  ++ L+   ++
Sbjct: 61  GGVVIGRVSSITLDKNYSPRVEMDIDQKYN-QIPSTSTLAIRTSGLLGEQFLALNIGFED 119

Query: 121 KKT 123
            + 
Sbjct: 120 PEM 122


>gi|187930305|ref|YP_001900792.1| Mammalian cell entry related domain-containing protein [Ralstonia
           pickettii 12J]
 gi|187727195|gb|ACD28360.1| Mammalian cell entry related domain protein [Ralstonia pickettii
           12J]
          Length = 175

 Score =  100 bits (248), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 23/117 (19%), Positives = 44/117 (37%), Gaps = 1/117 (0%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M        VGLFV+  +    F        + +       +     ++ GL   + V+ 
Sbjct: 1   MRKSVLDFWVGLFVLVGIIALLFLALKAGNMSSFSFAKTYQVKAAFDNIGGLKVRAPVKS 60

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTL 117
           +G+ VGR+  +  D +    ++A   +         ++A + T GL G  YI +   
Sbjct: 61  SGVVVGRVSQILFD-DKSYQAIAVLDMDQRYQFPKDSSAKVLTSGLLGEQYIGIEPG 116


>gi|94498326|ref|ZP_01304885.1| Mammalian cell entry related protein [Sphingomonas sp. SKA58]
 gi|94422206|gb|EAT07248.1| Mammalian cell entry related protein [Sphingomonas sp. SKA58]
          Length = 313

 Score =  100 bits (247), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 33/131 (25%), Positives = 58/131 (44%), Gaps = 2/131 (1%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+++ +  V L V  ++        WL +S + DG   E  ++   SVDG+   S V  
Sbjct: 1   METRSNWLKVSLVVGLLIAAVIGFTLWLIQSREADGATYE--VQFKQSVDGVQIGSGVNL 58

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G+PVG++  + L    P   + + ++  D  L+   TA+I      G   I L+   K 
Sbjct: 59  LGVPVGKVTQVRLQPSNPGTVMVRFVLTKDILLHRGVTASIDKSFFDGSAEISLAGSNKR 118

Query: 121 KKTIFQIATER 131
           +  +   A + 
Sbjct: 119 EPALTVQAGQP 129


>gi|224418848|ref|ZP_03656854.1| ABC transporter permease [Helicobacter canadensis MIT 98-5491]
 gi|253828163|ref|ZP_04871048.1| ABC-type transport system, periplasmic component [Helicobacter
           canadensis MIT 98-5491]
 gi|313142366|ref|ZP_07804559.1| predicted protein [Helicobacter canadensis MIT 98-5491]
 gi|253511569|gb|EES90228.1| ABC-type transport system, periplasmic component [Helicobacter
           canadensis MIT 98-5491]
 gi|313131397|gb|EFR49014.1| predicted protein [Helicobacter canadensis MIT 98-5491]
          Length = 265

 Score =  100 bits (247), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 28/166 (16%), Positives = 67/166 (40%), Gaps = 3/166 (1%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++  Y  +G+F +++L      I+W+ + ++      E  I      +G+  ++ V++
Sbjct: 1   METRLNYVLLGVFFIAVLLALAGFIFWMGKYDRNLSEYNEYYIYNKELPNGIRVETPVKY 60

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G+PVG +    L             ++ +  L   +   +++QGL G  ++ L   + +
Sbjct: 61  LGLPVGFVRHYQLSGN---EVEIVVWVQKEIILNEGSKVAVQSQGLTGGNFLTLIQGKGK 117

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQ 166
             +  Q A    +   I    S     ++  E + ++ +       
Sbjct: 118 PFSQSQKAILGFKENWIEQVSSKAENVMAQLETSLERFNQLLNDKN 163


>gi|241664473|ref|YP_002982833.1| Mammalian cell entry related domain-containing protein [Ralstonia
           pickettii 12D]
 gi|240866500|gb|ACS64161.1| Mammalian cell entry related domain protein [Ralstonia pickettii
           12D]
          Length = 175

 Score =  100 bits (247), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 23/117 (19%), Positives = 44/117 (37%), Gaps = 1/117 (0%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M        VGLFV+  +    F        + +       +     ++ GL   + V+ 
Sbjct: 1   MRKSVLDFWVGLFVLVGIIALLFLALKAGNMSSFSFAKTYQVKAAFDNIGGLKVRAPVKS 60

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTL 117
           +G+ VGR+  +  D +    ++A   +         ++A + T GL G  YI +   
Sbjct: 61  SGVVVGRVSQILFD-DKSYQAIAVLDMDQRYQFPRDSSAKVLTSGLLGEQYIGIEPG 116


>gi|113869372|ref|YP_727861.1| ABC-type transporter, periplasmic component involved in toluene
           tolerance [Ralstonia eutropha H16]
 gi|113528148|emb|CAJ94493.1| ABC-type transporter, periplasmic component involved in toluene
           tolerance [Ralstonia eutropha H16]
          Length = 170

 Score =  100 bits (247), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 25/117 (21%), Positives = 42/117 (35%), Gaps = 1/117 (0%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M+       VGLFV +      F        + +       +     ++ GL   + V+ 
Sbjct: 1   MKKNALDFWVGLFVAAGFVAVLFLALKAGNMSAFSFQDTYSVQARFDNIGGLKPRAPVKS 60

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTL 117
            G+ VGR+  +  D +    +  +  +         T+A I T GL G  YI L   
Sbjct: 61  AGVVVGRVAAIRFD-DKTYQATVEMSLEKRYQFPKDTSAKILTSGLLGEQYIGLEAG 116


>gi|258592960|emb|CBE69269.1| Mce-related protein [NC10 bacterium 'Dutch sediment']
          Length = 146

 Score =  100 bits (247), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 31/117 (26%), Positives = 47/117 (40%), Gaps = 4/117 (3%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M+     T VGLFVV  +    +    L R          V  +   SV GL   + V  
Sbjct: 1   MKRLTMETLVGLFVVVGIVSLAWLSIRLGRLEVVGDRGYPVSAQF-DSVAGLKNGAVVEI 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTL 117
            G+ +GR+  + LD      ++    I  D  L      +IRT+GL G  Y+ ++  
Sbjct: 60  AGVEIGRVKTIRLD---SYRAVVVMSIDSDVKLQDDAIVSIRTKGLIGEKYVRITPG 113


>gi|217969319|ref|YP_002354553.1| hypothetical protein Tmz1t_0890 [Thauera sp. MZ1T]
 gi|217506646|gb|ACK53657.1| Mammalian cell entry related domain protein [Thauera sp. MZ1T]
          Length = 156

 Score =  100 bits (247), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 28/117 (23%), Positives = 42/117 (35%), Gaps = 1/117 (0%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M        VGLFV        F    +   +  DG     +     ++ GL   + V+ 
Sbjct: 2   MSRTALDLWVGLFVAIGFAALVFLAMKVGNFSGLDGAETYRVEAPFDNIGGLKVRAPVKS 61

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTL 117
           +G+ VGR+  +  D         +  I         TTA+I T GL G  Y+ L   
Sbjct: 62  SGVLVGRVAVIRFDPAIYRAV-VELEIDKRYAFPADTTASILTSGLLGEQYVGLEAG 117


>gi|241762836|ref|ZP_04760899.1| Mammalian cell entry related domain protein [Acidovorax delafieldii
           2AN]
 gi|241368011|gb|EER62216.1| Mammalian cell entry related domain protein [Acidovorax delafieldii
           2AN]
          Length = 162

 Score =  100 bits (247), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 26/133 (19%), Positives = 45/133 (33%), Gaps = 1/133 (0%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M+       VGLFV+  +    F     +     +      +     ++ GL   ++VR 
Sbjct: 1   MQQSKNDVWVGLFVMLGVAALVFLALQSANLLHLNFQTGYRVTARFDNIGGLKPKAAVRS 60

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G+ VGR+  +  D +    +     +         ++  I T GL G  YI +     E
Sbjct: 61  AGVVVGRVESITFD-DKTFQARVTLELDKRYAFPKDSSLKILTSGLLGEQYIGIEAGADE 119

Query: 121 KKTIFQIATERNQ 133
           K           Q
Sbjct: 120 KNLAAGDTVSATQ 132


>gi|290476801|ref|YP_003469712.1| putative ABC transporter periplasmic binding protein [Xenorhabdus
           bovienii SS-2004]
 gi|289176145|emb|CBJ82950.1| putative transport protein (ABC superfamily, peri_bind)
           [Xenorhabdus bovienii SS-2004]
          Length = 168

 Score =  100 bits (247), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 24/124 (19%), Positives = 51/124 (41%), Gaps = 2/124 (1%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M++K     VG FV+  L    F    ++    +       +     ++ GL   S V+ 
Sbjct: 1   MQNKKNEIWVGCFVLIALAAIVFLCLKVADVRSFGSQTTYRVSAAFDNIGGLKVRSPVKI 60

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTP-LYPSTTATIRTQGLAGITYIELSTLRK 119
            G+ +GR+  ++LD +       +  +      +  +++ +IRT GL G  Y+ ++    
Sbjct: 61  GGVVIGRVERIWLDHKTYTP-QVELELFTQYDNIPSTSSLSIRTSGLLGEQYVAMNVGFY 119

Query: 120 EKKT 123
           +   
Sbjct: 120 DPDM 123


>gi|312795843|ref|YP_004028765.1| Toluene transport system Ttg2C protein [Burkholderia rhizoxinica
           HKI 454]
 gi|312167618|emb|CBW74621.1| Toluene transport system Ttg2C protein [Burkholderia rhizoxinica
           HKI 454]
          Length = 225

 Score =  100 bits (247), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 26/117 (22%), Positives = 42/117 (35%), Gaps = 1/117 (0%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M+       VGLFVV       F        +         +     ++ GL   ++V+ 
Sbjct: 33  MKKNALDFWVGLFVVLGFVALLFLALKAGNMSSLSFQSTYSVKMKFDNIGGLKPRAAVKS 92

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTL 117
            G+ VGR+  +  D +    +L    +         ++A I T GL G  YI L   
Sbjct: 93  AGVMVGRVQSIEFDTQTY-QALVTIDVFKPYTFPKDSSAKILTSGLLGEQYIGLDPG 148


>gi|77918064|ref|YP_355879.1| ABC transporter protein [Pelobacter carbinolicus DSM 2380]
 gi|77544147|gb|ABA87709.1| ABC-type transport system protein [Pelobacter carbinolicus DSM
           2380]
          Length = 148

 Score =  100 bits (247), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 32/133 (24%), Positives = 52/133 (39%), Gaps = 2/133 (1%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M+  N   +VG+F+V+      +    L   + +      +  R  GSV GL   + V  
Sbjct: 1   MKRFNVEMAVGIFLVAGFICFAYLSVKLGDVDWFGDKTYAISARF-GSVSGLKEGAVVEL 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G+ +G +  + LD E     L    I     L   + A+IRT G+ G  Y+E+S    E
Sbjct: 60  AGVKIGTVSRITLDPEKYEAVL-GMDIDAKVQLQEDSIASIRTSGIIGDKYVEVSPGGME 118

Query: 121 KKTIFQIATERNQ 133
                       +
Sbjct: 119 DYIQPGGEIYETE 131


>gi|225848327|ref|YP_002728490.1| mce related protein [Sulfurihydrogenibium azorense Az-Fu1]
 gi|225644731|gb|ACN99781.1| mce related protein [Sulfurihydrogenibium azorense Az-Fu1]
          Length = 516

 Score =  100 bits (246), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 54/372 (14%), Positives = 125/372 (33%), Gaps = 22/372 (5%)

Query: 6   YYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRFNGIPV 65
               VG+FV+ I     F I   S      G   +          GLS  + V+  G+  
Sbjct: 3   NSVKVGIFVLVISGLLGFLIIKFSGKE--FGQNYKEYFVYFTDAQGLSQGADVQVQGVKS 60

Query: 66  GRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKEKKTIF 125
           G++  +  +Q        K  +R + P+Y      IRT GL G  Y+ +         + 
Sbjct: 61  GKVEEIKFEQ---GKVKVKFKVRQEIPIYKDAKVVIRTYGLMGDKYLYVEPGNPSSGELV 117

Query: 126 QIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTIANIET 185
                 N               I++ E    ++  S++   ++++N+ K L         
Sbjct: 118 SGGVIENTT------------KIASTEEMIDQVRLSAKKFGELMDNLNKALGDERLKKLI 165

Query: 186 ISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVNQILEN 245
                    ++   + +   V    ++ +     +   + S+ + +        N   EN
Sbjct: 166 EDFDKFAYNTNEVVVQNKEDVRQAIANIRAITAELRQKLPSITENLDKTLENTKNITDEN 225

Query: 246 IQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAFLENIA 305
            +          D  +       +T  +  +   +I+  +S+       ++    +ENI 
Sbjct: 226 REDIRKLIANLKDLSVALKEKAPKTLDSVDKAATEIEKAVSENR-----QDLRLSIENIK 280

Query: 306 DSTSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNISALKEN 365
            ++ N+   ++ + E      K+++  +   N+   +   ++ F  +      +    E 
Sbjct: 281 KASDNLNQILAKVNEGKGTLGKLVNEDSFYNNVNEGVKSFAEPFKVVKESNLEVIMQGEK 340

Query: 366 NSLFKDAQRAMH 377
           ++  KD++    
Sbjct: 341 HTGNKDSKAGAA 352


>gi|83748498|ref|ZP_00945519.1| Hypothetical exported protein [Ralstonia solanacearum UW551]
 gi|207742156|ref|YP_002258548.1| abc-type transport system involved in resistance to organic
           solvents, periplasmic component protein [Ralstonia
           solanacearum IPO1609]
 gi|83724802|gb|EAP71959.1| Hypothetical exported protein [Ralstonia solanacearum UW551]
 gi|206593544|emb|CAQ60471.1| abc-type transport system involved in resistance to organic
           solvents, periplasmic component protein [Ralstonia
           solanacearum IPO1609]
          Length = 333

 Score =  100 bits (246), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 39/298 (13%), Positives = 102/298 (34%), Gaps = 6/298 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++ +    GLF + +  F   ++ W +R            +    +V+GLS  ++V++
Sbjct: 1   MENRAHAFLAGLFTIGLAIFVALAVVWFNRDQTV---RVPYDVVTRSTVNGLSPQAAVKY 57

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIE-LSTLRK 119
            G+ VG++  +  D + P   + + L+  D P+  +T   +  QG+ G+ Y++       
Sbjct: 58  RGLDVGKVDTIRFDDKVPGQIIVRVLVDKDAPITTTTYGRLAYQGVTGLAYVQLDDRGYD 117

Query: 120 EKKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTT 179
             K                       +     +   + ++   + +  +   ++      
Sbjct: 118 SGKRAGNPTRLETSDRRPARIAMEAGFLDELDKRGDQMLTRLDQTLGSLATMLDDEHRQA 177

Query: 180 IANIETISTVLANNISHIDKMMHTTQV--TPHSSDSKNTFNTITDLITSLDKMIKAIDLQ 237
           +           ++   + +            + +   T      L  SL      +   
Sbjct: 178 LMAAVHAFQGTMDSYGALARQAEPAMRKLPQIADNLDATLAATRRLSQSLSDPKGPLMGT 237

Query: 238 KVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSK 295
             +   +    S +    +      T+  +    +  ++  +  DH ++DF+S+ +S 
Sbjct: 238 LASAGSDLSSASQSMQAATQALTYETLPQLNGVAREARQAVRSFDHAVTDFNSRPQSV 295



 Score = 50.7 bits (118), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 18/133 (13%), Positives = 46/133 (34%), Gaps = 2/133 (1%)

Query: 314 SISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNISALKE--NNSLFKD 371
                + +         T+++   +      + +K  ++   ++   A     + SL   
Sbjct: 171 DDEHRQALMAAVHAFQGTMDSYGALARQAEPAMRKLPQIADNLDATLAATRRLSQSLSDP 230

Query: 372 AQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFER 431
               M T       ++    S+    Q  +   L  +  + R+ ++ V  FD  + +F  
Sbjct: 231 KGPLMGTLASAGSDLSSASQSMQAATQALTYETLPQLNGVAREARQAVRSFDHAVTDFNS 290

Query: 432 NPQDIVWGREKGS 444
            PQ +++G    +
Sbjct: 291 RPQSVLFGPAPAT 303


>gi|319409727|emb|CBY90033.1| conserved hypothetical integral membrane protein [Neisseria
           meningitidis WUE 2594]
 gi|325133422|gb|EGC56086.1| mce family protein [Neisseria meningitidis M13399]
 gi|325141490|gb|EGC63963.1| mce family protein [Neisseria meningitidis 961-5945]
 gi|325143673|gb|EGC65992.1| mce family protein [Neisseria meningitidis M01-240013]
 gi|325199053|gb|ADY94509.1| mce family protein [Neisseria meningitidis G2136]
 gi|325204914|gb|ADZ00368.1| mce family protein [Neisseria meningitidis M01-240355]
 gi|325206869|gb|ADZ02322.1| mce family protein [Neisseria meningitidis M04-240196]
          Length = 164

 Score =  100 bits (246), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 26/118 (22%), Positives = 45/118 (38%), Gaps = 2/118 (1%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRI-PGSVDGLSTDSSVR 59
           M+       VGLFV+       F  + ++    +        +    G + GL  ++ V+
Sbjct: 1   MKKNILEFWVGLFVLIGAAAVAFLAFRVAGGAAFGNSGKTYTVYADFGDIGGLKVNAPVK 60

Query: 60  FNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTL 117
             G+ VGR+  + LD +    +  +  +          +A I T GL G  YI L   
Sbjct: 61  SAGVLVGRVGAIGLDPKSY-QARVRLDLDGKYQFSSDVSAQILTSGLLGEQYIGLQQG 117


>gi|56476143|ref|YP_157732.1| mce related protein [Aromatoleum aromaticum EbN1]
 gi|56312186|emb|CAI06831.1| Mce related protein [Aromatoleum aromaticum EbN1]
          Length = 155

 Score =  100 bits (246), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 27/117 (23%), Positives = 42/117 (35%), Gaps = 1/117 (0%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M        VG FVV  +    F    +      +   + VI     ++ GL   + V+ 
Sbjct: 1   MSRTTLDLWVGFFVVIGMAALLFLSLKVGNLASANFSESYVIKAQFDNIGGLKVRAPVKS 60

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTL 117
            G+ VGR+  +  D      +    ++         T ATI T GL G  Y+ L   
Sbjct: 61  AGVVVGRVTDIRFD-TGSYRAEVTFVVDTRFQFPRDTIATILTSGLLGEQYLGLEPG 116


>gi|218461267|ref|ZP_03501358.1| putative ABC transporter, substrate-binding protein [Rhizobium etli
           Kim 5]
          Length = 110

 Score =  100 bits (246), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 34/106 (32%), Positives = 63/106 (59%), Gaps = 2/106 (1%)

Query: 343 NDSSQKFAELMSKINNISALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQ 402
           N +S +   ++ K++ +       S+F  A+  + +F+  ++ +N  I  I +NLQ FS 
Sbjct: 1   NSASTRIDGILIKVDALLGTDNTQSMFAQARETLESFKKVADNLNARIGPIADNLQKFSS 60

Query: 403 SGLNDIQNLVRKLQETVNHFDDCLNNFERNPQDIVWGREKGSVKIY 448
            GL D+Q LV  ++ TVN+ ++ + NF+RNPQ +++G +  +VK Y
Sbjct: 61  GGLRDVQTLVNDMRGTVNNLNETITNFDRNPQRLIFGGD--TVKQY 104


>gi|254804223|ref|YP_003082444.1| probable outer membrane transport protein [Neisseria meningitidis
           alpha14]
 gi|254667765|emb|CBA03697.1| probable outer membrane transport protein [Neisseria meningitidis
           alpha14]
          Length = 165

 Score =  100 bits (246), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 27/118 (22%), Positives = 46/118 (38%), Gaps = 2/118 (1%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRI-PGSVDGLSTDSSVR 59
           M+       VGLFV+       F  + ++    + G      +    G + GL  ++ V+
Sbjct: 1   MKKNILEFWVGLFVLIGAAAVGFLAFRVAGGAAFGGSDKTYAVYADFGDIGGLKVNAPVK 60

Query: 60  FNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTL 117
             G+ VGR+  + LD +    +  +  +          +A I T GL G  YI L   
Sbjct: 61  SAGVLVGRVGAIGLDPKSY-QARVRLDLDGKYQFSSDVSAQILTSGLLGEQYIGLQQG 117


>gi|15605967|ref|NP_213344.1| hypothetical protein aq_494 [Aquifex aeolicus VF5]
 gi|2983143|gb|AAC06746.1| putative protein [Aquifex aeolicus VF5]
          Length = 253

 Score =  100 bits (246), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 27/128 (21%), Positives = 51/128 (39%), Gaps = 4/128 (3%)

Query: 5   NYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRFNGIP 64
                +G FVV++     F +        +   M E ++     V GLS  + VR +G+ 
Sbjct: 40  TTELKLGAFVVAVSLAFAFLVLTFGEIPFFQPKMKEYLVYFDE-VAGLSKGAEVRVSGVR 98

Query: 65  VGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKEKKTI 124
            G++  + L+            ++ + P+Y    A+I T GL G  Y+ +     E   +
Sbjct: 99  AGKVKEIILE---RGKVKVVFEVKEEIPIYRDAIASIGTLGLMGDKYLAVKPGSPESGEL 155

Query: 125 FQIATERN 132
              +  +N
Sbjct: 156 PPRSEIKN 163


>gi|158521032|ref|YP_001528902.1| hypothetical protein Dole_1015 [Desulfococcus oleovorans Hxd3]
 gi|158509858|gb|ABW66825.1| Mammalian cell entry related domain protein [Desulfococcus
           oleovorans Hxd3]
          Length = 321

 Score =  100 bits (246), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 30/153 (19%), Positives = 65/153 (42%), Gaps = 2/153 (1%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M S      VGLF++  +  +  ++ ++  ++ Y    +  +     SV GL+ DS V++
Sbjct: 1   MASMRTNFIVGLFLIIGIAVTAATVIYVGATS-YFQKGSLYVSYFDESVQGLNKDSPVKY 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G+ +G++  + + ++          I PD      T A +++ G+ GI ++EL   +  
Sbjct: 60  RGVSIGQVHDIRISKDD-RLIEVMLRIDPDWKPGTDTIAQLKSIGITGIMFVELDLKKPG 118

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAEN 153
           +  +       +   +I   PS I   +     
Sbjct: 119 ESVLLPTPAHASTYPVIPTRPSDIRELLGGVTE 151


>gi|312797430|ref|YP_004030352.1| hypothetical protein RBRH_02223 [Burkholderia rhizoxinica HKI 454]
 gi|312169205|emb|CBW76208.1| Hypothetical exported protein [Burkholderia rhizoxinica HKI 454]
          Length = 345

 Score =  100 bits (246), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 55/306 (17%), Positives = 109/306 (35%), Gaps = 14/306 (4%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K++    GLF + +L     +I W    +          +    +V GL  D++VR+
Sbjct: 27  MENKSHAFWAGLFTIVLLVAIALTIAWF---SMDRTERVPYDLVATTNVTGLRADAAVRY 83

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G+ VG +  +  D   P   + + L+    PL  S+ A++  QG+ G+ +I+L     +
Sbjct: 84  RGLAVGNVQNIHFDTHRPGRIVIRILVDKRVPLTHSSFASLGLQGVTGLGFIQLDDTGDD 143

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
              +        Q  M        +         ++    +    Q   E   +    T 
Sbjct: 144 LHPLISSDENVAQIPMRPG--LFDDLQRRGVALLNQMEKIAVNLQQMTDEPNRRQYLATA 201

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
            +I+  ++ +A    H++ +      T    +       +     S      A +L +V 
Sbjct: 202 RSIQDAASGVAALTQHLEPVTRKLPDTIDELNRTMGSVNVLATSLSNPNGPVAANLNRVG 261

Query: 241 QILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAF 300
           Q  E   V+      S  ++         T +   E   +++ L  D    M+S  ++A 
Sbjct: 262 QAAEQAGVALAQLDTSMQEL---------TARVGYETLPRVNSLADDVRQAMRSVHSAAG 312

Query: 301 LENIAD 306
             N   
Sbjct: 313 AINANP 318



 Score = 44.5 bits (102), Expect = 0.033,   Method: Composition-based stats.
 Identities = 19/166 (11%), Positives = 51/166 (30%), Gaps = 5/166 (3%)

Query: 274 FQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNMRSSISAIREITDQRQKIISTIN 333
           F ++ ++   LL+       + +      N     +  RS   A   +    Q +     
Sbjct: 164 FDDLQRRGVALLNQMEKIAVNLQQMTDEPNRRQYLATARSIQDAASGVAALTQHLEPVTR 223

Query: 334 TIENITSNLNDSSQKFAELMSKINNISALKENNSLFKDAQRAMHTFRDTSEKINRYIPSI 393
            + +    LN +      L + ++N +       +  +  R           + +   S+
Sbjct: 224 KLPDTIDELNRTMGSVNVLATSLSNPNG-----PVAANLNRVGQAAEQAGVALAQLDTSM 278

Query: 394 GNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFERNPQDIVWG 439
                      L  + +L   +++ +            NP+ +++G
Sbjct: 279 QELTARVGYETLPRVNSLADDVRQAMRSVHSAAGAINANPRALLFG 324


>gi|57505620|ref|ZP_00371547.1| conserved hypothetical protein [Campylobacter upsaliensis RM3195]
 gi|57016167|gb|EAL52954.1| conserved hypothetical protein [Campylobacter upsaliensis RM3195]
          Length = 295

 Score =  100 bits (246), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 32/124 (25%), Positives = 57/124 (45%), Gaps = 1/124 (0%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K  Y  VG+F+  + F S   + WL   ++ +       I    SV GL   + VR 
Sbjct: 1   MENKASYFWVGIFIFGVFFASLIFMLWLGGYSEEESFEYY-EIHTQESVAGLGLKAPVRL 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G+ VG +  + +  +          ++ +TP+   T AT++ QG+ G+ +I+L      
Sbjct: 60  LGVEVGSVENISIYTKQNLEVNILIKVKKETPIKEDTFATLQLQGITGLKFIQLQGGSVN 119

Query: 121 KKTI 124
            K +
Sbjct: 120 SKKL 123


>gi|300692711|ref|YP_003753706.1| ABC-type transporter periplasmic component (resistance to organic
           solvents) [Ralstonia solanacearum PSI07]
 gi|299079771|emb|CBJ52448.1| putative ABC-type transporter, periplasmic component (resistance to
           organic solvents) [Ralstonia solanacearum PSI07]
          Length = 330

 Score =  100 bits (246), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 40/298 (13%), Positives = 105/298 (35%), Gaps = 6/298 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++ +    GLF + ++ F   ++ W +R            +    +V+GLS  +SV++
Sbjct: 1   MENRAHAFLAGLFTIGLVIFIALAVVWFNRDQTV---RVPYEVVTRSTVNGLSPQASVKY 57

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIE-LSTLRK 119
            G+ VG++  +  D + P   + + L+  D P+  +T   +  QG+ G+ Y++       
Sbjct: 58  RGLDVGKVDTIRFDDKVPGQIVVRVLVDKDAPITTTTYGRLAYQGVTGLAYVQLDDRGYD 117

Query: 120 EKKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTT 179
             +                       +     +   + ++   + +  +    +      
Sbjct: 118 GGRRAASPTRLETSDKHPARIAMEAGFLDELDKRGDQMLTKLDQTLSSLSALFDDEHRQA 177

Query: 180 IANIETISTVLANNISHIDKMMHTTQV--TPHSSDSKNTFNTITDLITSLDKMIKAIDLQ 237
           +           ++ + + +    T       + +   T      L  SL      +   
Sbjct: 178 LMAAMRSFQGTMDSYNALARQAEPTVRKLPQIADNLDATLAATRRLSQSLSDPKGPLMGT 237

Query: 238 KVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSK 295
             N   +    S +    ++     T+  +    +  ++  +  DH ++DF+++ +S 
Sbjct: 238 LANASSDLSSASQSMQAATNVLTYETLPQLNGFAREARQAVRSFDHAVTDFNTRPQSV 295



 Score = 39.5 bits (89), Expect = 1.1,   Method: Composition-based stats.
 Identities = 25/168 (14%), Positives = 57/168 (33%), Gaps = 12/168 (7%)

Query: 271 TQTFQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNMRSSISAIREITDQRQKIIS 330
                E+ ++ D +L+     + S       E+     + MRS    +       ++   
Sbjct: 142 AGFLDELDKRGDQMLTKLDQTLSSLSALFDDEHRQALMAAMRSFQGTMDSYNALARQAEP 201

Query: 331 TINTIENITSNLNDSSQKFAELMSKINNISALKENNSLFKDAQRAMHTFRDTSEKINRYI 390
           T+  +  I  NL+ +      L   +++                 M T  + S  ++   
Sbjct: 202 TVRKLPQIADNLDATLAATRRLSQSLSDPKG------------PLMGTLANASSDLSSAS 249

Query: 391 PSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFERNPQDIVW 438
            S+       +   L  +    R+ ++ V  FD  + +F   PQ +++
Sbjct: 250 QSMQAATNVLTYETLPQLNGFAREARQAVRSFDHAVTDFNTRPQSVLF 297


>gi|242241046|ref|YP_002989227.1| hypothetical protein Dd703_3648 [Dickeya dadantii Ech703]
 gi|242133103|gb|ACS87405.1| Mammalian cell entry related domain protein [Dickeya dadantii
           Ech703]
          Length = 190

 Score =  100 bits (246), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 26/146 (17%), Positives = 53/146 (36%), Gaps = 2/146 (1%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M++K +   VG F++  L    F    ++            +     ++ GL   S V+ 
Sbjct: 1   MQTKKHEIWVGAFMLIALVAILFLALKVADLKSLGNQQTYRLYATFDNIGGLKIRSPVKI 60

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDT-PLYPSTTATIRTQGLAGITYIELSTLRK 119
            G+ +GR+  + LD +          I      +  +++  IRT GL G  Y+ L+   +
Sbjct: 61  GGVVIGRVAEIGLDSKTY-LPRVALDIDRQYDHIPDTSSLAIRTSGLLGEQYLALNIGFE 119

Query: 120 EKKTIFQIATERNQRAMITATPSGIN 145
           +      I  +        +     +
Sbjct: 120 DADMGTSIFKDGGTIQDTKSAMVLED 145


>gi|222109933|ref|YP_002552197.1| mammalian cell entry related domain-containing protein [Acidovorax
           ebreus TPSY]
 gi|221729377|gb|ACM32197.1| Mammalian cell entry related domain protein [Acidovorax ebreus
           TPSY]
          Length = 161

 Score =  100 bits (246), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 24/122 (19%), Positives = 42/122 (34%), Gaps = 1/122 (0%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M+       VGLFV+       F     +     +      +     ++ GL   ++VR 
Sbjct: 1   MQHSKNDFWVGLFVLLGGAALVFLALQSANLLNLNFRSGYTVTARFDNIGGLKPKAAVRS 60

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G+ VGR+  +  D +    +     +         ++  I T GL G  YI +     E
Sbjct: 61  AGVVVGRVQSIGFD-DTTYQARVTLELEKRYVFPKDSSLKILTSGLLGDQYIGIEPGADE 119

Query: 121 KK 122
             
Sbjct: 120 NN 121


>gi|194290963|ref|YP_002006870.1| ABC transporter periplasmic protein [Cupriavidus taiwanensis LMG
           19424]
 gi|193224798|emb|CAQ70809.1| putative ABC-type transporter, periplasmic binding component
           [Cupriavidus taiwanensis LMG 19424]
          Length = 170

 Score =  100 bits (246), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 25/117 (21%), Positives = 41/117 (35%), Gaps = 1/117 (0%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M        VGLFV +      F        + +       +     ++ GL   + V+ 
Sbjct: 1   MRKNTLDFWVGLFVAAGFVALLFLALKAGNMSAFSFQDTYTVQARFDNIGGLKPRAPVKS 60

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTL 117
            G+ VGR+  +  D +    +  +  +         T+A I T GL G  YI L   
Sbjct: 61  AGVVVGRVAAIRFD-DKTYQATVEMSLETRYQFPKDTSAKILTSGLLGEQYIGLEAG 116


>gi|157164450|ref|YP_001466750.1| mce related protein [Campylobacter concisus 13826]
 gi|112799979|gb|EAT97323.1| putative ABC transport system periplasmic substrate-binding protein
           [Campylobacter concisus 13826]
          Length = 313

 Score =  100 bits (246), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 35/123 (28%), Positives = 57/123 (46%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++N YT VG+F ++ L      I+W++  N       E  I       GL  DS+V+F
Sbjct: 1   MENRNSYTIVGMFFIACLTAFAIFIWWMTSKNNTKVDFKEYYIHTTELPSGLKVDSTVKF 60

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G+P G +  +    +          IR D P+   + A+I  Q ++G+  I +S   K+
Sbjct: 61  IGVPAGSVSDINFVDDKNALINITMKIREDLPIKADSIASIEVQAISGVASINISRGTKD 120

Query: 121 KKT 123
            K 
Sbjct: 121 FKP 123


>gi|194100077|ref|YP_002003217.1| hypothetical protein NGK_2592 [Neisseria gonorrhoeae NCCP11945]
 gi|239998069|ref|ZP_04717993.1| hypothetical protein Ngon3_01093 [Neisseria gonorrhoeae 35/02]
 gi|240013250|ref|ZP_04720163.1| hypothetical protein NgonD_01135 [Neisseria gonorrhoeae DGI18]
 gi|240015697|ref|ZP_04722237.1| hypothetical protein NgonFA_00768 [Neisseria gonorrhoeae FA6140]
 gi|240079832|ref|ZP_04724375.1| hypothetical protein NgonF_00746 [Neisseria gonorrhoeae FA19]
 gi|240112040|ref|ZP_04726530.1| hypothetical protein NgonM_00380 [Neisseria gonorrhoeae MS11]
 gi|240114787|ref|ZP_04728849.1| hypothetical protein NgonPID1_00778 [Neisseria gonorrhoeae PID18]
 gi|240116988|ref|ZP_04731050.1| hypothetical protein NgonPID_00758 [Neisseria gonorrhoeae PID1]
 gi|240120322|ref|ZP_04733284.1| hypothetical protein NgonPI_00815 [Neisseria gonorrhoeae PID24-1]
 gi|240122626|ref|ZP_04735582.1| hypothetical protein NgonP_01541 [Neisseria gonorrhoeae PID332]
 gi|240124813|ref|ZP_04737699.1| hypothetical protein NgonSK_01075 [Neisseria gonorrhoeae SK-92-679]
 gi|240127330|ref|ZP_04739991.1| hypothetical protein NgonS_01540 [Neisseria gonorrhoeae SK-93-1035]
 gi|254492849|ref|ZP_05106020.1| outer membrane transporter [Neisseria gonorrhoeae 1291]
 gi|268593921|ref|ZP_06128088.1| conserved hypothetical protein [Neisseria gonorrhoeae 35/02]
 gi|268595977|ref|ZP_06130144.1| conserved hypothetical protein [Neisseria gonorrhoeae FA19]
 gi|268598098|ref|ZP_06132265.1| outer membrane transporter [Neisseria gonorrhoeae MS11]
 gi|268600441|ref|ZP_06134608.1| outer membrane transporter [Neisseria gonorrhoeae PID18]
 gi|268602672|ref|ZP_06136839.1| outer membrane transporter [Neisseria gonorrhoeae PID1]
 gi|268681222|ref|ZP_06148084.1| outer membrane transporter [Neisseria gonorrhoeae PID332]
 gi|268683392|ref|ZP_06150254.1| outer membrane transporter [Neisseria gonorrhoeae SK-92-679]
 gi|268685699|ref|ZP_06152561.1| outer membrane transporter [Neisseria gonorrhoeae SK-93-1035]
 gi|193935367|gb|ACF31191.1| Conserved hypothetical protein [Neisseria gonorrhoeae NCCP11945]
 gi|226511889|gb|EEH61234.1| outer membrane transporter [Neisseria gonorrhoeae 1291]
 gi|268547310|gb|EEZ42728.1| conserved hypothetical protein [Neisseria gonorrhoeae 35/02]
 gi|268549765|gb|EEZ44784.1| conserved hypothetical protein [Neisseria gonorrhoeae FA19]
 gi|268582229|gb|EEZ46905.1| outer membrane transporter [Neisseria gonorrhoeae MS11]
 gi|268584572|gb|EEZ49248.1| outer membrane transporter [Neisseria gonorrhoeae PID18]
 gi|268586803|gb|EEZ51479.1| outer membrane transporter [Neisseria gonorrhoeae PID1]
 gi|268621506|gb|EEZ53906.1| outer membrane transporter [Neisseria gonorrhoeae PID332]
 gi|268623676|gb|EEZ56076.1| outer membrane transporter [Neisseria gonorrhoeae SK-92-679]
 gi|268625983|gb|EEZ58383.1| outer membrane transporter [Neisseria gonorrhoeae SK-93-1035]
          Length = 164

 Score =  100 bits (246), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 27/118 (22%), Positives = 46/118 (38%), Gaps = 2/118 (1%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRI-PGSVDGLSTDSSVR 59
           M+       VGLFV+       F  + ++    + G      +    G + GL  ++ V+
Sbjct: 1   MKKNILEFWVGLFVLIGAAAVAFLAFRVAGGAAFGGSDKTYAVYADFGDIGGLKVNAPVK 60

Query: 60  FNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTL 117
             G+ VGR+  + LD +    +  +  +          +A I T GL G  YI L   
Sbjct: 61  SAGVLVGRVGAIGLDPKSY-QARVRLDLDGKYQFSSDVSAQILTSGLLGEQYIGLQQG 117


>gi|157803408|ref|YP_001491957.1| ABC transporter substrate binding protein [Rickettsia canadensis
           str. McKiel]
 gi|157784671|gb|ABV73172.1| ABC transporter substrate binding protein [Rickettsia canadensis
           str. McKiel]
          Length = 150

 Score = 99.6 bits (245), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 28/119 (23%), Positives = 48/119 (40%), Gaps = 3/119 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M+     T +G FVV I+   F    + +  +       +V      S +G++  S V  
Sbjct: 1   MKQNVIETIIG-FVVLIIVLLFLIFAYKTGYSITSSKGYQVTANF-QSAEGIAVGSDVMI 58

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRK 119
           +GI +G I  + LD     +++    I  D  +   + A + T GL G  YI +     
Sbjct: 59  SGIKIGSIKKITLDPNSF-YAIVYLNINDDVKIPKDSKAQVVTSGLFGSKYISIVPGND 116


>gi|289662618|ref|ZP_06484199.1| ABC transporter substrate-binding protein [Xanthomonas campestris
           pv. vasculorum NCPPB702]
 gi|289668437|ref|ZP_06489512.1| ABC transporter substrate-binding protein [Xanthomonas campestris
           pv. musacearum NCPPB4381]
          Length = 308

 Score = 99.6 bits (245), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 52/297 (17%), Positives = 99/297 (33%), Gaps = 13/297 (4%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K  Y  +G F +           W ++ +  D    +  +    +V GLS  S V++
Sbjct: 1   METKANYVLIGAFTIVAGLALLLFGLWAAKYSS-DRTWQQYRVVFREAVTGLSVGSPVQY 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NGI VG I  L L    P   +A   +   TP+   T A +    L G + I+LS    E
Sbjct: 60  NGIAVGSITELTLAPNDPRQVVAHVRVNSTTPIKSDTRAKLAITSLTGPSIIQLSGGTPE 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENI-------- 172
              +   A +++   +I  TPS +      A    +++            +         
Sbjct: 120 APAL--TAIDKSDAPIIQTTPSALQNITDTANRIVERMDQMLSDKNVASISATLQNLEKI 177

Query: 173 --EKPLTTTIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKM 230
                          +S   A              +     +       I + + +    
Sbjct: 178 SGGIADRDDGMQALIVSARDAARNLDTTLTTTNGTIKRLDQNLVQQLPGILEKLDATLVK 237

Query: 231 IKAIDLQKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSD 287
           + +      N + EN    ++       Q+  T+ ++R   +  + V  K+D+  + 
Sbjct: 238 LDSAAGNADNILGENRAAINSFANDGLGQLGPTLTELRGLIRDLRRVSDKLDNNPAR 294



 Score = 73.0 bits (176), Expect = 8e-11,   Method: Composition-based stats.
 Identities = 19/200 (9%), Positives = 70/200 (35%), Gaps = 3/200 (1%)

Query: 252 NFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNM 311
                + +        +      Q     + ++    +  ++  +     +N+A  ++ +
Sbjct: 112 QLSGGTPEAPALTAIDKSDAPIIQTTPSALQNITDTANRIVERMDQMLSDKNVASISATL 171

Query: 312 RSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNISALKENNSLFKD 371
           ++       I D+   + + I +  +   NL+ +       + +++    +++   + + 
Sbjct: 172 QNLEKISGGIADRDDGMQALIVSARDAARNLDTTLTTTNGTIKRLDQNL-VQQLPGILEK 230

Query: 372 AQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFER 431
               +      +   +  +      + +F+  GL  +   + +L+  +       +  + 
Sbjct: 231 LDATLVKLDSAAGNADNILGENRAAINSFANDGLGQLGPTLTELRGLIRDLRRVSDKLDN 290

Query: 432 NPQDIVWGREKGSVKIYKPK 451
           NP   + GR+    K ++PK
Sbjct: 291 NPARYLLGRDAP--KEFEPK 308


>gi|30250307|ref|NP_842377.1| mce related protein [Nitrosomonas europaea ATCC 19718]
 gi|30181102|emb|CAD86294.1| mce related protein [Nitrosomonas europaea ATCC 19718]
          Length = 159

 Score = 99.6 bits (245), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 25/122 (20%), Positives = 46/122 (37%), Gaps = 1/122 (0%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M+       VGLFV++ +         +     +    + V++    ++ GL   + V+ 
Sbjct: 1   MQRTMMDFWVGLFVMAGIGALLVLGLKVGNLTDFQPEGSYVLVGNFENIGGLKVRAPVKS 60

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G+ VGR+  +    +  +       +         T A+I T GL G  YI L     E
Sbjct: 61  AGVVVGRVTDIQFSVQTYDAV-VTMKVDTRYQFPKDTFASILTSGLLGEQYIGLLPGGDE 119

Query: 121 KK 122
           + 
Sbjct: 120 EM 121


>gi|85858834|ref|YP_461036.1| organic solvents resistance ABC transporter periplasmic protein
           [Syntrophus aciditrophicus SB]
 gi|85721925|gb|ABC76868.1| ABC-type transport system involved in resistance to organic
           solvents, periplasmic component [Syntrophus
           aciditrophicus SB]
          Length = 493

 Score = 99.6 bits (245), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 34/131 (25%), Positives = 55/131 (41%), Gaps = 4/131 (3%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M + +    VGLFV+  L    +  + + +          V +    +V GL  D+SV+ 
Sbjct: 1   MTAISSEAKVGLFVLVGLIILGYMSFRVGQQGFGLKKGYRVEVAF-DNVSGLEKDASVQI 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G+ +GR+  + L       ++    I PD  L     A+I+T G+ G  YIELS   K 
Sbjct: 60  AGVEMGRVESIRL---KDGKAMVTLRINPDVKLERDVMASIKTHGVLGDKYIELSPGTKG 116

Query: 121 KKTIFQIATER 131
           +  I       
Sbjct: 117 EGYIAPGGQIA 127


>gi|51246138|ref|YP_066022.1| hypothetical protein DP2286 [Desulfotalea psychrophila LSv54]
 gi|50877175|emb|CAG37015.1| conserved hypothetical protein [Desulfotalea psychrophila LSv54]
          Length = 173

 Score = 99.6 bits (245), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 28/122 (22%), Positives = 49/122 (40%), Gaps = 2/122 (1%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M  K     VG+F+++     F+    L  ++        +      SV GL   + V  
Sbjct: 24  MVQKKIEFYVGVFIIAGCLCFFWLFTALGGADWNRSDKYPI-FGFFTSVSGLKVGAEVEM 82

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G+ +GR+  + LD      +  +  +  +  L   T A+++T G+ G  YI LS    E
Sbjct: 83  AGVEIGRVKSIILDTTRY-VAKVELSLNKEVELSDDTIASVKTSGIIGDKYINLSAGGSE 141

Query: 121 KK 122
             
Sbjct: 142 DM 143


>gi|237747196|ref|ZP_04577676.1| predicted protein [Oxalobacter formigenes HOxBLS]
 gi|229378547|gb|EEO28638.1| predicted protein [Oxalobacter formigenes HOxBLS]
          Length = 293

 Score = 99.6 bits (245), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 37/135 (27%), Positives = 64/135 (47%), Gaps = 3/135 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K++    GLF V  L  +   I W    ++        +I    S+ GL+  ++VRF
Sbjct: 2   MENKSHAFIAGLFTV-CLVAAALLIVWFLNMDRTVR--VPYMIATNQSIPGLNPQATVRF 58

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G+ VGR+  +  + + P   L    ++ DTP+  ST AT+  QG+ GI  +ELS    +
Sbjct: 59  RGLDVGRVTNIGFNPKEPGEILIHFEVKEDTPMTKSTFATLTYQGVTGIASVELSDDGSD 118

Query: 121 KKTIFQIATERNQRA 135
           ++ +        +  
Sbjct: 119 REKLVTSPENPAEIP 133


>gi|218245389|ref|YP_002370760.1| Mammalian cell entry related domain-containing protein [Cyanothece
           sp. PCC 8801]
 gi|257058425|ref|YP_003136313.1| hypothetical protein Cyan8802_0530 [Cyanothece sp. PCC 8802]
 gi|218165867|gb|ACK64604.1| Mammalian cell entry related domain protein [Cyanothece sp. PCC
           8801]
 gi|256588591|gb|ACU99477.1| Mammalian cell entry related domain protein [Cyanothece sp. PCC
           8802]
          Length = 465

 Score = 99.6 bits (245), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 54/428 (12%), Positives = 125/428 (29%), Gaps = 46/428 (10%)

Query: 10  VGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRFNGIPVGRIV 69
           VGLF +  L      + WL           ++       V GL   + V F G+ VG+I 
Sbjct: 12  VGLFALIGLVLFGGLVIWLRG-GVLGQKPYQIQANF-QDVSGLQIGAPVNFRGVAVGKIT 69

Query: 70  GLFLDQEYPNHSLAKALI-RPDTPLYPSTTATIRTQGLAGITYIELSTLRKEKKTIFQIA 128
            L               +   +  +   +T  I   GL G   ++++    EK +   +A
Sbjct: 70  ALQASSNG---VTVLIEVSSRELRIPIGSTIQINRYGLIGEASVDITP--SEKLSDQALA 124

Query: 129 TERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTIANIETIST 188
            +              +    + E  S+ +   +R      +                  
Sbjct: 125 VDPTSEECPDKQLIICDNDTLDGETGSQLVQALTRLSNAYSDP----------------- 167

Query: 189 VLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVNQILENIQV 248
                   + ++         +       +    + +   +       Q + QI +  + 
Sbjct: 168 ------EFVKELKGAFTSVAQAGTKIGKLSDEAAIFSKTARREIQGTSQTIAQINQAARD 221

Query: 249 SSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAFLENIADST 308
           +S      +  V      +         +   ++ L+S+    + +        N  + T
Sbjct: 222 ASQLMRNVNTVVSENRESLNRAVNNAASLVNNLNGLVSENRGNVINT------LNSLERT 275

Query: 309 SNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNISALKENNSL 368
           S+    ++     T  +         I+ I  +L       AE  + + +IS    + ++
Sbjct: 276 SDEVRMVAIGLGKTVNKVNSGIDEVNIKKIARDLEILMANAAETSANLRDISQSFNDPTV 335

Query: 369 FKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNN 428
               Q+ + + R T E   +    +     +               +++ +N   + L+ 
Sbjct: 336 ILTVQKTLDSARATFENAQKITSDVEELTGD---------PAFRDNVRKLINGLSNLLSY 386

Query: 429 FERNPQDI 436
             +  Q I
Sbjct: 387 TNQLEQQI 394


>gi|85373089|ref|YP_457151.1| ABC-type transport system periplasmic component [Erythrobacter
           litoralis HTCC2594]
 gi|84786172|gb|ABC62354.1| ABC-type transport system periplasmic component [Erythrobacter
           litoralis HTCC2594]
          Length = 316

 Score = 99.6 bits (245), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 48/297 (16%), Positives = 99/297 (33%), Gaps = 6/297 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++  +  VG   +++L      I W++R N+  G   E  I    SV GL+T S V F
Sbjct: 1   METRANHIWVGAVSLALLAALAAFIIWIARFNE--GNQNEYDIFFQQSVSGLATGSQVSF 58

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITY--IELSTLR 118
            G+PVG++  + L +  P     +  ++ + P+   TTATI+       T          
Sbjct: 59  AGVPVGQVSQIALWERDPEFVRVRIRVQEEVPILIGTTATIQGSFTGVSTILLDGARAGA 118

Query: 119 KEKKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTT 178
                    A       + T          +      +  + + R    + ++ +  LT 
Sbjct: 119 PPIACDEASACPEGVPVIPTKPGGLGELLANAPLLLERLATLTERLTLTLSDDNQAALTG 178

Query: 179 TIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSL--DKMIKAIDL 236
            +AN   ++  LA     I+  +   ++T   +             T    ++  +A+ +
Sbjct: 179 ILANTNAMTEDLARATPRIEATLAELEITLREAGETLDAFESVTQSTDQLINQEGQALAV 238

Query: 237 QKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMK 293
           +    +        +      +          +T        Q +        +  +
Sbjct: 239 ELRGTLKSAAGALDSLGKTLEEAQPAARQLNNQTLPAANATLQDLRETSRALRAVTE 295


>gi|58580427|ref|YP_199443.1| hypothetical protein XOO0804 [Xanthomonas oryzae pv. oryzae
           KACC10331]
 gi|84622389|ref|YP_449761.1| hypothetical protein XOO_0732 [Xanthomonas oryzae pv. oryzae MAFF
           311018]
 gi|188578636|ref|YP_001915565.1| ABC transporter substrate-binding protein [Xanthomonas oryzae pv.
           oryzae PXO99A]
 gi|58425021|gb|AAW74058.1| conserved hypothetical protein [Xanthomonas oryzae pv. oryzae
           KACC10331]
 gi|84366329|dbj|BAE67487.1| conserved hypothetical protein [Xanthomonas oryzae pv. oryzae MAFF
           311018]
 gi|188523088|gb|ACD61033.1| ABC transporter substrate-binding protein [Xanthomonas oryzae pv.
           oryzae PXO99A]
          Length = 308

 Score = 99.6 bits (245), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 56/304 (18%), Positives = 109/304 (35%), Gaps = 11/304 (3%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K  Y  +G F +           W ++ +  D    +  +    +V GLS  S V++
Sbjct: 1   METKANYVLIGAFTIVAGLALLLFGLWAAKYSS-DRTWQQYRVVFREAVTGLSVGSPVQY 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NGI VG I  L L    P   +A   +   TP+   T A +    L G + I+LS    E
Sbjct: 60  NGIAVGSITELTLAPNDPRQVVALVRVNSTTPIKSDTRAKLAITSLTGPSIIQLSGGTPE 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
              +     +++   +I  TPS +      A           R  Q + +     ++ T+
Sbjct: 120 APAL--TTIDKSDAPIIQTTPSALQNITDTAN------RIVERMDQMLSDKNVASISATL 171

Query: 181 ANIETISTVLANNISHIDKMMHTTQV--TPHSSDSKNTFNTITDLITSLDKMIKAIDLQK 238
            N+E IS  +A++   +  ++ + +       +    T  TI  L  +L + +  I  + 
Sbjct: 172 QNLEKISGGIADHDDGMQALIVSARDAARNLDTTLTTTNGTIKRLDQNLVQQLPGILEKL 231

Query: 239 VNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETS 298
              +++    + N      +          +          ++  L+ D        + +
Sbjct: 232 DATLVKLDSAAGNADNILGENRAAINSFANDGLGQLGPTLTELRGLIRDLRRVSDKLDNN 291

Query: 299 AFLE 302
               
Sbjct: 292 PARY 295



 Score = 73.0 bits (176), Expect = 9e-11,   Method: Composition-based stats.
 Identities = 19/200 (9%), Positives = 69/200 (34%), Gaps = 3/200 (1%)

Query: 252 NFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNM 311
                + +        +      Q     + ++    +  ++  +     +N+A  ++ +
Sbjct: 112 QLSGGTPEAPALTTIDKSDAPIIQTTPSALQNITDTANRIVERMDQMLSDKNVASISATL 171

Query: 312 RSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNISALKENNSLFKD 371
           ++       I D    + + I +  +   NL+ +       + +++    +++   + + 
Sbjct: 172 QNLEKISGGIADHDDGMQALIVSARDAARNLDTTLTTTNGTIKRLDQNL-VQQLPGILEK 230

Query: 372 AQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFER 431
               +      +   +  +      + +F+  GL  +   + +L+  +       +  + 
Sbjct: 231 LDATLVKLDSAAGNADNILGENRAAINSFANDGLGQLGPTLTELRGLIRDLRRVSDKLDN 290

Query: 432 NPQDIVWGREKGSVKIYKPK 451
           NP   + GR+    K ++PK
Sbjct: 291 NPARYLLGRDAP--KEFEPK 308


>gi|260441400|ref|ZP_05795216.1| hypothetical protein NgonDG_10020 [Neisseria gonorrhoeae DGI2]
          Length = 164

 Score = 99.6 bits (245), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 27/118 (22%), Positives = 46/118 (38%), Gaps = 2/118 (1%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRI-PGSVDGLSTDSSVR 59
           M+       VGLFV+       F  + ++    + G      +    G + GL  ++ V+
Sbjct: 1   MKKNILEFWVGLFVLIGAAAVAFLAFRVAGGAAFGGSDKTYAVYADFGDIGGLKVNAPVK 60

Query: 60  FNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTL 117
             G+ VGR+  + LD +    +  +  +          +A I T GL G  YI L   
Sbjct: 61  SAGVLVGRVGAIGLDPKSY-QARVRLDLDGKYQFSSDVSAQILTSGLLGEQYIGLQQG 117


>gi|15677794|ref|NP_274958.1| hypothetical protein NMB1964 [Neisseria meningitidis MC58]
 gi|218767465|ref|YP_002341977.1| putative outer membrane transport protein [Neisseria meningitidis
           Z2491]
 gi|7227224|gb|AAF42293.1| conserved hypothetical protein [Neisseria meningitidis MC58]
 gi|121051473|emb|CAM07766.1| putative outer membrane transport protein [Neisseria meningitidis
           Z2491]
 gi|254672982|emb|CBA07461.1| mce related protein [Neisseria meningitidis alpha275]
 gi|261393292|emb|CAX50920.1| conserved hypothetical integral membrane protein [Neisseria
           meningitidis 8013]
 gi|316985592|gb|EFV64539.1| mce related family protein [Neisseria meningitidis H44/76]
 gi|325129425|gb|EGC52256.1| mce family protein [Neisseria meningitidis OX99.30304]
 gi|325137488|gb|EGC60073.1| mce family protein [Neisseria meningitidis ES14902]
 gi|325201012|gb|ADY96467.1| mce family protein [Neisseria meningitidis H44/76]
 gi|325201399|gb|ADY96853.1| mce family protein [Neisseria meningitidis M01-240149]
 gi|325207380|gb|ADZ02832.1| mce family protein [Neisseria meningitidis NZ-05/33]
          Length = 164

 Score = 99.6 bits (245), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 27/118 (22%), Positives = 46/118 (38%), Gaps = 2/118 (1%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRI-PGSVDGLSTDSSVR 59
           M+       VGLFV+       F  + ++    + G      +    G + GL  ++ V+
Sbjct: 1   MKKNILEFWVGLFVLIGAAAVAFLAFRVAGGAAFGGSDKTYAVYADFGDIGGLKVNAPVK 60

Query: 60  FNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTL 117
             G+ VGR+  + LD +    +  +  +          +A I T GL G  YI L   
Sbjct: 61  SAGVLVGRVGAIGLDPKSY-QARVRLDLDGKYQFSSDVSAQILTSGLLGEQYIGLQQG 117


>gi|94309015|ref|YP_582225.1| hypothetical protein Rmet_0070 [Cupriavidus metallidurans CH34]
 gi|93352867|gb|ABF06956.1| ABC-type transporter, periplasmic component [Cupriavidus
           metallidurans CH34]
          Length = 313

 Score = 99.6 bits (245), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 44/297 (14%), Positives = 107/297 (36%), Gaps = 5/297 (1%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K+     G+F + +      S++W S  +          +    +V+GL   + V++
Sbjct: 1   MENKSNAFLAGVFTIGLAILVSVSLFWFSSDHTV---RVPYDLITRSTVNGLGPQADVKY 57

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G+ VG+++ +  D + P   + +  I  DTP+  +T AT+  QG+ GI Y++L    + 
Sbjct: 58  RGLEVGKVLSIKFDPQVPGQIIVRISINHDTPITRTTYATLGFQGVTGIAYVQLDDSERT 117

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
           +                        +F    +     ++ +   +  +    +      +
Sbjct: 118 EGDTSSSPRLTTSAREPARIVMRPGFFEELEKRGDSLLTQAETLMASLDSMFQPANRDEL 177

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
                     A++ SH+   +         +        ++    + +       + +  
Sbjct: 178 MAAIRAVHKTADDYSHLKSTLQPAAEKLPKAVDNLNAALVSTKRLTDEIGNPDGTVMRTV 237

Query: 241 QILENIQVSSNNFVKSSDQV--INTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSK 295
             + N    + + V+S+  +    T+  +    +  ++  + ID   S F+ K  S 
Sbjct: 238 NRVGNDLQVAADSVQSTTTIVNQETLPQINGLARESRQAVRSIDRAASQFNDKPSSV 294


>gi|304388520|ref|ZP_07370623.1| ABC superfamily ATP binding cassette transporter, binding protein
           [Neisseria meningitidis ATCC 13091]
 gi|304337517|gb|EFM03683.1| ABC superfamily ATP binding cassette transporter, binding protein
           [Neisseria meningitidis ATCC 13091]
 gi|325131370|gb|EGC54079.1| mce family protein [Neisseria meningitidis M6190]
 gi|325135555|gb|EGC58173.1| mce family protein [Neisseria meningitidis M0579]
 gi|325139614|gb|EGC62154.1| mce family protein [Neisseria meningitidis CU385]
          Length = 182

 Score = 99.6 bits (245), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 27/118 (22%), Positives = 46/118 (38%), Gaps = 2/118 (1%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRI-PGSVDGLSTDSSVR 59
           M+       VGLFV+       F  + ++    + G      +    G + GL  ++ V+
Sbjct: 19  MKKNILEFWVGLFVLIGAAAVAFLAFRVAGGAAFGGSDKTYAVYADFGDIGGLKVNAPVK 78

Query: 60  FNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTL 117
             G+ VGR+  + LD +    +  +  +          +A I T GL G  YI L   
Sbjct: 79  SAGVLVGRVGAIGLDPKSY-QARVRLDLDGKYQFSSDVSAQILTSGLLGEQYIGLQQG 135


>gi|161869246|ref|YP_001598413.1| putative ABC transport system substrate-binding protein [Neisseria
           meningitidis 053442]
 gi|161594799|gb|ABX72459.1| putative ABC transport system substrate-binding protein [Neisseria
           meningitidis 053442]
 gi|308390062|gb|ADO32382.1| putative ABC transport ATP-binding protein [Neisseria meningitidis
           alpha710]
          Length = 164

 Score = 99.6 bits (245), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 27/118 (22%), Positives = 46/118 (38%), Gaps = 2/118 (1%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRI-PGSVDGLSTDSSVR 59
           M+       VGLFV+       F  + ++    + G      +    G + GL  ++ V+
Sbjct: 1   MKKNILEFWVGLFVLIGAAAVGFLAFRVAGGAAFGGSDKTYAVYADFGDIGGLKVNAPVK 60

Query: 60  FNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTL 117
             G+ VGR+  + LD +    +  +  +          +A I T GL G  YI L   
Sbjct: 61  SAGVLVGRVGAIGLDPKSY-QARVRLDLDGKYQFSSDVSAQILTSGLLGEQYIGLQQG 117


>gi|293397854|ref|ZP_06642060.1| ABC transport system substrate-binding protein [Neisseria
           gonorrhoeae F62]
 gi|291611800|gb|EFF40869.1| ABC transport system substrate-binding protein [Neisseria
           gonorrhoeae F62]
          Length = 178

 Score = 99.6 bits (245), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 27/118 (22%), Positives = 46/118 (38%), Gaps = 2/118 (1%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRI-PGSVDGLSTDSSVR 59
           M+       VGLFV+       F  + ++    + G      +    G + GL  ++ V+
Sbjct: 15  MKKNILEFWVGLFVLIGAAAVAFLAFRVAGGAAFGGSDKTYAVYADFGDIGGLKVNAPVK 74

Query: 60  FNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTL 117
             G+ VGR+  + LD +    +  +  +          +A I T GL G  YI L   
Sbjct: 75  SAGVLVGRVGAIGLDPKSY-QARVRLDLDGKYQFSSDVSAQILTSGLLGEQYIGLQQG 131


>gi|261401681|ref|ZP_05987806.1| toluene tolerance ABC transporter, periplasmic substrate-binding
           protein [Neisseria lactamica ATCC 23970]
 gi|269208207|gb|EEZ74662.1| toluene tolerance ABC transporter, periplasmic substrate-binding
           protein [Neisseria lactamica ATCC 23970]
          Length = 165

 Score = 99.6 bits (245), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 27/118 (22%), Positives = 46/118 (38%), Gaps = 2/118 (1%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRI-PGSVDGLSTDSSVR 59
           M+       VGLFV+       F  + ++    + G      +    G + GL  ++ V+
Sbjct: 1   MKKNVLEFWVGLFVLLGAAAVAFLAFRVAGGAAFGGSDKTYAVYADFGDIGGLKVNAPVK 60

Query: 60  FNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTL 117
             G+ VGR+  + LD +    +  +  +          +A I T GL G  YI L   
Sbjct: 61  SAGVLVGRVGAIGLDPKSY-QAKVRLDLDGKYQFSSDVSAQILTSGLLGEQYIGLQQG 117


>gi|320354121|ref|YP_004195460.1| Mammalian cell entry related domain-containing protein
           [Desulfobulbus propionicus DSM 2032]
 gi|320122623|gb|ADW18169.1| Mammalian cell entry related domain protein [Desulfobulbus
           propionicus DSM 2032]
          Length = 150

 Score = 99.6 bits (245), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 23/133 (17%), Positives = 53/133 (39%), Gaps = 2/133 (1%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M +      VG F+V       +    L       G    ++     ++ G+   + V+ 
Sbjct: 1   MTNARVELFVGFFLVVGFLALGWLALQLGEVPWLTGAKTYLLHAEFNNISGVKPGADVQI 60

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G+ VG++  L L+++    ++    I  +  +   + A++++QG+ G  YI+++    E
Sbjct: 61  AGVTVGKVRQLHLNED--RQAVVTMQIDREVVVPVDSIASVKSQGIIGDKYIQITLGGDE 118

Query: 121 KKTIFQIATERNQ 133
                  A    +
Sbjct: 119 TAYKPGEAIVDTE 131


>gi|218782262|ref|YP_002433580.1| Mammalian cell entry related domain protein [Desulfatibacillum
           alkenivorans AK-01]
 gi|218763646|gb|ACL06112.1| Mammalian cell entry related domain protein [Desulfatibacillum
           alkenivorans AK-01]
          Length = 148

 Score = 99.6 bits (245), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 32/133 (24%), Positives = 58/133 (43%), Gaps = 2/133 (1%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M  ++    VG+FV+  L    +    + R +   G   +V  R   SV+GL T + V+ 
Sbjct: 1   MGKQSIELVVGVFVLVCLLCVAYLTVKVGRMDVLGGDTYQVSARF-QSVEGLKTGADVQI 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G+ VG++  + +D      ++    +     L   T A++RT GL G  YI+L+    +
Sbjct: 60  AGVGVGKVSNVIIDP-MDLVAVVTLQVDKGIELTEDTIASVRTAGLIGDKYIKLTPGGAD 118

Query: 121 KKTIFQIATERNQ 133
           +        E  +
Sbjct: 119 EVLQDGDQIEETE 131


>gi|153871246|ref|ZP_02000469.1| mce related protein [Beggiatoa sp. PS]
 gi|152072291|gb|EDN69534.1| mce related protein [Beggiatoa sp. PS]
          Length = 163

 Score = 99.6 bits (245), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 24/122 (19%), Positives = 42/122 (34%), Gaps = 2/122 (1%)

Query: 2   ESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRFN 61
            ++     VG+FV             +S             I    ++ GL   S V+  
Sbjct: 3   STRTIEIWVGIFVAIGFAALLMLSMKVSHLGDLFADKGYATIAKFDNIGGLKVKSPVKMA 62

Query: 62  GIPVGRIVGLFLDQEYPNHSLAKALIRPDT-PLYPSTTATIRTQGLAGITYIELSTLRKE 120
           G+ +GR+  +  D +    ++    I      +   ++  I T GL G  YI L    +E
Sbjct: 63  GVRIGRVAEIQFD-DSFYQAIVTMHIENQYSKIPTDSSVNIFTAGLLGEQYIGLEAGAEE 121

Query: 121 KK 122
             
Sbjct: 122 DY 123


>gi|82703860|ref|YP_413426.1| hypothetical protein Nmul_A2747 [Nitrosospira multiformis ATCC
           25196]
 gi|82411925|gb|ABB76034.1| Mammalian cell entry related protein [Nitrosospira multiformis ATCC
           25196]
          Length = 161

 Score = 99.6 bits (245), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 27/117 (23%), Positives = 45/117 (38%), Gaps = 1/117 (0%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M+       VGLFV++ +         +     Y    +  +     ++ GL   + V+ 
Sbjct: 1   MQRATMDLWVGLFVMAGIGALLVLALKVGNLGTYSASDSYQVTGNFENIGGLKVRAPVKS 60

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTL 117
            G+ VGR+  +    E  + +L    I         T A+I T GL G  YI L+  
Sbjct: 61  AGVVVGRVTDIRFSTETYD-ALVIMNIDSRYKFPKDTFASILTSGLIGEQYIGLAAG 116


>gi|291044758|ref|ZP_06570467.1| conserved hypothetical protein [Neisseria gonorrhoeae DGI2]
 gi|291011652|gb|EFE03648.1| conserved hypothetical protein [Neisseria gonorrhoeae DGI2]
          Length = 178

 Score = 99.2 bits (244), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 27/118 (22%), Positives = 46/118 (38%), Gaps = 2/118 (1%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRI-PGSVDGLSTDSSVR 59
           M+       VGLFV+       F  + ++    + G      +    G + GL  ++ V+
Sbjct: 15  MKKNILEFWVGLFVLIGAAAVAFLAFRVAGGAAFGGSDKTYAVYADFGDIGGLKVNAPVK 74

Query: 60  FNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTL 117
             G+ VGR+  + LD +    +  +  +          +A I T GL G  YI L   
Sbjct: 75  SAGVLVGRVGAIGLDPKSY-QARVRLDLDGKYQFSSDVSAQILTSGLLGEQYIGLQQG 131


>gi|207727755|ref|YP_002256149.1| abc-type transport system involved in resistance to organic
           solvents, periplasmic component protein [Ralstonia
           solanacearum MolK2]
 gi|206590996|emb|CAQ56608.1| abc-type transport system involved in resistance to organic
           solvents, periplasmic component protein [Ralstonia
           solanacearum MolK2]
          Length = 333

 Score = 99.2 bits (244), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 39/298 (13%), Positives = 102/298 (34%), Gaps = 6/298 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++ +    GLF + +  F   ++ W +R            +    +V+GLS  ++V++
Sbjct: 1   MENRAHAFLAGLFTIGLAIFVALAVVWFNRDQTV---RVPYDVVTRSTVNGLSPQAAVKY 57

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIE-LSTLRK 119
            G+ VG++  +  D + P   + + L+  D P+  +T   +  QG+ G+ Y++       
Sbjct: 58  RGLDVGKVDTIRFDDKVPGQIIVRVLVDKDAPITTTTYGRLAYQGVTGLAYVQLDDRGYD 117

Query: 120 EKKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTT 179
             K                       +     +   + ++   + +  +   ++      
Sbjct: 118 SGKRAGNPTRLETSDRRPARIAMEAGFLDELDKRGDQMLTRLDQTLGSLATMLDDEHRQA 177

Query: 180 IANIETISTVLANNISHIDKMMHTTQV--TPHSSDSKNTFNTITDLITSLDKMIKAIDLQ 237
           +           ++   + +            + +   T      L  SL      +   
Sbjct: 178 LMAAVHAFQGTMDSYGALARQAEPAMRKLPQIADNLDATLAATRRLSQSLSDPKGPLMGT 237

Query: 238 KVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSK 295
             +   +    S +    +      T+  +    +  ++  +  DH ++DF+S+ +S 
Sbjct: 238 LASAGSDLSSASQSMQAATQALTYETLPQLNGVAREARQAVRSFDHAVTDFNSRPQSV 295



 Score = 50.3 bits (117), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 18/133 (13%), Positives = 46/133 (34%), Gaps = 2/133 (1%)

Query: 314 SISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNISALKE--NNSLFKD 371
                + +         T+++   +      + +K  ++   ++   A     + SL   
Sbjct: 171 DDEHRQALMAAVHAFQGTMDSYGALARQAEPAMRKLPQIADNLDATLAATRRLSQSLSDP 230

Query: 372 AQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFER 431
               M T       ++    S+    Q  +   L  +  + R+ ++ V  FD  + +F  
Sbjct: 231 KGPLMGTLASAGSDLSSASQSMQAATQALTYETLPQLNGVAREARQAVRSFDHAVTDFNS 290

Query: 432 NPQDIVWGREKGS 444
            PQ +++G    +
Sbjct: 291 RPQSVLFGPAPAT 303


>gi|270263238|ref|ZP_06191508.1| hypothetical protein SOD_d02550 [Serratia odorifera 4Rx13]
 gi|270042926|gb|EFA16020.1| hypothetical protein SOD_d02550 [Serratia odorifera 4Rx13]
          Length = 183

 Score = 99.2 bits (244), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 27/146 (18%), Positives = 53/146 (36%), Gaps = 2/146 (1%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M++K     VG F++  L    F    ++            I     ++ GL   S V+ 
Sbjct: 1   MQTKKSEIWVGAFMLIALCAIVFLCLQVANIKSIGNEPTYRIYATFDNIGGLKARSPVKI 60

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDT-PLYPSTTATIRTQGLAGITYIELSTLRK 119
            G+ +GR+  + LD +          I+     +  +++  IRT GL G  Y+ L+   +
Sbjct: 61  GGVVIGRVADISLDPKTYTP-RVALDIQDKFNQIPDTSSLAIRTSGLLGEQYLALNVGFE 119

Query: 120 EKKTIFQIATERNQRAMITATPSGIN 145
           +      I  +        +     +
Sbjct: 120 DPDMGTTILKDGGTIQDTKSAMVLED 145


>gi|166713441|ref|ZP_02244648.1| hypothetical protein Xoryp_18880 [Xanthomonas oryzae pv. oryzicola
           BLS256]
          Length = 308

 Score = 99.2 bits (244), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 56/304 (18%), Positives = 108/304 (35%), Gaps = 11/304 (3%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K  Y  +G F +           W ++ +  D    +  +    +V GLS  S V++
Sbjct: 1   METKANYVLIGAFTIVAGLALLLFGLWAAKYSS-DRTWQQYRVVFREAVTGLSVGSPVQY 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NGI VG I  L L    P   +A   +   TP+   T A +    L G + I+LS    E
Sbjct: 60  NGIAVGSITELTLAPNDPRQVVAHVRVNSTTPIKSDTRAKLAITSLTGPSIIQLSGGTPE 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
              +     +++   +I  TPS +      A           R  Q + +     ++ T+
Sbjct: 120 APAL--TTIDKSDAPIIQTTPSALQNITDTAN------RIVERMDQMLSDKNVASISATL 171

Query: 181 ANIETISTVLANNISHIDKMMHTTQV--TPHSSDSKNTFNTITDLITSLDKMIKAIDLQK 238
            N+E IS  +A+    +  ++ + +       +    T  TI  L  +L + +  I  + 
Sbjct: 172 QNLEKISGGIADRDDGVQALIISARDAARNLDTTLTTTNGTIKRLDQNLVQQLPGILEKL 231

Query: 239 VNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETS 298
              +++    + N      +          +          ++  L+ D        + +
Sbjct: 232 DATLVKLDSAAGNADNILGENRAAINSFANDGLGQLGPTLTELRGLIRDLRRVSDKLDNN 291

Query: 299 AFLE 302
               
Sbjct: 292 PARY 295



 Score = 73.0 bits (176), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 19/200 (9%), Positives = 70/200 (35%), Gaps = 3/200 (1%)

Query: 252 NFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNM 311
                + +        +      Q     + ++    +  ++  +     +N+A  ++ +
Sbjct: 112 QLSGGTPEAPALTTIDKSDAPIIQTTPSALQNITDTANRIVERMDQMLSDKNVASISATL 171

Query: 312 RSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNISALKENNSLFKD 371
           ++       I D+   + + I +  +   NL+ +       + +++    +++   + + 
Sbjct: 172 QNLEKISGGIADRDDGVQALIISARDAARNLDTTLTTTNGTIKRLDQNL-VQQLPGILEK 230

Query: 372 AQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFER 431
               +      +   +  +      + +F+  GL  +   + +L+  +       +  + 
Sbjct: 231 LDATLVKLDSAAGNADNILGENRAAINSFANDGLGQLGPTLTELRGLIRDLRRVSDKLDN 290

Query: 432 NPQDIVWGREKGSVKIYKPK 451
           NP   + GR+    K ++PK
Sbjct: 291 NPARYLLGRDTP--KEFEPK 308


>gi|21230108|ref|NP_636025.1| hypothetical protein XCC0633 [Xanthomonas campestris pv. campestris
           str. ATCC 33913]
 gi|66769901|ref|YP_244663.1| hypothetical protein XC_3601 [Xanthomonas campestris pv. campestris
           str. 8004]
 gi|21111636|gb|AAM39949.1| conserved hypothetical protein [Xanthomonas campestris pv.
           campestris str. ATCC 33913]
 gi|66575233|gb|AAY50643.1| conserved hypothetical protein [Xanthomonas campestris pv.
           campestris str. 8004]
          Length = 308

 Score = 99.2 bits (244), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 51/297 (17%), Positives = 98/297 (32%), Gaps = 13/297 (4%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K  Y  +G F +           W ++ +  D    +  +    +V GLS  S V++
Sbjct: 1   METKANYVLIGAFTIVAGLALLLFGLWAAKYSS-DRTWQQYRVVFREAVTGLSVGSPVQY 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NGI VG I  L L    P   +A   +   TP+   T A +    L G + I+LS    E
Sbjct: 60  NGIAVGSITELTLAPNDPRQVVAHVRVNSTTPIKSDTRAKLAITSLTGPSIIQLSGGTPE 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENI-------- 172
             ++     +++   +I  TPS +      A    +++                      
Sbjct: 120 APSL--TTIDKSDAPIIQTTPSALQNITDTANRIVERMDQMLSDKNVASITATLQNLEKI 177

Query: 173 --EKPLTTTIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKM 230
                          +S   A              +     +       I + + +    
Sbjct: 178 SGGIADRDEGMQALIVSARDAARNLDTTLTTTNGTIKRLDQNLVQQLPGILEKLDATLVK 237

Query: 231 IKAIDLQKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSD 287
           + +      N + EN    ++       Q+  T+ ++R   +  + V  K+D+  + 
Sbjct: 238 LDSAAGNADNILGENRAAINSFANDGLGQLGPTLTELRGLIRDLRRVSDKLDNNPAR 294



 Score = 73.0 bits (176), Expect = 8e-11,   Method: Composition-based stats.
 Identities = 20/200 (10%), Positives = 72/200 (36%), Gaps = 3/200 (1%)

Query: 252 NFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNM 311
                + +  +     +      Q     + ++    +  ++  +     +N+A  T+ +
Sbjct: 112 QLSGGTPEAPSLTTIDKSDAPIIQTTPSALQNITDTANRIVERMDQMLSDKNVASITATL 171

Query: 312 RSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNISALKENNSLFKD 371
           ++       I D+ + + + I +  +   NL+ +       + +++    +++   + + 
Sbjct: 172 QNLEKISGGIADRDEGMQALIVSARDAARNLDTTLTTTNGTIKRLDQNL-VQQLPGILEK 230

Query: 372 AQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFER 431
               +      +   +  +      + +F+  GL  +   + +L+  +       +  + 
Sbjct: 231 LDATLVKLDSAAGNADNILGENRAAINSFANDGLGQLGPTLTELRGLIRDLRRVSDKLDN 290

Query: 432 NPQDIVWGREKGSVKIYKPK 451
           NP   + GR+    K ++PK
Sbjct: 291 NPARYLLGRDAP--KEFEPK 308


>gi|118578999|ref|YP_900249.1| hypothetical protein Ppro_0560 [Pelobacter propionicus DSM 2379]
 gi|118501709|gb|ABK98191.1| Mammalian cell entry related domain protein [Pelobacter propionicus
           DSM 2379]
          Length = 148

 Score = 99.2 bits (244), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 25/113 (22%), Positives = 49/113 (43%), Gaps = 1/113 (0%)

Query: 10  VGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRFNGIPVGRIV 69
           VG+F++  +    +    L +     G    +      SV GL   +S+   G+ VG++ 
Sbjct: 8   VGVFMIVGILCLGYISIKLGKMEIMGGDYYTISAGF-DSVSGLKPGASIEVAGVEVGKVE 66

Query: 70  GLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKEKK 122
            + LD +  + +LA   I+    +     A++RT G+ G  +I+L     +  
Sbjct: 67  RIALDPKSNDRALAYMKIKSGVKITDDVIASVRTSGIIGDKFIKLKPGGSDTY 119


>gi|78049253|ref|YP_365428.1| ABC transporter substrate-binding protein [Xanthomonas campestris
           pv. vesicatoria str. 85-10]
 gi|325928562|ref|ZP_08189750.1| ABC-type transport system involved in resistance to organic
           solvents, periplasmic component [Xanthomonas perforans
           91-118]
 gi|78037683|emb|CAJ25428.1| ABC transporter substrate-binding protein [Xanthomonas campestris
           pv. vesicatoria str. 85-10]
 gi|325541101|gb|EGD12655.1| ABC-type transport system involved in resistance to organic
           solvents, periplasmic component [Xanthomonas perforans
           91-118]
          Length = 308

 Score = 99.2 bits (244), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 51/297 (17%), Positives = 99/297 (33%), Gaps = 13/297 (4%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K  Y  +G F +           W ++ +  D    +  +    +V GLS  S V++
Sbjct: 1   METKANYVLIGAFTIVAGLALLLFGLWAAKYSS-DRTWQQYRVVFREAVTGLSVGSPVQY 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NGI VG I  L L    P   +A   +   TP+   T A +    L G + I+LS    E
Sbjct: 60  NGIAVGSITELTLAPNDPRQVVAHVRVNSTTPIKSDTRAKLAITSLTGPSIIQLSGGTPE 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENI-------- 172
              +   + +++   +I  TPS +      A    +++            +         
Sbjct: 120 APAL--TSIDKSDAPIIQTTPSALQNITDTANRIVERMDQMLSDKNVASISATLQNLEKI 177

Query: 173 --EKPLTTTIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKM 230
                          +S   A              +     +       I + + +    
Sbjct: 178 SGGIADRDEGMQALIVSARDAARNLDTTLTTTNGTIKRLDQNLVQQLPGILEKLDATLVK 237

Query: 231 IKAIDLQKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSD 287
           + +      N + EN    ++       Q+  T+ ++R   +  + V  K+D+  + 
Sbjct: 238 LDSAAGNADNILGENRAAINSFANDGLGQLGPTLTELRGLIRDLRRVSDKLDNNPAR 294



 Score = 73.0 bits (176), Expect = 9e-11,   Method: Composition-based stats.
 Identities = 19/200 (9%), Positives = 71/200 (35%), Gaps = 3/200 (1%)

Query: 252 NFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNM 311
                + +        +      Q     + ++    +  ++  +     +N+A  ++ +
Sbjct: 112 QLSGGTPEAPALTSIDKSDAPIIQTTPSALQNITDTANRIVERMDQMLSDKNVASISATL 171

Query: 312 RSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNISALKENNSLFKD 371
           ++       I D+ + + + I +  +   NL+ +       + +++    +++   + + 
Sbjct: 172 QNLEKISGGIADRDEGMQALIVSARDAARNLDTTLTTTNGTIKRLDQNL-VQQLPGILEK 230

Query: 372 AQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFER 431
               +      +   +  +      + +F+  GL  +   + +L+  +       +  + 
Sbjct: 231 LDATLVKLDSAAGNADNILGENRAAINSFANDGLGQLGPTLTELRGLIRDLRRVSDKLDN 290

Query: 432 NPQDIVWGREKGSVKIYKPK 451
           NP   + GR+    K ++PK
Sbjct: 291 NPARYLLGRDAP--KEFEPK 308


>gi|242277697|ref|YP_002989826.1| mammalian cell entry related domain protein [Desulfovibrio
           salexigens DSM 2638]
 gi|242120591|gb|ACS78287.1| Mammalian cell entry related domain protein [Desulfovibrio
           salexigens DSM 2638]
          Length = 148

 Score = 99.2 bits (244), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 29/133 (21%), Positives = 48/133 (36%), Gaps = 2/133 (1%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M+     T+VG+FV   L    +    L   + +      V       V GL  +S V  
Sbjct: 1   MKKYPKETAVGIFVFIGLLCIVYMSIKLGDVHMFSDDHYHVTASF-NDVTGLRVNSPVEM 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G+P+G +  + LD E     L    +     L     A+++T GL G  YI+++     
Sbjct: 60  MGVPIGYVSKINLDIEKQKAVL-TLSLEKRIELTDDAIASVKTSGLIGDKYIKITPGGVG 118

Query: 121 KKTIFQIATERNQ 133
                       +
Sbjct: 119 DPIEPGGVIIETE 131


>gi|21244297|ref|NP_643879.1| hypothetical protein XAC3572 [Xanthomonas axonopodis pv. citri str.
           306]
 gi|294624129|ref|ZP_06702867.1| conserved hypothetical protein [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 11122]
 gi|294663968|ref|ZP_06729388.1| conserved hypothetical protein [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 10535]
 gi|21109947|gb|AAM38415.1| conserved hypothetical protein [Xanthomonas axonopodis pv. citri
           str. 306]
 gi|292601574|gb|EFF45573.1| conserved hypothetical protein [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 11122]
 gi|292606263|gb|EFF49494.1| conserved hypothetical protein [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 10535]
          Length = 308

 Score = 99.2 bits (244), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 51/297 (17%), Positives = 98/297 (32%), Gaps = 13/297 (4%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K  Y  +G F +           W ++ +  D    +  +    +V GLS  S V++
Sbjct: 1   METKANYVLIGAFTIVAGLALLLFGLWAAKYSS-DRTWQQYRVVFREAVTGLSVGSPVQY 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NGI VG I  L L    P   +A   +   TP+   T A +    L G + I+LS    E
Sbjct: 60  NGIAVGSITELTLAPNDPRQVVAHVRVNSTTPIKSDTRAKLAITSLTGPSIIQLSGGTPE 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENI-------- 172
              +     +++   +I  TPS +      A    +++            +         
Sbjct: 120 APAL--TTIDKSDAPIIQTTPSALQNITDTANRIVERMDQMLSDKNVASISATLQNLEKI 177

Query: 173 --EKPLTTTIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKM 230
                          +S   A              +     +       I + + +    
Sbjct: 178 SGGIADRDEGMQALIVSARDAARNLDTTLTTTNGTIKRLDQNLVQQLPGILEKLDATLVK 237

Query: 231 IKAIDLQKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSD 287
           + +      N + EN    ++       Q+  T+ ++R   +  + V  K+D+  + 
Sbjct: 238 LDSAAGNADNILGENRAAINSFANDGLGQLGPTLTELRGLIRDLRRVSDKLDNNPAR 294



 Score = 73.0 bits (176), Expect = 9e-11,   Method: Composition-based stats.
 Identities = 19/200 (9%), Positives = 71/200 (35%), Gaps = 3/200 (1%)

Query: 252 NFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNM 311
                + +        +      Q     + ++    +  ++  +     +N+A  ++ +
Sbjct: 112 QLSGGTPEAPALTTIDKSDAPIIQTTPSALQNITDTANRIVERMDQMLSDKNVASISATL 171

Query: 312 RSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNISALKENNSLFKD 371
           ++       I D+ + + + I +  +   NL+ +       + +++    +++   + + 
Sbjct: 172 QNLEKISGGIADRDEGMQALIVSARDAARNLDTTLTTTNGTIKRLDQNL-VQQLPGILEK 230

Query: 372 AQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFER 431
               +      +   +  +      + +F+  GL  +   + +L+  +       +  + 
Sbjct: 231 LDATLVKLDSAAGNADNILGENRAAINSFANDGLGQLGPTLTELRGLIRDLRRVSDKLDN 290

Query: 432 NPQDIVWGREKGSVKIYKPK 451
           NP   + GR+    K ++PK
Sbjct: 291 NPARYLLGRDAP--KEFEPK 308


>gi|17545034|ref|NP_518436.1| signal peptide protein [Ralstonia solanacearum GMI1000]
 gi|17427324|emb|CAD13843.1| probable abc-type transport system involved in resistance to
           organic solvents, periplasmic component abc transporter
           protein [Ralstonia solanacearum GMI1000]
          Length = 330

 Score = 99.2 bits (244), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 26/113 (23%), Positives = 55/113 (48%), Gaps = 3/113 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++ +    GLF + +  F   ++ W +R            +    +V+GLS  ++V++
Sbjct: 1   MENRAHAFLAGLFTIGLAIFIALAVVWFNRDQTV---RVPYEVVTRSTVNGLSPQAAVKY 57

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIE 113
            G+ VG++  +  D   P   + + L+  D P+  +T   +  QG+ G+ Y++
Sbjct: 58  RGLDVGKVDSIRFDDRVPGQIIVRVLVDKDAPITTTTYGRLAYQGVTGLAYVQ 110



 Score = 49.5 bits (115), Expect = 0.001,   Method: Composition-based stats.
 Identities = 24/174 (13%), Positives = 57/174 (32%), Gaps = 12/174 (6%)

Query: 271 TQTFQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNMRSSISAIREITDQRQKIIS 330
                E+ ++ D +L+     + S       E+     + M+S    +       ++   
Sbjct: 142 AGFLDELDKRGDQMLARIDQTLSSLSALFDDEHRQALMAAMQSFQGTMDSYNALARQAEP 201

Query: 331 TINTIENITSNLNDSSQKFAELMSKINNISALKENNSLFKDAQRAMHTFRDTSEKINRYI 390
           T+  +  I  NL+ +      L   +++                 M T       ++   
Sbjct: 202 TMRRLPQIADNLDATLSATRRLSQSLSDPKG------------PLMGTLASAGNDLSSAS 249

Query: 391 PSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFERNPQDIVWGREKGS 444
            S+       +   L  +    R+ ++ V  FD  + +F   PQ +++G    +
Sbjct: 250 QSMQAATNVLANETLPQLNGFAREARQAVRSFDHAVTDFNTRPQSVLFGPAPAT 303


>gi|149374948|ref|ZP_01892721.1| hypothetical protein MDG893_07820 [Marinobacter algicola DG893]
 gi|149360837|gb|EDM49288.1| hypothetical protein MDG893_07820 [Marinobacter algicola DG893]
          Length = 312

 Score = 99.2 bits (244), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 50/302 (16%), Positives = 106/302 (35%), Gaps = 6/302 (1%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME + ++  +GLF +  L  +     WL ++   D   A   I     V GLS  S V++
Sbjct: 1   MEPRAHHVLIGLFTLVALAGALAFALWLGQAGN-DRDYAWYEIIFDRGVSGLSEGSPVKY 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           +GI VG +  L LD   P +  A   +  D P+   T A +    + G   +EL      
Sbjct: 60  SGIEVGDVAELSLDPSDPRNVRALIRVYDDVPIKEDTRAGLALTNITGSMNVELKGGTPG 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKI--IENIEKPLTT 178
            + +      R     I A PS     ++++E    K+     +   +   EN      +
Sbjct: 120 SRKL---TGSRESPPTIQAEPSAFTTLMASSEELFAKLDQFLSNANAMVSEENSRNLTRS 176

Query: 179 TIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQK 238
                   S ++       + +    Q++  +  +  TF    +   +L        +  
Sbjct: 177 LKNIEAVSSGLMDQRSELSNLVTSFDQLSVQTEATLETFRRFGNTANNLLDKEGRQLMTT 236

Query: 239 VNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETS 298
               +++++ ++      + +   ++    +         +++   L +  S +   E  
Sbjct: 237 AQSAMDSLETATARLEALTARNEGSLDQGMQGIGELAPAMRELRSTLKNLDSLIHRLEDD 296

Query: 299 AF 300
             
Sbjct: 297 PT 298



 Score = 71.9 bits (173), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 30/190 (15%), Positives = 78/190 (41%), Gaps = 4/190 (2%)

Query: 261 INTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNMRSSISAIRE 320
             +   ++     F  +    + L +     + +       EN  + T ++++  +    
Sbjct: 127 RESPPTIQAEPSAFTTLMASSEELFAKLDQFLSNANAMVSEENSRNLTRSLKNIEAVSSG 186

Query: 321 ITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNISALKENNSLFKDAQRAMHTFR 380
           + DQR ++ + + + + ++     + + F    +  NN+   KE   L   AQ AM +  
Sbjct: 187 LMDQRSELSNLVTSFDQLSVQTEATLETFRRFGNTANNLL-DKEGRQLMTTAQSAMDSLE 245

Query: 381 DTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFERNPQDIVWGR 440
             + ++         +L      G+ ++   +R+L+ T+ + D  ++  E +P  ++ GR
Sbjct: 246 TATARLEALTARNEGSLDQ-GMQGIGELAPAMRELRSTLKNLDSLIHRLEDDPTGLLLGR 304

Query: 441 EKGSVKIYKP 450
           E   ++ + P
Sbjct: 305 E--PIQEFNP 312


>gi|313669180|ref|YP_004049464.1| outer membrane transport protein [Neisseria lactamica ST-640]
 gi|313006642|emb|CBN88108.1| putative outer membrane transport protein [Neisseria lactamica
           020-06]
          Length = 165

 Score = 99.2 bits (244), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 27/118 (22%), Positives = 46/118 (38%), Gaps = 2/118 (1%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRI-PGSVDGLSTDSSVR 59
           M+       VGLFV+       F  + ++    + G      +    G + GL  ++ V+
Sbjct: 1   MKKNILEFWVGLFVLLGAAAVAFLAFRVAGGAAFGGSDKTYAVYADFGDIGGLKVNAPVK 60

Query: 60  FNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTL 117
             G+ VGR+  + LD +    +  +  +          +A I T GL G  YI L   
Sbjct: 61  SAGVLVGRVGAIGLDPKSY-QAKVRLDLDGKYQFSSDVSAQILTSGLLGEQYIGLQQG 117


>gi|238793702|ref|ZP_04637324.1| hypothetical protein yinte0001_790 [Yersinia intermedia ATCC 29909]
 gi|238726943|gb|EEQ18475.1| hypothetical protein yinte0001_790 [Yersinia intermedia ATCC 29909]
          Length = 189

 Score = 99.2 bits (244), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 28/133 (21%), Positives = 55/133 (41%), Gaps = 2/133 (1%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M++K     VGLF++  +    F    ++            I     +V GL T+S V+ 
Sbjct: 1   MQTKKSEVWVGLFILIAILAVVFLCLKVADIKSVGNQPTYRIYATFDNVGGLKTNSPVKI 60

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDT-PLYPSTTATIRTQGLAGITYIELSTLRK 119
            G+ VGR+  + LD +  +       I+     +  +++  +RT GL G  ++ L+   +
Sbjct: 61  GGVVVGRVADITLDTKNYSP-RVAIDIQQRYNHIPDTSSLAVRTSGLLGEQFLALNVGFE 119

Query: 120 EKKTIFQIATERN 132
           +      I  +  
Sbjct: 120 DPDMGTSILKDGG 132


>gi|309378879|emb|CBX22466.1| unnamed protein product [Neisseria lactamica Y92-1009]
          Length = 165

 Score = 99.2 bits (244), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 27/118 (22%), Positives = 46/118 (38%), Gaps = 2/118 (1%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRI-PGSVDGLSTDSSVR 59
           M+       VGLFV+       F  + ++    + G      +    G + GL  ++ V+
Sbjct: 1   MKKNVLEFWVGLFVLIGAAAVAFLAFRVAGGAAFGGSDKTYAVYADFGDIGGLKVNAPVK 60

Query: 60  FNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTL 117
             G+ VGR+  + LD +    +  +  +          +A I T GL G  YI L   
Sbjct: 61  SAGVLVGRVGAIGLDPKSY-QAKVRLDLDGKYQFSSDVSAQILTSGLLGEQYIGLQQG 117


>gi|315453382|ref|YP_004073652.1| ABC transport system periplasmic substrate-binding protein
           [Helicobacter felis ATCC 49179]
 gi|315132434|emb|CBY83062.1| putative possible ABC transport system periplasmic
           substrate-binding protein [Helicobacter felis ATCC
           49179]
          Length = 277

 Score = 99.2 bits (244), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 26/129 (20%), Positives = 51/129 (39%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME    YT +G   ++ +      I WL   N  +      ++     + G+  ++ + +
Sbjct: 1   MERHVNYTLIGGIFLACMACMVIFILWLGHVNFEEEDYMRYVVYTDKDLGGVGANTPINY 60

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            GI VG I  +  D ++         I+   P+    T  + +QGL G+ Y+ L   R +
Sbjct: 61  KGIQVGTIKSVGFDPKHLGVVKLAIDIKSKVPVSKDATLKVASQGLVGLKYLSLIQGRSK 120

Query: 121 KKTIFQIAT 129
           +    +   
Sbjct: 121 EFYTKKDPE 129



 Score = 40.3 bits (91), Expect = 0.59,   Method: Composition-based stats.
 Identities = 12/122 (9%), Positives = 43/122 (35%), Gaps = 2/122 (1%)

Query: 321 ITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNISALKENNSLFKDAQRAMHTFR 380
               +      I  +  I +++  ++Q    + + ++ +    +           +    
Sbjct: 158 KNIDKMLSPENIANLSKIIASVQQATQGLDTIKNNLDALLVKAD--RALSKGDTLLQHGN 215

Query: 381 DTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFERNPQDIVWGR 440
                +++ +     +L++     L   +  +R + + V      ++ F+ NP   ++G 
Sbjct: 216 QLITDVDKKVQGGQYDLKSMLTPLLIQAELSLRNIDQFVQKGSLLMDKFDANPYKTLFGE 275

Query: 441 EK 442
           +K
Sbjct: 276 QK 277


>gi|188993116|ref|YP_001905126.1| conserved putative secreted protein [Xanthomonas campestris pv.
           campestris str. B100]
 gi|167734876|emb|CAP53088.1| conserved putative secreted protein [Xanthomonas campestris pv.
           campestris]
          Length = 308

 Score = 99.2 bits (244), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 51/297 (17%), Positives = 98/297 (32%), Gaps = 13/297 (4%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K  Y  +G F +           W ++ +  D    +  +    +V GLS  S V++
Sbjct: 1   METKANYVLIGAFTIVAGLALLLFGLWAAKYSS-DRTWQQYRVVFREAVTGLSVGSPVQY 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NGI VG I  L L    P   +A   +   TP+   T A +    L G + I+LS    E
Sbjct: 60  NGIAVGSITELTLAPNDPRQVVAHVRVNSTTPIKSDTRAKLAITSLTGPSIIQLSGGTPE 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENI-------- 172
             ++     +++   +I  TPS +      A    +++                      
Sbjct: 120 APSL--TTIDKSDAPIIQTTPSALQNITDTANRIVERMDQMLSDKNVASITATLQNLEKI 177

Query: 173 --EKPLTTTIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKM 230
                          +S   A              +     +       I + + +    
Sbjct: 178 SGGIADRDEGMQALIVSARDAARNLDTTLTTTNGTIKRLDQNLVQQLPGILEKLDATLVK 237

Query: 231 IKAIDLQKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSD 287
           + +      N + EN    ++       Q+  T+ ++R   +  + V  K+D+  + 
Sbjct: 238 LDSAAGNADNILGENRTAINSFANDGLGQLGPTLTELRGLIRDLRRVSDKLDNNPAR 294



 Score = 73.0 bits (176), Expect = 9e-11,   Method: Composition-based stats.
 Identities = 20/200 (10%), Positives = 72/200 (36%), Gaps = 3/200 (1%)

Query: 252 NFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNM 311
                + +  +     +      Q     + ++    +  ++  +     +N+A  T+ +
Sbjct: 112 QLSGGTPEAPSLTTIDKSDAPIIQTTPSALQNITDTANRIVERMDQMLSDKNVASITATL 171

Query: 312 RSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNISALKENNSLFKD 371
           ++       I D+ + + + I +  +   NL+ +       + +++    +++   + + 
Sbjct: 172 QNLEKISGGIADRDEGMQALIVSARDAARNLDTTLTTTNGTIKRLDQNL-VQQLPGILEK 230

Query: 372 AQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFER 431
               +      +   +  +      + +F+  GL  +   + +L+  +       +  + 
Sbjct: 231 LDATLVKLDSAAGNADNILGENRTAINSFANDGLGQLGPTLTELRGLIRDLRRVSDKLDN 290

Query: 432 NPQDIVWGREKGSVKIYKPK 451
           NP   + GR+    K ++PK
Sbjct: 291 NPARYLLGRDAP--KEFEPK 308


>gi|330818438|ref|YP_004362143.1| Mce related protein [Burkholderia gladioli BSR3]
 gi|327370831|gb|AEA62187.1| Mce related protein [Burkholderia gladioli BSR3]
          Length = 315

 Score = 99.2 bits (244), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 38/290 (13%), Positives = 101/290 (34%), Gaps = 6/290 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K++    GLF + +L     +++W +             +    +V GL  D++VR+
Sbjct: 1   MENKSHAFWAGLFAIGLLLAIIAAVFWFNVDRTV---RIPYDLVARTNVTGLFPDAAVRY 57

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G+ VG++  +  D+ +P     + L+  D P+  ST  ++  QG+ GI +++L    ++
Sbjct: 58  RGLDVGKVATIHFDRAHPGEISIRILVDKDAPITRSTYGSLGFQGVTGIAFVQLDDTGRD 117

Query: 121 KKTIFQIATERNQRA-MITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTT 179
              +     +  Q     +             +      S  +  +   +    K    +
Sbjct: 118 PSPLPTSMKDVAQIPLHPSLFDQLQQRGDVLLKQMEVAASSVNAMLSPEMREQLKATAAS 177

Query: 180 IANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKV 239
           +       + L  ++  +   +  T    + + +            + +        ++ 
Sbjct: 178 VQQAADGVSTLTRSLEPVTAQLPETTRRVNQALASADAMLAPHGPLAANLDRAGKAAEQA 237

Query: 240 NQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFS 289
              L  +  + +    S      T+  +   +    +  + +  +  + S
Sbjct: 238 GTALTQMDQTLSELNASVR--YETLPRINSLSSNLGDTSRTVRDVAGEIS 285



 Score = 52.2 bits (122), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 24/163 (14%), Positives = 61/163 (37%), Gaps = 4/163 (2%)

Query: 282 DHLLSDFSSKMKSKETSAFLENIADSTSNMRSSISAIREITDQRQKIISTINTIENITSN 341
           D L       +K  E +A   N   S        +    +      + +   ++E +T+ 
Sbjct: 139 DQLQQRGDVLLKQMEVAASSVNAMLSPEMREQLKATAASVQQAADGVSTLTRSLEPVTAQ 198

Query: 342 LNDSSQKFAELMSKINNISALKENNSL-FKDAQRAMHTFRDTSEKINRYIPSIGNNLQNF 400
           L +++++  + ++  + + A     +     A +A         ++++ +  +  +++  
Sbjct: 199 LPETTRRVNQALASADAMLAPHGPLAANLDRAGKAAEQAGTALTQMDQTLSELNASVR-- 256

Query: 401 SQSGLNDIQNLVRKLQETVNHFDDCLNNFERNPQDIVWGREKG 443
               L  I +L   L +T     D      RNP+ +++G   G
Sbjct: 257 -YETLPRINSLSSNLGDTSRTVRDVAGEISRNPRSLLFGTSAG 298


>gi|114321370|ref|YP_743053.1| hypothetical protein Mlg_2221 [Alkalilimnicola ehrlichii MLHE-1]
 gi|114227764|gb|ABI57563.1| Mammalian cell entry related domain protein [Alkalilimnicola
           ehrlichii MLHE-1]
          Length = 153

 Score = 99.2 bits (244), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 26/122 (21%), Positives = 47/122 (38%), Gaps = 2/122 (1%)

Query: 2   ESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRFN 61
            ++     VG+FV   L   F     +S   ++    +  +     +V GL   + V   
Sbjct: 3   STRTMELWVGVFVALGLGAMFLLALEVSGLAEFRDRPSYEVTAHFDNVGGLREKAPVNMA 62

Query: 62  GIPVGRIVGLFLDQEYPNHSLAKALIRPDT-PLYPSTTATIRTQGLAGITYIELSTLRKE 120
           G+ VG++  + LD +    +     +      +   +TA I T GL G  Y+ L    +E
Sbjct: 63  GVRVGQVKAIELDAQSYR-ARVVLGLDSRFDRIPADSTAAIYTSGLLGEQYVSLDPGWEE 121

Query: 121 KK 122
             
Sbjct: 122 DY 123


>gi|37527884|ref|NP_931229.1| hypothetical protein plu4032 [Photorhabdus luminescens subsp.
           laumondii TTO1]
 gi|36787320|emb|CAE16404.1| unnamed protein product [Photorhabdus luminescens subsp. laumondii
           TTO1]
          Length = 168

 Score = 99.2 bits (244), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 30/145 (20%), Positives = 61/145 (42%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M+SK     VG FV+  L    F    ++            +     ++ GL   S V+ 
Sbjct: 1   MQSKKSEIWVGFFVLIALAAIVFLCLKVADIKSVGNQPTYRLYATFDNIGGLKVRSPVKI 60

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G+ +GR+  + LD++     +A  +++    +  +++ +IRT GL G  YI L+   ++
Sbjct: 61  GGVVIGRVASISLDEKTYTPQVALDIMKQYDRIPDTSSLSIRTSGLLGEQYIALNIGFED 120

Query: 121 KKTIFQIATERNQRAMITATPSGIN 145
                +I  E ++     +     +
Sbjct: 121 PDMDTRILKEGDRVQDTKSAMVLED 145


>gi|294634665|ref|ZP_06713198.1| toluene tolerance ABC transporter, periplasmic substrate-binding
           protein [Edwardsiella tarda ATCC 23685]
 gi|291091911|gb|EFE24472.1| toluene tolerance ABC transporter, periplasmic substrate-binding
           protein [Edwardsiella tarda ATCC 23685]
          Length = 178

 Score = 99.2 bits (244), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 27/146 (18%), Positives = 55/146 (37%), Gaps = 2/146 (1%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M++K     VGLF++  L  + F    ++            +     +V GL   S V+ 
Sbjct: 1   MQTKKTEIWVGLFMLIALCAAVFLCLQVANVKSLGNEPTYRLYATFDNVGGLKARSPVKI 60

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDT-PLYPSTTATIRTQGLAGITYIELSTLRK 119
            G+ +GR+  + LD +          I      +  +++  IRT GL G  ++ L+   +
Sbjct: 61  GGVVIGRVANISLDPQTY-LPKVAMDIDTRYNHIPDTSSLAIRTSGLLGEQFLALNVGFE 119

Query: 120 EKKTIFQIATERNQRAMITATPSGIN 145
           + +    I  +        +     +
Sbjct: 120 DPEMGTAILKDGGTIQDTKSAMVLED 145


>gi|148264679|ref|YP_001231385.1| hypothetical protein Gura_2635 [Geobacter uraniireducens Rf4]
 gi|146398179|gb|ABQ26812.1| Mammalian cell entry related domain protein [Geobacter
           uraniireducens Rf4]
          Length = 328

 Score = 99.2 bits (244), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 27/147 (18%), Positives = 48/147 (32%), Gaps = 21/147 (14%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M +K   T++G FV+  +      +  L  + ++       I    GSV GL+  S V F
Sbjct: 1   MSTKVNKTAIGAFVLGAIALFVAGVLVLG-AGKFFTKEFVYITYFVGSVKGLNVGSPVMF 59

Query: 61  NGIPVGRIVGLF-----------------LDQEYPNHSLAKALIRP---DTPLYPSTTAT 100
            G+ VG +  +                  LD E    +  +    P      +     A 
Sbjct: 60  RGVKVGSVTDISIIVDPSKKELLIPVVFTLDPEKFRGAKVQFRQDPRYVKYAVDLGLRAQ 119

Query: 101 IRTQGLAGITYIELSTLRKEKKTIFQI 127
           ++TQ       +       +K   +  
Sbjct: 120 LQTQSFVTGQLMVALDFFPDKPANYVG 146



 Score = 51.5 bits (120), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 21/209 (10%), Positives = 72/209 (34%), Gaps = 6/209 (2%)

Query: 238 KVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKET 297
           +    +    + + +F          +        +     +++   L +   +      
Sbjct: 121 QTQSFVTGQLMVALDFFPDKPANYVGLTKKYPEIPSIPTSLEQLQKTLENLPLEEIIDNL 180

Query: 298 SAFLENIADSTSNMRSSISAIREI---TDQRQKIISTINTIENITSNLNDSSQKFAELMS 354
           ++ LE I    S++ +  +         D +  +    + ++ +  NL+++S       +
Sbjct: 181 NSTLEEIDRVVSSIDAKKTTRTIEAAIRDVQALVKHVNDKVDPLVENLSETSVAARGAFT 240

Query: 355 KINNISALKENN--SLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLV 412
           +     ALKE     +    +  +     + +++   + +     +  +  G + +   +
Sbjct: 241 QAEKTLALKEGVPGDIAVSLRETLAKSSASFDQLRAALLTYEKLAERNADLGYS-VTKTL 299

Query: 413 RKLQETVNHFDDCLNNFERNPQDIVWGRE 441
            +L  T        +  ER+P+ ++ G++
Sbjct: 300 TELDSTSRAIRSLADYLERHPESLIKGKQ 328


>gi|332178186|gb|AEE13875.1| Mammalian cell entry related domain protein [Thermodesulfobium
           narugense DSM 14796]
          Length = 422

 Score = 99.2 bits (244), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 33/111 (29%), Positives = 48/111 (43%), Gaps = 6/111 (5%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME K     VG+FV++ L     SI W    + +  PM  ++   P  V GLS D+ V +
Sbjct: 1   ME-KGRAAKVGIFVLATLILLAGSILWF--QSDFLKPMYRIVAYFPD-VSGLSVDAPVYY 56

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITY 111
            G+ VGRI  +              LI  D  +   +  +I T GL G  +
Sbjct: 57  MGVKVGRIKSIT--PTLYKGVETVILINKDVLIPKGSYFSIGTYGLVGDKF 105


>gi|325915746|ref|ZP_08178048.1| ABC-type transport system involved in resistance to organic
           solvents, periplasmic component [Xanthomonas vesicatoria
           ATCC 35937]
 gi|325538010|gb|EGD09704.1| ABC-type transport system involved in resistance to organic
           solvents, periplasmic component [Xanthomonas vesicatoria
           ATCC 35937]
          Length = 308

 Score = 99.2 bits (244), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 51/297 (17%), Positives = 100/297 (33%), Gaps = 13/297 (4%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K  Y  +G F +           W ++ +  D    +  +    +V GLS  S V++
Sbjct: 1   METKANYVLIGAFTIVAGLALLLFGLWAAKYSS-DRTWQQYRVVFREAVTGLSVGSPVQY 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NGI VG I  L L    P   +A   +   TP+   T A +    L G + I+LS    E
Sbjct: 60  NGIAVGSITELTLAPNDPRQVVAHVRVNSTTPIKSDTRAKLAITSLTGPSIIQLSGGTPE 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENI-------- 172
             ++     +++   +I  TPS +      A    +++ +          +         
Sbjct: 120 APSL--TTIDKSDAPIIQTTPSALQNITDTANRIVERMDEMLSDKNVASISATLQNLEKI 177

Query: 173 --EKPLTTTIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKM 230
                          +S   A              +     +       I + + +    
Sbjct: 178 SGGIADRDEGMQALIVSARDAARNLDTTLTTTNGTIKRLDQNLVQQLPGILNKLDATLVK 237

Query: 231 IKAIDLQKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSD 287
           + +      N + EN    ++       Q+  T+ ++R   +  + V  K+D+  + 
Sbjct: 238 LDSAAGNADNILGENRAAINSFANDGLGQLGPTLTELRGLIRDLRRVSDKLDNNPAR 294



 Score = 72.7 bits (175), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 19/200 (9%), Positives = 71/200 (35%), Gaps = 3/200 (1%)

Query: 252 NFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNM 311
                + +  +     +      Q     + ++    +  ++  +     +N+A  ++ +
Sbjct: 112 QLSGGTPEAPSLTTIDKSDAPIIQTTPSALQNITDTANRIVERMDEMLSDKNVASISATL 171

Query: 312 RSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNISALKENNSLFKD 371
           ++       I D+ + + + I +  +   NL+ +       + +++    +++   +   
Sbjct: 172 QNLEKISGGIADRDEGMQALIVSARDAARNLDTTLTTTNGTIKRLDQNL-VQQLPGILNK 230

Query: 372 AQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFER 431
               +      +   +  +      + +F+  GL  +   + +L+  +       +  + 
Sbjct: 231 LDATLVKLDSAAGNADNILGENRAAINSFANDGLGQLGPTLTELRGLIRDLRRVSDKLDN 290

Query: 432 NPQDIVWGREKGSVKIYKPK 451
           NP   + GR+    K ++PK
Sbjct: 291 NPARYLLGRDAP--KEFEPK 308


>gi|307129072|ref|YP_003881088.1| putative ABC-type organic solvent transporter [Dickeya dadantii
           3937]
 gi|306526601|gb|ADM96531.1| predicted ABC-type organic solvent transporter [Dickeya dadantii
           3937]
          Length = 207

 Score = 98.9 bits (243), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 26/146 (17%), Positives = 55/146 (37%), Gaps = 2/146 (1%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M++K +   VG+F++  L    F    ++            +     ++ GL   S V+ 
Sbjct: 1   MQTKKHEIWVGVFMLIALCAIVFLCLKVADLKSLGQQQTYRLYATFDNIGGLKARSPVKI 60

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDT-PLYPSTTATIRTQGLAGITYIELSTLRK 119
            G+ +GR+  + LD +          I      +  +++  IRT GL G  Y+ L+   +
Sbjct: 61  GGVVIGRVADISLDTKTY-LPRVAIDIDKRYDHIPDTSSLAIRTSGLLGEQYLALNMGFE 119

Query: 120 EKKTIFQIATERNQRAMITATPSGIN 145
           ++     I  +        +     +
Sbjct: 120 DEDMGTSILKDGGTIQDTKSAMVLED 145


>gi|255067844|ref|ZP_05319699.1| toluene tolerance ABC transporter, periplasmic substrate-binding
           protein [Neisseria sicca ATCC 29256]
 gi|255047935|gb|EET43399.1| toluene tolerance ABC transporter, periplasmic substrate-binding
           protein [Neisseria sicca ATCC 29256]
          Length = 165

 Score = 98.9 bits (243), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 26/119 (21%), Positives = 46/119 (38%), Gaps = 4/119 (3%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYD--GPMAEVIIRIPGSVDGLSTDSSV 58
           M+       VGLFV+  +    F  + ++    +   G    V       + GL  ++ +
Sbjct: 1   MKKNVLEFWVGLFVLLGVAAVGFLAFRVAGGAAFGNSGKTYTVYADFSD-IGGLKANAPI 59

Query: 59  RFNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTL 117
           +  G+ VGR+  + LD +    +  +  +          +A I T GL G  YI L   
Sbjct: 60  KSAGVLVGRVGSIELDPKSY-QAKVRLDLDSKYQFSSDVSAQILTSGLLGEQYIGLQQG 117


>gi|157372591|ref|YP_001480580.1| hypothetical protein Spro_4358 [Serratia proteamaculans 568]
 gi|157324355|gb|ABV43452.1| Mammalian cell entry related domain protein [Serratia
           proteamaculans 568]
          Length = 183

 Score = 98.9 bits (243), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 27/146 (18%), Positives = 53/146 (36%), Gaps = 2/146 (1%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M++K     VG F++  L    F    ++            I     ++ GL   S V+ 
Sbjct: 1   MQTKKSEIWVGAFMLIALCAVVFLCLQVANIKSIGNEPTYRIYATFDNIGGLKARSPVKI 60

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDT-PLYPSTTATIRTQGLAGITYIELSTLRK 119
            G+ +GR+  + LD +          I+     +  +++  IRT GL G  Y+ L+   +
Sbjct: 61  GGVVIGRVANISLDPKTYTP-RVALDIQDKFNQIPDTSSLAIRTSGLLGEQYLALNVGFE 119

Query: 120 EKKTIFQIATERNQRAMITATPSGIN 145
           +      I  +        +     +
Sbjct: 120 DPDMGTTILKDGGTIQDTKSAMVLED 145


>gi|170703964|ref|ZP_02894626.1| Mammalian cell entry related domain protein [Burkholderia ambifaria
           IOP40-10]
 gi|170131127|gb|EDS99792.1| Mammalian cell entry related domain protein [Burkholderia ambifaria
           IOP40-10]
          Length = 311

 Score = 98.9 bits (243), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 33/176 (18%), Positives = 76/176 (43%), Gaps = 6/176 (3%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K++    GLF +++      +++W +             +    +V GL  D++VRF
Sbjct: 1   MENKSHAFWAGLFTIALTLAIAGTVFWFNVDRTV---RVPYDLLARTNVTGLFPDAAVRF 57

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G+ VG++  +  D+ +P     + L+  D P+  ST  ++  QG+ GI +++L      
Sbjct: 58  RGLDVGKVQLIGFDRTHPGQIRIRILVDRDAPITQSTYGSLGFQGVTGIAFVQL---EDT 114

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPL 176
            + +  + +     A I   PS  +      +   +++  ++     ++    +  
Sbjct: 115 GRDLAPLPSSPKAIAQIPMRPSLFDQIQERGDVLLRQLEQAAESANALMSPEMREQ 170



 Score = 39.1 bits (88), Expect = 1.6,   Method: Composition-based stats.
 Identities = 17/168 (10%), Positives = 46/168 (27%), Gaps = 2/168 (1%)

Query: 271 TQTFQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNMRSSISAIREITDQRQKIIS 330
             +  +   +I    S F    +  +        A  ++N   S     ++    + +  
Sbjct: 121 LPSSPKAIAQIPMRPSLFDQIQERGDVLLRQLEQAAESANALMSPEMREQLRATAESLQH 180

Query: 331 TINTIENITSNLNDSSQKFAELMSKINNISALKENNSLFKDAQRAMHTFRDTSEKINRYI 390
             +    ++  L  +     + M ++N   A      L +     +           +  
Sbjct: 181 AADGAATLSKQLAPAVAALPQTMHEVNRTMASANT--LLQPNGPLVSNLNKAGSAAEQVG 238

Query: 391 PSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFERNPQDIVW 438
            ++ +         L     L   + +      D      RNP  +++
Sbjct: 239 VALNDLNARVQYDTLPRFNALAGSVGDASRQLKDVAGELGRNPSSLLF 286


>gi|300705333|ref|YP_003746936.1| ABC transporter periplasmic component [Ralstonia solanacearum
           CFBP2957]
 gi|299072997|emb|CBJ44354.1| putative ABC-type transporter, periplasmic component (resistance to
           organic solvents) [Ralstonia solanacearum CFBP2957]
          Length = 327

 Score = 98.9 bits (243), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 39/298 (13%), Positives = 102/298 (34%), Gaps = 6/298 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++ +    GLF + +  F   ++ W +R            +    +V+GLS  ++V++
Sbjct: 1   MENRAHAFLAGLFTIGLAIFIALAVVWFNRDQTV---RVPYDVVTRSTVNGLSPQAAVKY 57

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIE-LSTLRK 119
            G+ VG++  +  D + P   + + L+  D P+  +T   +  QG+ G+ Y++       
Sbjct: 58  RGLDVGKVDTIRFDDKVPGQIIVRVLVDKDAPITTTTYGRLAYQGVTGLAYVQLDDRGYD 117

Query: 120 EKKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTT 179
             K                       +     +   + ++   + +  +   ++      
Sbjct: 118 SSKRAANPTRLETSDRRPARIAMEAGFLDELDKRGDQMLTKLDQTLGSLAAMLDDEHRQA 177

Query: 180 IANIETISTVLANNISHIDKMMHTTQV--TPHSSDSKNTFNTITDLITSLDKMIKAIDLQ 237
           +           ++   + +            + +   T      L  SL      +   
Sbjct: 178 LMAAVRSFQGTMDSYGALARQAEPAMRKLPQIADNLDATLAATRRLSQSLSDPKGPLMGT 237

Query: 238 KVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSK 295
             +   +    S +    +      T+  +    +  ++  +  DH ++DF+S+ +S 
Sbjct: 238 LASAGSDLSSASQSMQAATQALTYETLPQLNGVAREARQAVRSFDHAVTDFNSRPQSV 295



 Score = 49.9 bits (116), Expect = 9e-04,   Method: Composition-based stats.
 Identities = 18/128 (14%), Positives = 46/128 (35%), Gaps = 2/128 (1%)

Query: 314 SISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNISALKE--NNSLFKD 371
                + +    +    T+++   +      + +K  ++   ++   A     + SL   
Sbjct: 171 DDEHRQALMAAVRSFQGTMDSYGALARQAEPAMRKLPQIADNLDATLAATRRLSQSLSDP 230

Query: 372 AQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFER 431
               M T       ++    S+    Q  +   L  +  + R+ ++ V  FD  + +F  
Sbjct: 231 KGPLMGTLASAGSDLSSASQSMQAATQALTYETLPQLNGVAREARQAVRSFDHAVTDFNS 290

Query: 432 NPQDIVWG 439
            PQ +++G
Sbjct: 291 RPQSVLFG 298


>gi|325923306|ref|ZP_08184979.1| ABC-type transport system involved in resistance to organic
           solvents, periplasmic component [Xanthomonas gardneri
           ATCC 19865]
 gi|325546233|gb|EGD17414.1| ABC-type transport system involved in resistance to organic
           solvents, periplasmic component [Xanthomonas gardneri
           ATCC 19865]
          Length = 308

 Score = 98.9 bits (243), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 56/304 (18%), Positives = 110/304 (36%), Gaps = 11/304 (3%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K  Y  +G F +           W ++ +  D    +  +    +V GL+  S V++
Sbjct: 1   METKANYVLIGAFTIVAGLALLLFGLWAAKYSS-DRTWQQYRVVFREAVTGLTVGSPVQY 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NGI VG I  L L    P   +A   +   TP+   T A +    L G + I+LS    E
Sbjct: 60  NGIAVGSITELTLAPNDPRQVVAHVRVNSTTPIKSDTRAKLAITSLTGPSIIQLSGGTPE 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
             ++     +++   +I  TPS +      A           R  Q + +     +T T+
Sbjct: 120 APSL--TTIDKSDAPIIQTTPSALQNITDTAN------RIVERMDQMLSDKNVASITATL 171

Query: 181 ANIETISTVLANNISHIDKMMHTTQV--TPHSSDSKNTFNTITDLITSLDKMIKAIDLQK 238
            N+E IS+ +A+    +  ++ + +       +    T  TI  L  +L + +  I  + 
Sbjct: 172 QNLEKISSGIADRDEGMQALIVSARDAARNLDTTLTTTNGTIKRLDQNLVQQLPGILAKL 231

Query: 239 VNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETS 298
              +++    + N      +          +          ++  L+ D        + +
Sbjct: 232 DATLVKLDSAAGNADNILGENRAAINSFANDGLGQLGPTLTELRGLIRDLRRVSDKLDNN 291

Query: 299 AFLE 302
               
Sbjct: 292 PARY 295



 Score = 73.8 bits (178), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 20/200 (10%), Positives = 71/200 (35%), Gaps = 3/200 (1%)

Query: 252 NFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNM 311
                + +  +     +      Q     + ++    +  ++  +     +N+A  T+ +
Sbjct: 112 QLSGGTPEAPSLTTIDKSDAPIIQTTPSALQNITDTANRIVERMDQMLSDKNVASITATL 171

Query: 312 RSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNISALKENNSLFKD 371
           ++       I D+ + + + I +  +   NL+ +       + +++    +++   +   
Sbjct: 172 QNLEKISSGIADRDEGMQALIVSARDAARNLDTTLTTTNGTIKRLDQNL-VQQLPGILAK 230

Query: 372 AQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFER 431
               +      +   +  +      + +F+  GL  +   + +L+  +       +  + 
Sbjct: 231 LDATLVKLDSAAGNADNILGENRAAINSFANDGLGQLGPTLTELRGLIRDLRRVSDKLDN 290

Query: 432 NPQDIVWGREKGSVKIYKPK 451
           NP   + GR+    K ++PK
Sbjct: 291 NPARYLLGRDAP--KEFEPK 308


>gi|208435332|ref|YP_002266998.1| ABC transport system substrate binding protein [Helicobacter pylori
           G27]
 gi|208433261|gb|ACI28132.1| ABC transport system substrate binding protein [Helicobacter pylori
           G27]
          Length = 267

 Score = 98.9 bits (243), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 30/236 (12%), Positives = 83/236 (35%), Gaps = 4/236 (1%)

Query: 6   YYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRFNGIPV 65
            YT +G      L      I WL      DG   E ++     + G++T+S + + GI V
Sbjct: 2   NYTLIGGLFFLCLVCMVGFILWLGHLGLDDGKYYEYVVYTDKDLGGIATNSPINYKGIQV 61

Query: 66  GRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKEKKTIF 125
           G ++ +   ++         +I+    +   +   + ++G  G+ ++ L     E+   F
Sbjct: 62  GNVIKVGFAKDKVGVVRLDLMIKSSVKIRKDSKVAVSSRGFMGLKFLALEQSHNEE---F 118

Query: 126 QIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTIANIET 185
             + ++ +R ++      ++    +A    +++  + R++ +I+++        I     
Sbjct: 119 YGSGDKGER-ILIFKEGLMDRLSGDANQVVQEVMKAIRNVNRILDDENVEKFKHILASVD 177

Query: 186 ISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVNQ 241
                 ++      ++ +      S+ +    +    L               +  
Sbjct: 178 DLIANLDSRKTQFDLLISNANNLVSNVNNVALDVDKRLKQGQYDFKAMFTPLIMQA 233


>gi|77166236|ref|YP_344761.1| ABC-type transport system involved in resistance to organic
           solvents periplasmic component [Nitrosococcus oceani
           ATCC 19707]
 gi|76884550|gb|ABA59231.1| ABC-type transport system involved in resistance to organic
           solvents periplasmic component [Nitrosococcus oceani
           ATCC 19707]
          Length = 155

 Score = 98.9 bits (243), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 30/116 (25%), Positives = 47/116 (40%), Gaps = 2/116 (1%)

Query: 3   SKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRFNG 62
           S+     VGLFV + L   F     +S  +         ++    ++ GL   S V   G
Sbjct: 4   SRTVELVVGLFVAAGLVAFFMLAMRVSNLSLVAQENTYSVVAEFQNIGGLKVRSPVTLAG 63

Query: 63  IPVGRIVGLFLDQEYPN-HSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTL 117
           + +GR+V + +D +            + D  L   T+A+I T GL G  YI L   
Sbjct: 64  VTIGRVVSIQIDPQTYGAQVRMHIEAQYDY-LPEDTSASIYTSGLLGEQYIALEPG 118


>gi|319638900|ref|ZP_07993658.1| hypothetical protein HMPREF0604_01282 [Neisseria mucosa C102]
 gi|317399804|gb|EFV80467.1| hypothetical protein HMPREF0604_01282 [Neisseria mucosa C102]
          Length = 164

 Score = 98.5 bits (242), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 26/118 (22%), Positives = 43/118 (36%), Gaps = 2/118 (1%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRI-PGSVDGLSTDSSVR 59
           M+       VGLFV+       F  +  +    +        +      + GL T++ V+
Sbjct: 1   MKKNALEFWVGLFVLLGAAAIGFLAFRAAGGQSFGKSSQTYTVYADFSDIGGLKTNAPVK 60

Query: 60  FNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTL 117
             G+ VGR+  + LD +    +     +          +A I T GL G  YI L   
Sbjct: 61  SAGVLVGRVASIQLDPKSY-QAKVALNLDSQYQFSSDVSAQILTSGLLGEQYIGLQQG 117


>gi|156935717|ref|YP_001439633.1| hypothetical protein ESA_03586 [Cronobacter sakazakii ATCC BAA-894]
 gi|156533971|gb|ABU78797.1| hypothetical protein ESA_03586 [Cronobacter sakazakii ATCC BAA-894]
          Length = 183

 Score = 98.5 bits (242), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 27/146 (18%), Positives = 55/146 (37%), Gaps = 2/146 (1%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M++K +   VG F++  L  + F    ++            +     ++ GL   S VR 
Sbjct: 1   MQTKKFEIWVGAFMLVALLAALFICLKVADVTSLRAEPTYRLYATFDNIGGLKPHSPVRI 60

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDT-PLYPSTTATIRTQGLAGITYIELSTLRK 119
            G+ +GR+  + LD +          I      +  +++  IRT GL G  Y+ L+   +
Sbjct: 61  GGVVIGRVSDITLDPKTY-LPRVAMDIEQRYDHIPDTSSLAIRTSGLLGEQYLALNVGFE 119

Query: 120 EKKTIFQIATERNQRAMITATPSGIN 145
           + +    I  +        +     +
Sbjct: 120 DPELGTTILKDGGTIQDTKSAMVLED 145


>gi|241661799|ref|YP_002980159.1| Mammalian cell entry related domain-containing protein [Ralstonia
           pickettii 12D]
 gi|240863826|gb|ACS61487.1| Mammalian cell entry related domain protein [Ralstonia pickettii
           12D]
          Length = 322

 Score = 98.5 bits (242), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 45/325 (13%), Positives = 110/325 (33%), Gaps = 6/325 (1%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K +    GLF + +  F   ++ W +R            +    +V+GL+  +SV++
Sbjct: 1   MENKAHAFLAGLFTIGLAIFMGLAVMWFNRDQTV---RVPYEVVTRSTVNGLNPQASVKY 57

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G+ VG++  +  D + P   + + L+  D P+  +T   +  QG+ G+ Y++L     +
Sbjct: 58  RGLDVGKVDSIRFDDKVPGQIVVRVLVDKDAPITTTTYGRLAYQGVTGLAYVQLDDRGFD 117

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHI---QKIIENIEKPLT 177
                             A       F+   +    ++            I+ + E    
Sbjct: 118 NSQHAPSPVRLATSQKDPARIRMDAGFLDELDKRGDQMLSKLDQTLSSLSIMFDDEHRQQ 177

Query: 178 TTIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQ 237
            T +      T+ A +           ++   + +  +T      L  SL      +   
Sbjct: 178 VTASLQAFQKTMDAYSTLAQQAEPTMRRLPQIADNLDSTLVATRKLTQSLSDPKGPLMTT 237

Query: 238 KVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKET 297
                 +    + +    ++     T+  +    +  ++  +  DH ++DF+++ +S   
Sbjct: 238 LSGAGTDLTAATQSMQSAANVLTYETLPQLNGFAREARQAVRGFDHAVTDFNARPQSVLF 297

Query: 298 SAFLENIADSTSNMRSSISAIREIT 322
                      +   +  +      
Sbjct: 298 GPAPGAPGPGETGFTAPAARASAQP 322



 Score = 44.2 bits (101), Expect = 0.050,   Method: Composition-based stats.
 Identities = 25/194 (12%), Positives = 58/194 (29%), Gaps = 8/194 (4%)

Query: 245 NIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAFLENI 304
           + +   N+    S   + T        +       ++D       SK+    +S  +   
Sbjct: 112 DDRGFDNSQHAPSPVRLATSQKDPARIRMDAGFLDELDKRGDQMLSKLDQTLSSLSIMFD 171

Query: 305 ADSTSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNISALKE 364
            +    + +S+ A ++  D    +       E     L   +      +     +     
Sbjct: 172 DEHRQQVTASLQAFQKTMDAYSTLA---QQAEPTMRRLPQIADNLDSTLVATRKL----- 223

Query: 365 NNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDD 424
             SL       M T       +     S+ +     +   L  +    R+ ++ V  FD 
Sbjct: 224 TQSLSDPKGPLMTTLSGAGTDLTAATQSMQSAANVLTYETLPQLNGFAREARQAVRGFDH 283

Query: 425 CLNNFERNPQDIVW 438
            + +F   PQ +++
Sbjct: 284 AVTDFNARPQSVLF 297


>gi|169631230|ref|YP_001704879.1| MCE-family protein [Mycobacterium abscessus ATCC 19977]
 gi|169243197|emb|CAM64225.1| Hypothetical MCE-family protein [Mycobacterium abscessus]
          Length = 344

 Score = 98.5 bits (242), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 38/308 (12%), Positives = 101/308 (32%), Gaps = 7/308 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M+ +     V +F V +L  +   I          G        +  +   L +   VR 
Sbjct: 1   MK-RATQIKVIVFTVVMLLVAAGLIITFGEFRFGSGKRYH---AMFSTASDLRSGQKVRI 56

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G+PVGR+  + L+++          +     LY S+ A IR + L G  Y+E++    E
Sbjct: 57  AGVPVGRVKNVSLNRDNS--VEVTFDVDSKYQLYSSSRAIIRYENLVGDRYLEITAGPGE 114

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
              +    T   +          +   +          +  +      I+ ++    T  
Sbjct: 115 LHKLPDGGTLDKEHTQPALDLDALLGGLRPV-LKGFDAAKVNEISNAFIQILQGQGGTLS 173

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
             +   S+  +        +            + ++ +T         + + +   Q+ +
Sbjct: 174 QLLGDTSSFTSGLAERDQLIGDVINHLNEVLATVDSKSTQFSSSVDQLQQLISGLAQQRD 233

Query: 241 QILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAF 300
            +   +   ++        + +T   ++ T +  +++  ++D   +D +  +++   +  
Sbjct: 234 VVAGALPPLASTASSLESVLKDTRPYIKGTIEQARQLATRVDERKADVNVVVENLAENYL 293

Query: 301 LENIADST 308
             N   + 
Sbjct: 294 RLNALGAY 301


>gi|121592686|ref|YP_984582.1| hypothetical protein Ajs_0252 [Acidovorax sp. JS42]
 gi|120604766|gb|ABM40506.1| Mammalian cell entry related domain protein [Acidovorax sp. JS42]
          Length = 325

 Score = 98.5 bits (242), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 29/113 (25%), Positives = 59/113 (52%), Gaps = 3/113 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K++  + G+FV+++         WL+R            +    SV GL   ++VR+
Sbjct: 1   MENKSHALAAGIFVIAVAALLAGLGMWLTRDQ---TDYQLYELSSKDSVSGLQPQAAVRY 57

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIE 113
            G+ VG+++ +  D +   + L +  +  D P+ P+T AT+  QG+ G+ +++
Sbjct: 58  KGVAVGKVMHIGFDPQVSGNVLIRIAVNADAPISPTTFATLGYQGVTGLAHVQ 110



 Score = 50.3 bits (117), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 30/241 (12%), Positives = 60/241 (24%), Gaps = 12/241 (4%)

Query: 199 KMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVNQILENIQVSSNNFVKSSD 258
            ++    V   +  S  TF T+     +    ++  D +                   S 
Sbjct: 77  NVLIRIAVNADAPISPTTFATLGYQGVTGLAHVQLDDAEAPLPAPPPGASGLPRLPLHSS 136

Query: 259 QVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNMRSSISAI 318
                           QE  Q+I+ LL D + +  S       +         R   + +
Sbjct: 137 SFSQLAEQGPAILGQVQEATQRINTLLGDENQQRFSTALKQLGDAAGSIDQLARRLDNTV 196

Query: 319 REITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNISALKENNSLFKDAQRAMHT 378
               D     +  +      T      +   A   +                 A R +  
Sbjct: 197 TTRLDPALAGVPPLVQDTQQTLQALRQAGSSAATAAN------------DVSQAIRTLQA 244

Query: 379 FRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFERNPQDIVW 438
                ++I     S+      F +  L  I +   +            +    NPQ +++
Sbjct: 245 EGGALDEIAAGAKSLAGAADRFGRVTLPRINHAADETARAARRLGRTASGINDNPQSLIY 304

Query: 439 G 439
           G
Sbjct: 305 G 305


>gi|300113020|ref|YP_003759595.1| mammalian cell entry related domain-containing protein
           [Nitrosococcus watsonii C-113]
 gi|299538957|gb|ADJ27274.1| Mammalian cell entry related domain protein [Nitrosococcus watsonii
           C-113]
          Length = 155

 Score = 98.5 bits (242), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 31/116 (26%), Positives = 48/116 (41%), Gaps = 2/116 (1%)

Query: 3   SKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRFNG 62
           S+     VGLFV + L   F     +S  +         ++    ++ GL   S V   G
Sbjct: 4   SRTVELIVGLFVAAGLAAFFMLAMRVSNLSLMAQKNTYSVVAEFQNIGGLKVRSPVTLAG 63

Query: 63  IPVGRIVGLFLDQEYPNHSLAKALIRPDTP-LYPSTTATIRTQGLAGITYIELSTL 117
           + +GR+V + +D +    +  K  I      L   T+A+I T GL G  YI L   
Sbjct: 64  VTIGRVVSIQIDPQTYG-AQVKMHIEAQYNYLPEDTSASIYTSGLLGEQYIALEPG 118


>gi|239947171|ref|ZP_04698924.1| ABC transporter substrate binding protein [Rickettsia endosymbiont
           of Ixodes scapularis]
 gi|239921447|gb|EER21471.1| ABC transporter substrate binding protein [Rickettsia endosymbiont
           of Ixodes scapularis]
          Length = 149

 Score = 98.5 bits (242), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 28/119 (23%), Positives = 47/119 (39%), Gaps = 3/119 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M+     T +G FVV I+   F    + + S+       +V      S +G+   S V  
Sbjct: 1   MKQNIIETIIG-FVVLIIALLFLIFAYKTGSSITSSKGYQVTANF-QSAEGIEVGSDVMI 58

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRK 119
           +GI +G +  + LD     ++     I  D  +   + A + T GL G  YI +     
Sbjct: 59  SGIKIGSVKKITLDPNSF-YASVYLNINDDVKIPKDSKAQVVTSGLLGGKYISIVPGND 116


>gi|238756122|ref|ZP_04617443.1| hypothetical protein yruck0001_2770 [Yersinia ruckeri ATCC 29473]
 gi|238705661|gb|EEP98057.1| hypothetical protein yruck0001_2770 [Yersinia ruckeri ATCC 29473]
          Length = 180

 Score = 98.5 bits (242), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 31/136 (22%), Positives = 54/136 (39%), Gaps = 2/136 (1%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M++K     VGLF+V  L    F    ++            I     +V GL   S V+ 
Sbjct: 1   MQTKKTEVWVGLFIVIALAAIIFLCLKVADIKSVGNQPTYRIYATFDNVGGLKASSPVKI 60

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDT-PLYPSTTATIRTQGLAGITYIELSTLRK 119
            G+ VGR+  + LD +          I+     +  +++  +RT GL G  Y+ L+   +
Sbjct: 61  GGVVVGRVAEISLDTKNYTP-RVAIDIQDQYNNIPDTSSLAVRTSGLLGEQYLALNVGFE 119

Query: 120 EKKTIFQIATERNQRA 135
           + +    I  E +   
Sbjct: 120 DPEMGTSILKEGSTIQ 135


>gi|226364208|ref|YP_002781990.1| Mce family protein [Rhodococcus opacus B4]
 gi|226242697|dbj|BAH53045.1| putative Mce family protein [Rhodococcus opacus B4]
          Length = 340

 Score = 98.5 bits (242), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 35/298 (11%), Positives = 79/298 (26%), Gaps = 11/298 (3%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M  +     + +F   +           S+                  V GL     VR 
Sbjct: 1   MTVRATTVKLLIFATVMSVIFAGLALVFSQYRFSSSDGYHAT---FTDVSGLKPGDKVRI 57

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G+PVG +  + +D +    +     +     L+  T AT+R + L G  Y+EL      
Sbjct: 58  AGVPVGAVEKVSIDDDN--LADVDFTVDTKYSLFDGTKATVRYENLVGDRYMELLEGAGS 115

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNA------ENTSKKISDSSRHIQKIIENIEK 174
            + +    +   +          +             +  +       +  Q     +  
Sbjct: 116 VQPLPDGGSIPVENTSPALDLDLLLGGFKPLLRALDPQQVNDLSQALVQVFQGQGGTLVS 175

Query: 175 PLTTTIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAI 234
            L +T +   T++         I  +           D   +       + S     +  
Sbjct: 176 LLGSTSSFTNTLADRDQLIGEVITNLNQVLGTINDRGDQFRSTLDQLQQLVSGLSQDRDQ 235

Query: 235 DLQKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKM 292
               + +I       +     +   + +T+ +   T    Q     +D +  +     
Sbjct: 236 IGDAIPRIAGATGDLAGLLEGARPPLQSTIAEANRTATQLQAGEDDLDWVFQNLPDAY 293


>gi|67458574|ref|YP_246198.1| ABC transporter substrate binding protein [Rickettsia felis
           URRWXCal2]
 gi|67004107|gb|AAY61033.1| ABC transporter substrate binding protein [Rickettsia felis
           URRWXCal2]
          Length = 149

 Score = 98.5 bits (242), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 28/119 (23%), Positives = 48/119 (40%), Gaps = 3/119 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M+     T +G FVV I+   F    + + S+       +V      S +G++  S V  
Sbjct: 1   MKQNIIETIIG-FVVLIIALLFLIFAYKTGSSIASSKGYQVTANF-QSAEGIAVGSDVMI 58

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRK 119
           +GI +G +  + LD     ++     I  D  +   + A + T GL G  YI +     
Sbjct: 59  SGIKIGSVKKITLDPNSF-YASVYLNINDDVKIPKDSKAQVVTSGLLGGKYISIVPGND 116


>gi|118594040|ref|ZP_01551387.1| Mammalian cell entry related protein [Methylophilales bacterium
           HTCC2181]
 gi|118439818|gb|EAV46445.1| Mammalian cell entry related protein [Methylophilales bacterium
           HTCC2181]
          Length = 153

 Score = 98.5 bits (242), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 28/120 (23%), Positives = 44/120 (36%), Gaps = 1/120 (0%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME       VG+FV+  L   F     +      +      I     ++ GL   ++++ 
Sbjct: 1   MERTKLDIWVGIFVILGLAALFGLATKVGNLTSNNIKDTYTIYAHFENIGGLKPRAAIKA 60

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G+ VGR+  +  D E   H++    +         T A I T GL G  YI L      
Sbjct: 61  AGVVVGRVNSIIFDTEAY-HAVVSIDVDNRYIFPKDTFANIYTAGLLGEQYIGLEAGGDM 119


>gi|85058185|ref|YP_453887.1| hypothetical protein SG0207 [Sodalis glossinidius str. 'morsitans']
 gi|84778705|dbj|BAE73482.1| conserved hypothetical protein [Sodalis glossinidius str.
           'morsitans']
          Length = 175

 Score = 98.5 bits (242), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 28/133 (21%), Positives = 50/133 (37%), Gaps = 2/133 (1%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M++K     VG F++  L    F    ++            I     ++ GL   S VR 
Sbjct: 1   MQTKKSEIWVGAFMIIALCAIVFLCLKVADIRSVSNAATYRISASFDNIGGLKVRSPVRV 60

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDT-PLYPSTTATIRTQGLAGITYIELSTLRK 119
            G+ +GR+  + LD +          I      +  +++  IRT GL G  Y+ L+    
Sbjct: 61  GGVVIGRVADITLDPKTYTP-KVTIDIEQTYNHIPDTSSLAIRTSGLLGEQYLALNIGFD 119

Query: 120 EKKTIFQIATERN 132
           + +    I  +  
Sbjct: 120 DPEMGTSILKDGG 132


>gi|284008693|emb|CBA75355.1| conserved hypothetical protein [Arsenophonus nasoniae]
          Length = 177

 Score = 98.1 bits (241), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 30/146 (20%), Positives = 55/146 (37%), Gaps = 2/146 (1%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M+SK     VGLFV+  L    F    ++    +       +     +V GL  +S V+ 
Sbjct: 1   MQSKKSEILVGLFVLIALAAIVFLCLKVADIKSFGNQPTYKVTASFTNVGGLKVNSPVKI 60

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTP-LYPSTTATIRTQGLAGITYIELSTLRK 119
            G+ VGRIV + LD++          I      +  +++ +I T GL G  ++ L+    
Sbjct: 61  GGVVVGRIVDIMLDKKTYTP-RVTLAIFSQYDNIPDNSSLSILTAGLLGEQFLALNVGFY 119

Query: 120 EKKTIFQIATERNQRAMITATPSGIN 145
           +         +  +           +
Sbjct: 120 DPDMGITFLKDGGRIEDTKPAIILED 145


>gi|315639124|ref|ZP_07894291.1| ABC superfamily ATP binding cassette transporter periplasmic
           substrate-binding protein [Campylobacter upsaliensis
           JV21]
 gi|315480828|gb|EFU71465.1| ABC superfamily ATP binding cassette transporter periplasmic
           substrate-binding protein [Campylobacter upsaliensis
           JV21]
          Length = 295

 Score = 98.1 bits (241), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 32/124 (25%), Positives = 57/124 (45%), Gaps = 1/124 (0%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K  Y  VG+F+  + F S   + WL   ++ +       I    SV GL   + VR 
Sbjct: 1   MENKASYFWVGIFIFGVFFVSLIFMLWLGGYSEEESFEYY-EIHTQESVAGLGLKAPVRL 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G+ VG +  + +  +          ++ +TP+   T AT++ QG+ G+ +I+L      
Sbjct: 60  LGVEVGSVENISIYTKQNLGVNILIKVKKETPIKEDTFATLQLQGITGLKFIQLQGGSVN 119

Query: 121 KKTI 124
            K +
Sbjct: 120 SKKL 123


>gi|198283901|ref|YP_002220222.1| Mammalian cell entry related domain-containing protein
           [Acidithiobacillus ferrooxidans ATCC 53993]
 gi|218665999|ref|YP_002426535.1| mce-related protein [Acidithiobacillus ferrooxidans ATCC 23270]
 gi|198248422|gb|ACH84015.1| Mammalian cell entry related domain protein [Acidithiobacillus
           ferrooxidans ATCC 53993]
 gi|218518212|gb|ACK78798.1| mce-related protein [Acidithiobacillus ferrooxidans ATCC 23270]
          Length = 312

 Score = 98.1 bits (241), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 33/193 (17%), Positives = 69/193 (35%), Gaps = 3/193 (1%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           MES+ +     +F+  +         W+    +   P     +    SV GL+  + VRF
Sbjct: 1   MESRAHALVALIFLAVLGIGMVVVGLWMHHRQR---PGVTFDVISRYSVAGLTLQAPVRF 57

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G+ VG +  + LD   P     +  +   TP+  +T A +  QG+ G++Y+ L+     
Sbjct: 58  KGVRVGEVTAIGLDPANPRMIRVRIKVDEATPVTRATFAELAPQGVTGLSYLSLTDHGTN 117

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
              + ++ +   +  M  +    ++    +  N    ++     +           T   
Sbjct: 118 FAPLPRVDSRPAEIPMHPSFWEVLSRNGESLVNRGNVLASRMNMLLNSQNRARFGQTLIH 177

Query: 181 ANIETISTVLANN 193
            +  T   V    
Sbjct: 178 LDQATDHLVQMEM 190


>gi|261378130|ref|ZP_05982703.1| toluene tolerance ABC transporter, periplasmic substrate-binding
           protein [Neisseria cinerea ATCC 14685]
 gi|269145590|gb|EEZ72008.1| toluene tolerance ABC transporter, periplasmic substrate-binding
           protein [Neisseria cinerea ATCC 14685]
          Length = 165

 Score = 98.1 bits (241), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 26/119 (21%), Positives = 46/119 (38%), Gaps = 4/119 (3%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYD--GPMAEVIIRIPGSVDGLSTDSSV 58
           M+       VGLFV+  +    F  + ++    +   G    V       + GL  ++ +
Sbjct: 1   MKKNVLEFWVGLFVLLGVAAVGFLAFRVAGGAAFGNSGKTYTVYADFSD-IGGLKANAPI 59

Query: 59  RFNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTL 117
           +  G+ VGR+  + LD +    +  +  +          +A I T GL G  YI L   
Sbjct: 60  KSAGVLVGRVGSIELDPKSY-QAKVRLDLDSKYQFSSDVSAQILTSGLLGEQYIGLQQG 117


>gi|254670841|emb|CBA07274.1| mce related protein [Neisseria meningitidis alpha153]
 gi|308814917|dbj|BAJ22981.1| a component of GltT L-glutamate ABC transporter [Neisseria
           meningitidis]
 gi|325127427|gb|EGC50358.1| mce family protein [Neisseria meningitidis N1568]
          Length = 164

 Score = 98.1 bits (241), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 26/119 (21%), Positives = 46/119 (38%), Gaps = 4/119 (3%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYD--GPMAEVIIRIPGSVDGLSTDSSV 58
           M+       VGLFV+  +    F  + ++    +   G    V       + GL  ++ +
Sbjct: 1   MKKNILEFWVGLFVLLGVAAVGFLAFRVAGGAAFGNSGKTYTVYADFSD-IGGLKANAPI 59

Query: 59  RFNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTL 117
           +  G+ VGR+  + LD +    +  +  +          +A I T GL G  YI L   
Sbjct: 60  KSAGVLVGRVGSIELDPKSY-QAKVRLDLDSKYQFSSDVSAQILTSGLLGEQYIGLQQG 117


>gi|157964867|ref|YP_001499691.1| ABC transporter substrate binding protein [Rickettsia massiliae
           MTU5]
 gi|157844643|gb|ABV85144.1| ABC transporter substrate binding protein [Rickettsia massiliae
           MTU5]
          Length = 149

 Score = 98.1 bits (241), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 28/119 (23%), Positives = 47/119 (39%), Gaps = 3/119 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M+     T +G FVV I+   F    + + S+       +V      S +G+   S V  
Sbjct: 1   MQQNIIETIIG-FVVLIIALLFLIFAYKTGSSITSSKGYQVTAHF-QSAEGIVVGSDVMI 58

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRK 119
           +GI +G +  + LD     ++     I  D  +   + A + T GL G  YI +     
Sbjct: 59  SGIKIGSVKKITLDPNSF-YASVYLNINDDVKIPKDSKAQVVTSGLLGGKYISIVPGND 116


>gi|291279511|ref|YP_003496346.1| ABC transporter substrate-binding protein [Deferribacter
           desulfuricans SSM1]
 gi|290754213|dbj|BAI80590.1| ABC transporter, substrate-binding protein [Deferribacter
           desulfuricans SSM1]
          Length = 526

 Score = 98.1 bits (241), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 54/311 (17%), Positives = 100/311 (32%), Gaps = 4/311 (1%)

Query: 7   YTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRFNGIPVG 66
              VG+FVV  L    +    +           E+I  +     GL  DS V++ G+ VG
Sbjct: 6   EAKVGIFVVIGLLLLGYMTTKVEDLKLGKSDGYEIIAYL-NDASGLVKDSYVKYRGVEVG 64

Query: 67  RIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKEKKTIFQ 126
           ++  + L +    H     LI     L  +  A +R+ G  G  Y+EL T+ KE +    
Sbjct: 65  KVKDIRLKEN---HVEVVLLIDKQYKLPSNVAAIVRSSGFLGEKYLELQTVGKETEGYLT 121

Query: 127 IATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTIANIETI 186
             +E              N F   A++     +     I       +  +T       T 
Sbjct: 122 TGSEIKNYKSSADFDELQNKFSEIADDIKAITASLKEVIASDNGKADMKMTLQNIRYSTE 181

Query: 187 STVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVNQILENI 246
                   +          +   ++  KN      + +  L   +K +     NQ  +  
Sbjct: 182 YIRQMLEENQKRINQIVKNIEAITASIKNVTEANQENVNQLITNLKEVSETLKNQTPQIA 241

Query: 247 QVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAFLENIAD 306
           +  +N      D V N+  D+RET    + V  K++  + + +                 
Sbjct: 242 KKINNITTNIDDLVGNSKGDLRETISNIKVVTAKLEKTVDNLNDITDKINKGKGTVGTLI 301

Query: 307 STSNMRSSISA 317
           + +     +  
Sbjct: 302 NDNETAKDVKD 312


>gi|118473663|ref|YP_890125.1| virulence factor Mce family protein [Mycobacterium smegmatis str.
           MC2 155]
 gi|118174950|gb|ABK75846.1| virulence factor Mce family protein [Mycobacterium smegmatis str.
           MC2 155]
          Length = 344

 Score = 98.1 bits (241), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 37/308 (12%), Positives = 91/308 (29%), Gaps = 6/308 (1%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M        VG+F + +L  +   +          G               L     VR 
Sbjct: 1   MHRDRTMLKVGIFTMVMLLVAAGLVVVFGEFRFAAGQSYHAT---FSEASRLKAGQDVRI 57

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G+PVG +  + L+ +          +     LY S+ A +R + L G  Y+E+++   E
Sbjct: 58  AGVPVGTVKSVKLNPDNT--VDVGFDVNKRYQLYTSSRAVVRYENLVGDRYLEITSGPGE 115

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
            + +    T   Q          +   +            +      +IE ++       
Sbjct: 116 LRKLAPGGTLGLQNTQPALDLDALLGGLRPVLKGLDGAKINEV-SNAVIEMLQGQGGALA 174

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
             + + S    N  +    +            + +      D      + +     +  +
Sbjct: 175 NMLTSTSAFTQNLAARDQLISDVIANLNTVLGTVDEKGAQFDASVDQLQQLITGLAENKD 234

Query: 241 QILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAF 300
            I   I+  ++     ++ +  +   V+   +  + +  ++D    D +  ++    +  
Sbjct: 235 PIAGAIEPLASAESDLTEMLEKSRRPVQGVIENVRPMAGRMDERKDDINKVIEPLAENYL 294

Query: 301 LENIADST 308
             N   + 
Sbjct: 295 RLNALGAY 302


>gi|225077105|ref|ZP_03720304.1| hypothetical protein NEIFLAOT_02158 [Neisseria flavescens
           NRL30031/H210]
 gi|241758966|ref|ZP_04757078.1| outer membrane transport protein [Neisseria flavescens SK114]
 gi|224951662|gb|EEG32871.1| hypothetical protein NEIFLAOT_02158 [Neisseria flavescens
           NRL30031/H210]
 gi|241320787|gb|EER57020.1| outer membrane transport protein [Neisseria flavescens SK114]
          Length = 164

 Score = 98.1 bits (241), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 26/118 (22%), Positives = 43/118 (36%), Gaps = 2/118 (1%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRI-PGSVDGLSTDSSVR 59
           M+       VGLFV+       F  +  +    +        +      + GL T++ V+
Sbjct: 1   MKKNALEFWVGLFVLLGAAAIGFLAFRAAGGQSFGKSSQTYTVYADFSDIGGLKTNAPVK 60

Query: 60  FNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTL 117
             G+ VGR+  + LD +    +     +          +A I T GL G  YI L   
Sbjct: 61  SAGVLVGRVASIQLDPKSY-QAKVALNLDSQYQFSSDVSAQILTSGLLGEQYIGLQQG 117


>gi|149907974|ref|ZP_01896642.1| hypothetical protein PE36_19940 [Moritella sp. PE36]
 gi|149808980|gb|EDM68911.1| hypothetical protein PE36_19940 [Moritella sp. PE36]
          Length = 149

 Score = 97.7 bits (240), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 28/133 (21%), Positives = 52/133 (39%), Gaps = 2/133 (1%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M+  +  TSVG+FV+  +    +    L +          V      S  GL   ++V  
Sbjct: 1   MKKSSIETSVGIFVLIGILCVGYLTIKLGKMELLSDNYYSVYADF-NSATGLKGGANVEM 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G+ +G+I  + L       +  K  I  +  L     A+++T GL G  Y+ L+    +
Sbjct: 60  AGVKIGQIDNIVLLPN-IKIARVKLNIDKEITLSVDVIASVKTAGLLGDRYLSLTPGGSD 118

Query: 121 KKTIFQIATERNQ 133
           +      + E  +
Sbjct: 119 EYLEAGDSIEETE 131


>gi|328953208|ref|YP_004370542.1| Mammalian cell entry related domain protein [Desulfobacca
           acetoxidans DSM 11109]
 gi|328453532|gb|AEB09361.1| Mammalian cell entry related domain protein [Desulfobacca
           acetoxidans DSM 11109]
          Length = 146

 Score = 97.7 bits (240), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 27/138 (19%), Positives = 53/138 (38%), Gaps = 4/138 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M+       VG+FV+  L    +    L       G    +      ++ GL   + V  
Sbjct: 1   MKKARIELLVGVFVIIGLVCLAYLAIHLGEMEFLGG-GYRLTADF-DNISGLKVGALVEV 58

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G+ VG++  + +++E   H +    I     +Y    A++RT+G+ G  YI+LS    +
Sbjct: 59  AGVDVGKVESIGVNRENMAHVV--LNINKGVIVYQDAIASVRTKGIIGDKYIKLSVGGAD 116

Query: 121 KKTIFQIATERNQRAMIT 138
           +           +  +  
Sbjct: 117 EPLPPNGRIRHTESVLEW 134


>gi|237752256|ref|ZP_04582736.1| ABC transporter permease [Helicobacter winghamensis ATCC BAA-430]
 gi|229376498|gb|EEO26589.1| ABC transporter permease [Helicobacter winghamensis ATCC BAA-430]
          Length = 272

 Score = 97.7 bits (240), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 32/166 (19%), Positives = 63/166 (37%), Gaps = 3/166 (1%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++  Y  +G+F+V+ L      ++W+ + ++  G   E  +       G+  ++ VR+
Sbjct: 1   MEARLNYVLLGVFLVASLVALAGFVFWMGKYDRNLGAYVEYYLYNKELPKGIRIETPVRY 60

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G+PVG +    L             ++ +  L   T A + +QGL G  YI L+     
Sbjct: 61  LGLPVGFVKSYDLSTAQD-KVEIVLWVKKEIMLKEGTRAIVESQGLTGGNYIALTQGDG- 118

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQ 166
              + +      Q   I    S         E +  +++       
Sbjct: 119 -APLTKGGVIDFQENWIEKLGSKTEVVFDRLEVSLDRLNMLLSEKN 163


>gi|300724963|ref|YP_003714288.1| putative ABC transporter periplasmic-binding protein [Xenorhabdus
           nematophila ATCC 19061]
 gi|297631505|emb|CBJ92212.1| putative transport protein (ABC superfamily, peri_bind)
           [Xenorhabdus nematophila ATCC 19061]
          Length = 170

 Score = 97.7 bits (240), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 28/146 (19%), Positives = 55/146 (37%), Gaps = 2/146 (1%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M++K     VG FV+  L    F    ++    +       I     ++ GL   S V+ 
Sbjct: 1   MQNKKNEIWVGAFVLIALAAIIFLCLKVADIRSFGNQATYRISAAFDNIGGLKVRSPVKV 60

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTP-LYPSTTATIRTQGLAGITYIELSTLRK 119
            G+ +GR+  ++LD +          I      +  +++ +IRT GL G  YI L+    
Sbjct: 61  GGVVIGRVQKIWLDHKTYTP-QVALDIFTQYDNIPDTSSLSIRTSGLLGEQYIALNIGFD 119

Query: 120 EKKTIFQIATERNQRAMITATPSGIN 145
           +      +  + ++           +
Sbjct: 120 DPDLGTAMLKDGDRIEDTKPAMVLED 145


>gi|302342027|ref|YP_003806556.1| Mammalian cell entry related domain protein [Desulfarculus baarsii
           DSM 2075]
 gi|301638640|gb|ADK83962.1| Mammalian cell entry related domain protein [Desulfarculus baarsii
           DSM 2075]
          Length = 305

 Score = 97.7 bits (240), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 38/158 (24%), Positives = 68/158 (43%), Gaps = 2/158 (1%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M SK+    +GLFV+S +  +   + W+  +    G    V      SV GL  DS V++
Sbjct: 1   MSSKSSNVRLGLFVLSGITLAVVILVWMGAAKYMKGATTYVTF-FDESVQGLQIDSRVKY 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G+ VGR+  + +  +          I  D  L     A ++T G+ GI ++EL   R  
Sbjct: 60  RGVEVGRVTDVRVAPD-FRLIEVVMEIGFDGDLSHDMVAQLQTIGITGIMFVELDRQRPG 118

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKI 158
            K    +     +  +I + PS ++  +   +  + +I
Sbjct: 119 DKAESPVINFAAEHPIIPSKPSEMHRLLGVIDRITNQI 156



 Score = 41.8 bits (95), Expect = 0.21,   Method: Composition-based stats.
 Identities = 17/177 (9%), Positives = 61/177 (34%), Gaps = 5/177 (2%)

Query: 263 TVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNMRSSISAIREIT 322
                     +      ++  ++   ++++   +  A   +I  +   +R  +       
Sbjct: 127 NFAAEHPIIPSKPSEMHRLLGVIDRITNQISRIDFEALGNDINQTIKGVRDLVQDGALKK 186

Query: 323 DQRQKIISTINTIENITSNLNDSSQ-KFAELMSKINNISALKENNSLFKDAQRAMHTFRD 381
                  +  N        L++    +  + +   N  +  +  ++L  +A++A+   R 
Sbjct: 187 TVDNMQATAANLESITALVLSEVKGGELRKAVKSFN--TGAQSFDALMGEARQALKDLR- 243

Query: 382 TSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFERNPQDIVW 438
             ++    +  +   L++ + +     +  +  L+ +    D+ L   E NP  +++
Sbjct: 244 -LKETAGQVRELAAVLKDQTVAIAQLTRRTMVNLRSSSGRLDNLLRRLEMNPSYLIF 299


>gi|237751538|ref|ZP_04582018.1| predicted protein [Helicobacter bilis ATCC 43879]
 gi|229372904|gb|EEO23295.1| predicted protein [Helicobacter bilis ATCC 43879]
          Length = 255

 Score = 97.7 bits (240), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 24/111 (21%), Positives = 44/111 (39%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME    YT +GL    +       I+W+ R    D  +    +     V G+S ++ V++
Sbjct: 1   MERNINYTLIGLIFCILTIAMIAFIFWIGRFGIDDRRVKIYHVYTQDEVGGISVNTPVKY 60

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITY 111
            GI VG +  +   ++          I    P+   +   I + G  G++Y
Sbjct: 61  KGISVGSVTHMGFKKDDVGVVQIDVAINKKIPVREGSELVIDSDGFVGMSY 111



 Score = 37.2 bits (83), Expect = 4.9,   Method: Composition-based stats.
 Identities = 23/227 (10%), Positives = 61/227 (26%), Gaps = 11/227 (4%)

Query: 221 TDLITSLDKMIKAIDLQKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQK 280
             +     K+       +V  I  N  V        S   +    D     Q    + +K
Sbjct: 31  FGIDDRRVKIYHVYTQDEVGGISVNTPVKYKGISVGSVTHMGFKKDDVGVVQIDVAINKK 90

Query: 281 IDHLLSDFSSKMKSKETSAFLENIADSTSNMRSSISAIREITDQRQKIISTINTIENITS 340
           I                      +  +             +   +  I   +   + +T+
Sbjct: 91  IPVREGSELVIDSDGFVGMSYLKLKQNEKGNIIKDEDEATLYLAKNAIGKLLENAQGMTN 150

Query: 341 NLNDSSQKFAELMSKINNISALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNF 400
           ++ D       +    N    +++  ++    +        T    ++ +  +   L   
Sbjct: 151 DIQDIVSNVKNITDSKN----IEDIRNMLISLEGTKQNLDKTLNSADKLLRDLDKALLRG 206

Query: 401 SQSGLNDIQNLVRKLQETVNHFDDCL-------NNFERNPQDIVWGR 440
             +    +  L+ K   ++   +  L       +  ER+P + + G+
Sbjct: 207 DFNVREILTPLINKSGYSLQTLNSFLEKASLFMDRMERDPYETLLGK 253


>gi|121593174|ref|YP_985070.1| hypothetical protein Ajs_0750 [Acidovorax sp. JS42]
 gi|120605254|gb|ABM40994.1| Mammalian cell entry related domain protein [Acidovorax sp. JS42]
          Length = 161

 Score = 97.7 bits (240), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 24/122 (19%), Positives = 41/122 (33%), Gaps = 1/122 (0%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M+       VGLFV+       F     +     +      +     ++ GL   ++VR 
Sbjct: 1   MQHSKNDFWVGLFVLLGGAALVFLALQSANLLNLNFRSGYTVTARFDNIGGLKPKAAVRS 60

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G+ VGR+  +  D      +     +         ++  I T GL G  YI +     E
Sbjct: 61  AGVVVGRVQSIGFDVTTY-QARVTLELEKRYVFPKDSSLKILTSGLLGDQYIGIEPGADE 119

Query: 121 KK 122
             
Sbjct: 120 NN 121


>gi|237756548|ref|ZP_04585073.1| mce related protein [Sulfurihydrogenibium yellowstonense SS-5]
 gi|237691291|gb|EEP60374.1| mce related protein [Sulfurihydrogenibium yellowstonense SS-5]
          Length = 515

 Score = 97.7 bits (240), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 55/377 (14%), Positives = 134/377 (35%), Gaps = 25/377 (6%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M++      VG+FV+ +   + + I   S            +        GLS  + V+ 
Sbjct: 1   MKTSQ---KVGIFVLLVSILTGYLIIKFSGKELGQSFKTYYV--YFDDAQGLSKGADVQV 55

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G+  GR+  +  +        A   I+ + PLY + T +IRT GL G  YI ++     
Sbjct: 56  LGVKAGRVEDISFE---NGKVKAILKIKKEIPLYKNATVSIRTYGLMGDKYIYINPGSPN 112

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
              + +    +NQ              I++ E    +I+ +++   ++++N+ K      
Sbjct: 113 TGNLAENQVIQNQ------------AKIASTEEMINQINVAAQKFAQLMDNLNKATGDDR 160

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
                       + ++   + +   +    ++ +     I   + S+ + +        N
Sbjct: 161 LKKLIEDFDKFASNTNDVVVENKEDIRQSIANIRQITADIRQQLPSIIQNLDKTLENTKN 220

Query: 241 QILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAF 300
              EN +          D  I       +T  +  +   +I+  +S+       ++    
Sbjct: 221 ITAENREDIRKLIANLKDLSIALKEKAPKTLDSVDKAATQIEQAVSENR-----QDLKLS 275

Query: 301 LENIADSTSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNIS 360
           +ENI  ++ N+   ++ + E      K+++  +   N+   +   ++ F  +      + 
Sbjct: 276 IENIKKASQNLNELLAKVNEGKGTLGKLVNQDDLYNNVNEGVKSFAEPFKVVKESNLEVI 335

Query: 361 ALKENNSLFKDAQRAMH 377
              E ++   D++    
Sbjct: 336 MQGEKHTGNDDSKAGAA 352


>gi|149190596|ref|ZP_01868865.1| putative ABC superfamily transport protein [Vibrio shilonii AK1]
 gi|148835594|gb|EDL52562.1| putative ABC superfamily transport protein [Vibrio shilonii AK1]
          Length = 160

 Score = 97.7 bits (240), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 29/130 (22%), Positives = 51/130 (39%), Gaps = 3/130 (2%)

Query: 3   SKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYD-GPMAEVIIRIPGSVDGLSTDSSVRFN 61
           ++     VG FV+  L    F I+ ++       G   ++  R   ++  L   S V+  
Sbjct: 4   TRKLELWVGSFVIIGLCAILFMIFQVADVKGLGSGDTYKLEARF-DNIGSLKVRSPVKVG 62

Query: 62  GIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKEK 121
           G+ +GR+  + LD+E          I  D     +++A + T GL G  YI L       
Sbjct: 63  GVVIGRVSDISLDKESYLPV-VTLSISSDYRFPDTSSAQVLTSGLIGEQYIGLVPGFIFD 121

Query: 122 KTIFQIATER 131
              +    +R
Sbjct: 122 DEGYLADGDR 131


>gi|259907020|ref|YP_002647376.1| hypothetical protein EpC_03390 [Erwinia pyrifoliae Ep1/96]
 gi|224962642|emb|CAX54097.1| Putative membrane protein [Erwinia pyrifoliae Ep1/96]
 gi|283476815|emb|CAY72653.1| Uncharacterized protein yrbD precursor [Erwinia pyrifoliae DSM
           12163]
          Length = 182

 Score = 97.7 bits (240), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 26/146 (17%), Positives = 52/146 (35%), Gaps = 2/146 (1%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M++K     VG F++  L    F    ++            +     +V GL   S V+ 
Sbjct: 1   MQTKKSEIWVGAFLLLALCAIIFLCLRVTDLKSLGNVSTWKLHATFDNVGGLKPGSPVKI 60

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDT-PLYPSTTATIRTQGLAGITYIELSTLRK 119
            G+ +GR+  + LD +  +       I      +  +++  +RT GL G  Y+ L+    
Sbjct: 61  GGVVIGRVSDIVLDPKTYSP-KVSMDIEDQYNNIPDTSSLAVRTSGLLGEQYLALNIGFD 119

Query: 120 EKKTIFQIATERNQRAMITATPSGIN 145
           + +    I           +     +
Sbjct: 120 DPEMGTAILKNGGTVQDTKSAMVLED 145


>gi|154175509|ref|YP_001408230.1| hypothetical protein CCV52592_1435 [Campylobacter curvus 525.92]
 gi|112802187|gb|EAT99531.1| conserved domain protein [Campylobacter curvus 525.92]
          Length = 313

 Score = 97.7 bits (240), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 33/122 (27%), Positives = 57/122 (46%), Gaps = 1/122 (0%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++N YT VG+F +  +      I+W++  +          I       GL  DS V+F
Sbjct: 1   MENRNSYTIVGMFFIFCMSAFAVFIWWMTNHDDSKLQYKNYYIHTSELPSGLKVDSQVKF 60

Query: 61  NGIPVGRIVGLFLDQEYPNH-SLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRK 119
            G+P G +  +   ++  N        IR D P+   + A+I TQ ++G+  I +S  ++
Sbjct: 61  IGVPAGTVSKIDFVKDDKNALIEITMKIRDDVPIRKDSVASIETQAISGVASINISRGKE 120

Query: 120 EK 121
           E 
Sbjct: 121 EF 122


>gi|296313906|ref|ZP_06863847.1| toluene tolerance ABC transporter, periplasmic substrate-binding
           protein [Neisseria polysaccharea ATCC 43768]
 gi|296839440|gb|EFH23378.1| toluene tolerance ABC transporter, periplasmic substrate-binding
           protein [Neisseria polysaccharea ATCC 43768]
          Length = 165

 Score = 97.7 bits (240), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 26/119 (21%), Positives = 45/119 (37%), Gaps = 4/119 (3%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYD--GPMAEVIIRIPGSVDGLSTDSSV 58
           M+       VGLFV+       F  + ++    +   G    V       + GL  ++ +
Sbjct: 1   MKKNVLEFWVGLFVLIGAAAVAFLAFRVAGGAAFGNSGKTYTVYADFSD-IGGLKANAPI 59

Query: 59  RFNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTL 117
           +  G+ VGR+  + LD +    +  +  +          +A I T GL G  YI L   
Sbjct: 60  KSAGVLVGRVGSIELDPKSY-QARVRLDLDGKYQFSSDVSAQILTSGLLGEQYIGLQQG 117


>gi|289207569|ref|YP_003459635.1| hypothetical protein TK90_0384 [Thioalkalivibrio sp. K90mix]
 gi|288943200|gb|ADC70899.1| Mammalian cell entry related domain protein [Thioalkalivibrio sp.
           K90mix]
          Length = 152

 Score = 97.3 bits (239), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 30/121 (24%), Positives = 50/121 (41%), Gaps = 2/121 (1%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M+ + +  +VG+FV+  +   F+    +S    Y       +     ++ GL T + V  
Sbjct: 1   MKVRFFELAVGVFVLLGVAALFYLAIQVSNVTDYHDRDTYTVTAYFDNIGGLKTRAPVTV 60

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTP-LYPSTTATIRTQGLAGITYIELSTLRK 119
           +G+ +GR+  +  D E    +     IR +   L   T A I T GL G  YI L     
Sbjct: 61  SGVRIGRVAEIRYDPEQFR-AEVTLAIRAEHDYLPMDTQAAIHTAGLLGEQYIALEPGGD 119

Query: 120 E 120
            
Sbjct: 120 Y 120


>gi|254467962|ref|ZP_05081368.1| ABC transporter, periplasmic substrate-binding protein [beta
           proteobacterium KB13]
 gi|207086772|gb|EDZ64055.1| ABC transporter, periplasmic substrate-binding protein [beta
           proteobacterium KB13]
          Length = 154

 Score = 97.3 bits (239), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 26/122 (21%), Positives = 40/122 (32%), Gaps = 1/122 (0%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M+       VG+FV   L         +      D      +     ++ GL   + V+ 
Sbjct: 1   MDRIKLDAWVGIFVALGLIALMGLAMKVGNLTSNDIKTTYFVTANFENIGGLKPRAPVKS 60

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G+ VGR+  +  D +    ++    I         T A I T GL G  YI L      
Sbjct: 61  AGVVVGRVDSIVFDTKMYE-AIVTMSIDERYVFPKDTFANIYTAGLLGEQYIGLEAGGDP 119

Query: 121 KK 122
             
Sbjct: 120 DN 121


>gi|307728303|ref|YP_003905527.1| Mammalian cell entry related domain-containing protein
           [Burkholderia sp. CCGE1003]
 gi|307582838|gb|ADN56236.1| Mammalian cell entry related domain protein [Burkholderia sp.
           CCGE1003]
          Length = 320

 Score = 97.3 bits (239), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 29/128 (22%), Positives = 61/128 (47%), Gaps = 3/128 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K++    GLF + +L     + +  +             +    +V GL +D++VR+
Sbjct: 1   MENKSHAFWAGLFTIVLLAAIATAAFLFNVDRAV---RVPYDLIARTNVTGLFSDAAVRY 57

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G+ VG++  +  D+++P   + + L+    P+  ST  ++  QG+ GI +I+L     +
Sbjct: 58  RGLDVGKVQSIKFDRDHPGQIVIRILVDTHAPITHSTYGSLGFQGVTGIAFIQLDDTGHD 117

Query: 121 KKTIFQIA 128
              +   A
Sbjct: 118 PSPLPSSA 125


>gi|90580198|ref|ZP_01236005.1| putative ABC superfamily transport protein [Vibrio angustum S14]
 gi|90438500|gb|EAS63684.1| putative ABC superfamily transport protein [Vibrio angustum S14]
          Length = 159

 Score = 97.3 bits (239), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 23/134 (17%), Positives = 53/134 (39%), Gaps = 4/134 (2%)

Query: 3   SKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRFNG 62
           +K     VG+F+++ +       + ++    +    +  +     ++ GL   S V+  G
Sbjct: 4   NKRLELWVGIFMLAGIAALLVLAFKVANLQSFGSNESYTLKAHFDNIGGLKVRSPVKVGG 63

Query: 63  IPVGRIVGLFLDQEYPNHSLAKALIRPDT-PLYPSTTATIRTQGLAGITYIELSTLR--K 119
           + VG +  + LD+E     +    I         +++A+I T GL G  Y+ +S      
Sbjct: 64  VTVGEVTAINLDKETYIP-MVTLSINKKFGYFPETSSASILTSGLLGEQYLGISPGFVDD 122

Query: 120 EKKTIFQIATERNQ 133
           + + +       + 
Sbjct: 123 DVEMLHNGDLIEDT 136


>gi|322419714|ref|YP_004198937.1| Mammalian cell entry related domain-containing protein [Geobacter
           sp. M18]
 gi|320126101|gb|ADW13661.1| Mammalian cell entry related domain protein [Geobacter sp. M18]
          Length = 561

 Score = 97.3 bits (239), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 40/403 (9%), Positives = 113/403 (28%), Gaps = 13/403 (3%)

Query: 43  IRIPGSVDGLSTDSSVRFNGIPVGRIVGLFLDQEYPNH-SLAKALIRPDTPLYPSTTATI 101
           +     V  L T S V F  I VG++V   LD +              D  +  ST    
Sbjct: 171 VLHTDDVGSLYTGSPVFFRRIQVGQVVSTDLDGDGQGVTVRVFIRSPYDRFVTASTFFWH 230

Query: 102 RTQGLAGITYIELSTLRKEKKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDS 161
            +     ++   +    +    +       +Q     +T S           T  +   +
Sbjct: 231 ASGVDLTVSPGGVKLNTESMLAVLLGGISFDQPPNPPSTVSAPPNTAYTLYGTRDEALKN 290

Query: 162 SRHIQKIIENIEKPLTTTIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTIT 221
           S   +K +    + +             +         +         S   +  F    
Sbjct: 291 SAASEKFVLVFRESVRGLAVGATVDLRGVTVGEVTDIDVALDPSRAGFSVPVEIQFYPEH 350

Query: 222 DLITSLDKMIKAIDLQKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKI 281
            L          + L    +  E +     +  ++  +  + +         F    ++ 
Sbjct: 351 LLSRGRQGKGGTLPLSGSGETRELLDDLVAHGFRAQIKSGSLLTGQLYVALDFVPGARRT 410

Query: 282 DHLLSDFSSKMKSKETSAFLENIADSTSNMRSSISAIREITDQRQKIISTINTIENITSN 341
               S    +  +             +               ++  +            +
Sbjct: 411 RIDWSSSPPRFPTV----------PGSMEKLQKNLIEIVQKIEKLPLDKLAGDAGQSLRS 460

Query: 342 LNDSSQKFAELMSKINNISALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFS 401
           L+++ +    ++  ++    + E  S   +++ A+   R T  +    +      L + +
Sbjct: 461 LDETLKSADRVLKNVDRNL-IPEAKSALAESRTALEDVRKTLAEARTTLGGANQALSSDA 519

Query: 402 QSGLNDIQNLVRKLQETVNHFDDCLNNFERNPQDIVWGREKGS 444
              + D+++ +R++           +  E++P+ ++ G+++  
Sbjct: 520 PVQV-DLRDTLREVSRAAQSLRVLGDYLEQHPESLIRGKKEEK 561



 Score = 54.9 bits (129), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 15/72 (20%), Positives = 26/72 (36%), Gaps = 3/72 (4%)

Query: 41  VIIRIPGSVDGLSTDSSVRFNGIPVGRIVGLF--LDQEYPNH-SLAKALIRPDTPLYPST 97
            ++    SV GL+  ++V   G+ VG +  +   LD          +    P+  L    
Sbjct: 297 FVLVFRESVRGLAVGATVDLRGVTVGEVTDIDVALDPSRAGFSVPVEIQFYPEHLLSRGR 356

Query: 98  TATIRTQGLAGI 109
                T  L+G 
Sbjct: 357 QGKGGTLPLSGS 368



 Score = 41.8 bits (95), Expect = 0.24,   Method: Composition-based stats.
 Identities = 38/453 (8%), Positives = 119/453 (26%), Gaps = 39/453 (8%)

Query: 14  VVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTD-SSVRFNGIPVGRIVGLF 72
           ++ I+         +     +      + I      +GL    + +++  + +G +  + 
Sbjct: 31  IIPIVAAIIGLSIAVKA---WVDRGQTITISFKT-GEGLEAGKTKLKYKDVMIGEVKSIA 86

Query: 73  LDQEYPNHSLAKALIRPDTP--LYPSTTATIRTQGLAGITYIELST--LRKEKKTIFQIA 128
           +  +  +  +  A +  D    +   T   +    ++G     L+T             +
Sbjct: 87  IS-DDRSQVVVTAEVSKDAKGLMVKDTRFWVVRARISGGNVTGLTTLLGGSYIGVEAGAS 145

Query: 129 TERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTIANI----- 183
           TE   + +   +P  ++  +   +         S +    +      +   ++       
Sbjct: 146 TEPRDQFVGLESPPAVSVDVPGRQFVLHTDDVGSLYTGSPVFFRRIQVGQVVSTDLDGDG 205

Query: 184 -----ETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQK 238
                        +                 +            ++  L   I       
Sbjct: 206 QGVTVRVFIRSPYDRFVTASTFFWHASGVDLTVSPGGVKLNTESMLAVLLGGISFDQPPN 265

Query: 239 VNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKI---------DHLLSDFS 289
               +     ++     + D+ +       +    F+E  + +            + + +
Sbjct: 266 PPSTVSAPPNTAYTLYGTRDEALKNSAASEKFVLVFRESVRGLAVGATVDLRGVTVGEVT 325

Query: 290 SKMKSKETSAFLENIADSTSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKF 349
               + + S    ++          + +           +S       +  +L     + 
Sbjct: 326 DIDVALDPSRAGFSVPVEIQFYPEHLLSRGRQGKGGTLPLSGSGETRELLDDLVAHGFRA 385

Query: 350 A---------ELMSKINNISALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNF 400
                     +L   ++ +   +     +  +     T   + EK+ + +  I   ++  
Sbjct: 386 QIKSGSLLTGQLYVALDFVPGARRTRIDWSSSPPRFPTVPGSMEKLQKNLIEIVQKIEKL 445

Query: 401 -SQSGLNDIQNLVRKLQETVNHFDDCLNNFERN 432
                  D    +R L ET+   D  L N +RN
Sbjct: 446 PLDKLAGDAGQSLRSLDETLKSADRVLKNVDRN 478


>gi|284036724|ref|YP_003386654.1| hypothetical protein Slin_1810 [Spirosoma linguale DSM 74]
 gi|283816017|gb|ADB37855.1| Mammalian cell entry related domain protein [Spirosoma linguale DSM
           74]
          Length = 341

 Score = 97.3 bits (239), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 19/134 (14%), Positives = 45/134 (33%), Gaps = 3/134 (2%)

Query: 1   MESKNYY--TSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSV 58
           M +++      VG+FV+  +      ++ L    +      +++      V GL   ++V
Sbjct: 1   MSTESNKRSVVVGIFVLLGIIIFVAGVFVLGGQQKRFTKSFKLMAVFKD-VGGLKVGNNV 59

Query: 59  RFNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLR 118
            F+G+ +G +  +                     +     ATI + GL G   + ++   
Sbjct: 60  WFSGVKIGTVKRISFYGNAQVEVDMNIEESSQQYIRKDADATISSDGLIGNKIVVIAGGT 119

Query: 119 KEKKTIFQIATERN 132
                +      + 
Sbjct: 120 TSHPQVEDGDRIKT 133


>gi|53803965|ref|YP_114400.1| hypothetical protein MCA1967 [Methylococcus capsulatus str. Bath]
 gi|53757726|gb|AAU92017.1| conserved hypothetical protein [Methylococcus capsulatus str. Bath]
          Length = 166

 Score = 97.3 bits (239), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 31/136 (22%), Positives = 52/136 (38%), Gaps = 5/136 (3%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQY--DGPMAEVIIRIPGSVDGLSTDSSV 58
           M SK     VG+FV   L   F     +S  +++        +  R   +V  L   ++V
Sbjct: 1   MHSKTIEIWVGIFVALGLASLFLLAMKVSNLSEFETGAEGYRITARF-QNVGSLKPRAAV 59

Query: 59  RFNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTP-LYPSTTATIRTQGLAGITYIELSTL 117
              G+ +GR+  +  D++       +  I      L   T+A+I T GL G  Y+ L+  
Sbjct: 60  SMGGVRIGRVTSVSFDKKSYEAV-VEMRIDRQYDTLPDDTSASILTAGLLGEQYVGLTPG 118

Query: 118 RKEKKTIFQIATERNQ 133
             +         E  Q
Sbjct: 119 GSDDYLADGGQIELTQ 134


>gi|89075258|ref|ZP_01161685.1| putative ABC superfamily transport protein [Photobacterium sp.
           SKA34]
 gi|89048939|gb|EAR54507.1| putative ABC superfamily transport protein [Photobacterium sp.
           SKA34]
          Length = 159

 Score = 97.3 bits (239), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 23/134 (17%), Positives = 53/134 (39%), Gaps = 4/134 (2%)

Query: 3   SKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRFNG 62
           +K     VG+F+++ +       + ++    +    +  +     ++ GL   S V+  G
Sbjct: 4   NKRLELWVGIFMLAGIAALLVLAFKVANLQNFGSNESYTLKAHFDNIGGLKVRSPVKVGG 63

Query: 63  IPVGRIVGLFLDQEYPNHSLAKALIRPDT-PLYPSTTATIRTQGLAGITYIELSTLR--K 119
           + VG +  + LD+E     +    I         +++A+I T GL G  Y+ +S      
Sbjct: 64  VTVGEVTAINLDKETYIP-MVTLSINKKFGYFPETSSASILTSGLLGEQYLGISPGFVDD 122

Query: 120 EKKTIFQIATERNQ 133
           + + +       + 
Sbjct: 123 DVEMLHNGDLIEDT 136


>gi|310766232|gb|ADP11182.1| hypothetical protein EJP617_15010 [Erwinia sp. Ejp617]
          Length = 182

 Score = 96.9 bits (238), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 26/146 (17%), Positives = 52/146 (35%), Gaps = 2/146 (1%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M++K     VG F++  L    F    ++            +     +V GL   S V+ 
Sbjct: 1   MQTKKSEIWVGAFLLLALCAIIFLCLRVTDLKSLGNVSTWKLHATFDNVGGLKPGSPVKV 60

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDT-PLYPSTTATIRTQGLAGITYIELSTLRK 119
            G+ +GR+  + LD +  +       I      +  +++  +RT GL G  Y+ L+    
Sbjct: 61  GGVVIGRVSDIVLDPKTYSP-KVSMDIEDQYNNIPDTSSLAVRTSGLLGEQYLALNIGFD 119

Query: 120 EKKTIFQIATERNQRAMITATPSGIN 145
           + +    I           +     +
Sbjct: 120 DPEMGTAILKNGGTVQDTKSAMVLED 145


>gi|329851288|ref|ZP_08266045.1| mce related family protein [Asticcacaulis biprosthecum C19]
 gi|328840134|gb|EGF89706.1| mce related family protein [Asticcacaulis biprosthecum C19]
          Length = 311

 Score = 96.9 bits (238), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 41/312 (13%), Positives = 99/312 (31%), Gaps = 8/312 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME + +Y  VGL    +        +W  +   ++       +     VD L+  + V F
Sbjct: 1   MERQAHYAFVGLVTFVMALILLAFTFWFIKF-DFNQEFGVYDVEFNQPVDFLNKGAEVHF 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NGI VG +  L L +       A+  +  +TP+   + AT++ QG+ G+ Y+++S     
Sbjct: 60  NGIKVGEVTSLRLGKANTAQVFARIKLDSETPIRVDSVATLQPQGITGLLYMQISPGSAS 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
              + +               S  +      + +   +  +   + ++   +      T 
Sbjct: 120 SPLLKRKPGGPPPVIR-----SEESALAKLLQGSGSVVEKTYESLDRVNRLLSDRNIKTF 174

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
           ++       +  +I +  +M+        S+       T     T      +  +  +  
Sbjct: 175 SDTLDNLQSITADIENRQQMLDDAHEAVISAGQAADAITKLANSTDGVMAQQLPETLEKI 234

Query: 241 QILENIQVSSNNFVKSSDQVINTVHDV--RETTQTFQEVGQKIDHLLSDFSSKMKSKETS 298
               +   ++   V      +    D    +T    QE  + ++         ++  + +
Sbjct: 235 NAATDKLATAAERVSVVADSVKGPADQINTQTLPQMQESLENLNEASESLKDLVEQVQQN 294

Query: 299 AFLENIADSTSN 310
                       
Sbjct: 295 PQGLVTKPVAKQ 306


>gi|302341644|ref|YP_003806173.1| Mammalian cell entry related domain protein [Desulfarculus baarsii
           DSM 2075]
 gi|301638257|gb|ADK83579.1| Mammalian cell entry related domain protein [Desulfarculus baarsii
           DSM 2075]
          Length = 500

 Score = 96.9 bits (238), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 44/320 (13%), Positives = 98/320 (30%), Gaps = 11/320 (3%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M   +    VG+FV+  +    +    L      +    EV      S  GL  ++ V  
Sbjct: 1   MAGVSTEAKVGVFVMVAIALLGYMTLRLGDFQIGEPAGYEVWALF-DSASGLKLNAPVEM 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            GI +G++ G+ LDQ     +     I  D  L     A IRT+G+ G  ++ +      
Sbjct: 60  AGITIGKVAGVSLDQ---GRARITLRINEDVHLPADVQALIRTRGVLGDKFVSIEGGSPA 116

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
              +     E  QR    + P+ ++  +S     ++ I   +  ++  I + E       
Sbjct: 117 APPL-----ENGQRLARASVPTDLDQVMSRIGQVAEDIGAITSSLKMSIASPESQRNIAQ 171

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
           +            +   D       +  +  +     + ++D   S          +   
Sbjct: 172 SLSNIKELTDTLKVVIGDNQARLDNIIANLDNFSENISQLSDENRSALTSTIQNFAKASA 231

Query: 241 QILENIQVSSNNFVKSSDQVINTVH--DVRETTQTFQEVGQKIDHLLSDFSSKMKSKETS 298
            + + +   ++   K  D         +  +T +        +  +    +    +    
Sbjct: 232 NMEQTMHSLNSVLAKIDDGKGTIGQLVNNDQTVRDLNSTLASLRQVSDKINQGKGTLGRL 291

Query: 299 AFLENIADSTSNMRSSISAI 318
              +   D      + I+  
Sbjct: 292 VNDDATIDKIDQALTGINDY 311


>gi|288575847|ref|ZP_05977713.2| toluene tolerance ABC transporter, periplasmic substrate-binding
           protein [Neisseria mucosa ATCC 25996]
 gi|288566868|gb|EFC88428.1| toluene tolerance ABC transporter, periplasmic substrate-binding
           protein [Neisseria mucosa ATCC 25996]
          Length = 183

 Score = 96.9 bits (238), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 26/119 (21%), Positives = 46/119 (38%), Gaps = 4/119 (3%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYD--GPMAEVIIRIPGSVDGLSTDSSV 58
           M+       VGLFV+  +    F  + ++    +   G    V       + GL  ++ +
Sbjct: 19  MKKNVLEFWVGLFVLLGVAAVGFLAFRVAGGVAFGNSGKTYTVYADFSD-IGGLKANAPI 77

Query: 59  RFNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTL 117
           +  G+ VGR+  + LD +    +  +  +          +A I T GL G  YI L   
Sbjct: 78  KSAGVLVGRVGSIELDPKSY-QAKVRLDLDSKYQFSSDVSAQILTSGLLGEQYIGLQQG 135


>gi|149200414|ref|ZP_01877430.1| possible ABC transport system periplasmic substrate-binding protein
           [Lentisphaera araneosa HTCC2155]
 gi|149136483|gb|EDM24920.1| possible ABC transport system periplasmic substrate-binding protein
           [Lentisphaera araneosa HTCC2155]
          Length = 361

 Score = 96.9 bits (238), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 47/442 (10%), Positives = 137/442 (30%), Gaps = 82/442 (18%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K  +  +G+FV++ L     ++++L    +      + +     SV GL   SSV+ 
Sbjct: 1   MENK--HFKLGIFVLTGLVLFVLALFYLG-LREQFRKSYDFVTYFDRSVQGLEVGSSVKL 57

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G+ VGR+  + L ++   +                  A  R    + +  +  +  +  
Sbjct: 58  KGVTVGRVSSVELWEQ--EYVKVTMS------------AVPRNVSDSEMKEMSEAQAQLR 103

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
            +     A ++  R  +                                           
Sbjct: 104 FEGYIVEAVDKGLRVSLNY----------------------------------------- 122

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
           A I  +  +  + +            T   +      +++ D++  ++K++  +      
Sbjct: 123 AGITGMKYIELDYVDMKRDNSVELPFTVTETYIPALRSSLEDIVLDVEKIMDGVARIDFQ 182

Query: 241 QILENIQVSSNNFVKSSDQVIN-TVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSA 299
           QI EN + + ++  K+   +      ++   ++      ++ID        ++ + +   
Sbjct: 183 QIGENAEKAMSSAEKTMASLDKFATSELLTLSKDLSSSLKRIDKFTEVLEKEIIAAKVGD 242

Query: 300 FLENIADSTSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNI 359
              ++  + + +  + + + +       + S   T + I  + +  S      ++ +   
Sbjct: 243 TTTSVRKTLAKLDVNSAELNK------ALASVTKTSDMIGKDFSKISDGVTVALATVEK- 295

Query: 360 SALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETV 419
                           +      + ++ + +      +         D    +     T+
Sbjct: 296 ---------------NLKALASLTPQLEKMLAG-EGKIGKAVVGLAKDTSASLDSFDRTL 339

Query: 420 NHFDDCLNNFERNPQDIVWGRE 441
           +      +  ERNP  ++ G+ 
Sbjct: 340 DSIRRLTDYLERNPNALIQGKN 361


>gi|121609356|ref|YP_997163.1| hypothetical protein Veis_2399 [Verminephrobacter eiseniae EF01-2]
 gi|121553996|gb|ABM58145.1| Mammalian cell entry related domain protein [Verminephrobacter
           eiseniae EF01-2]
          Length = 156

 Score = 96.9 bits (238), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 26/133 (19%), Positives = 45/133 (33%), Gaps = 1/133 (0%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M+       VGLFV+  +    F     +            I     ++ GL   ++VR 
Sbjct: 1   MQRSKNDLWVGLFVLLGVLALVFLALQSANLLSLQWQSGYRITARFDNIGGLKPQAAVRS 60

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G+ VGR+  +  D +    +     ++        ++  I T GL G  YI +     E
Sbjct: 61  AGVLVGRVQDIAFD-DKSYQARVTLEMQKRYMFPKDSSLKILTSGLLGEQYIGIEAGAHE 119

Query: 121 KKTIFQIATERNQ 133
           +           Q
Sbjct: 120 QNLAAGDTVTATQ 132


>gi|217970676|ref|YP_002355910.1| hypothetical protein Tmz1t_2275 [Thauera sp. MZ1T]
 gi|217508003|gb|ACK55014.1| Mammalian cell entry related domain protein [Thauera sp. MZ1T]
          Length = 305

 Score = 96.9 bits (238), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 35/130 (26%), Positives = 65/130 (50%), Gaps = 3/130 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++ +  + GLF + +     F+I+W S       PM E+++   G ++GL   S VR+
Sbjct: 1   MENRAHALAAGLFAILLGAGVVFAIWWFSGQRV---PMREIVLEARGDINGLGAQSRVRY 57

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G+ VG +  + +D E     L +  +  D PL   TTA + T G+ G+ +++L     +
Sbjct: 58  RGMAVGSVRAVAIDPEDLRTLLVRIAVPADLPLTRGTTAALGTLGVTGLAFVQLDDRGVD 117

Query: 121 KKTIFQIATE 130
           ++ +     E
Sbjct: 118 RRPLAAADGE 127



 Score = 40.7 bits (92), Expect = 0.52,   Method: Composition-based stats.
 Identities = 15/89 (16%), Positives = 33/89 (37%), Gaps = 4/89 (4%)

Query: 359 ISALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNL----QNFSQSGLNDIQNLVRK 414
            S L        +A  A+   R    +I++    +         +  +  L  +  L+ +
Sbjct: 200 TSVLGNLERGSAEAVPAVAELRRLIVRIDQAAARLELRAAAAGDDLVERTLPQLDVLLGE 259

Query: 415 LQETVNHFDDCLNNFERNPQDIVWGREKG 443
           L  T   F   +   + +PQ ++ GR++ 
Sbjct: 260 LTSTSQRFGHLVEELDASPQLLLTGRDRP 288


>gi|302525563|ref|ZP_07277905.1| conserved hypothetical protein [Streptomyces sp. AA4]
 gi|302434458|gb|EFL06274.1| conserved hypothetical protein [Streptomyces sp. AA4]
          Length = 345

 Score = 96.9 bits (238), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 30/130 (23%), Positives = 54/130 (41%), Gaps = 3/130 (2%)

Query: 8   TSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRFNGIPVGR 67
             +G+F V  +  +      ++ +N   G  A  + +      GL     VR +G+ VG+
Sbjct: 9   IKIGIFAVVTVLLTGVLATTIANTN--FGNTASYVAKFTD-ASGLQAGDDVRISGVKVGQ 65

Query: 68  IVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKEKKTIFQI 127
           +  + +DQ   N++  + L+     L    TATI+ + L G  Y+ L T      T+   
Sbjct: 66  VESIGVDQGEQNYAEVRFLVESAYKLPSLATATIKYRNLVGQRYLSLGTDVSGGDTLSPG 125

Query: 128 ATERNQRAMI 137
            T   +R   
Sbjct: 126 DTIPPERTKP 135


>gi|225024504|ref|ZP_03713696.1| hypothetical protein EIKCOROL_01379 [Eikenella corrodens ATCC
           23834]
 gi|224942655|gb|EEG23864.1| hypothetical protein EIKCOROL_01379 [Eikenella corrodens ATCC
           23834]
          Length = 156

 Score = 96.9 bits (238), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 27/130 (20%), Positives = 46/130 (35%), Gaps = 1/130 (0%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M+       VG+FV   +    F    ++         +  +      + GL   + V+ 
Sbjct: 1   MKRSTLELWVGVFVALGIAAVVFLSLRVAGGQTVSRQSSYTVSASFTDIGGLKVKAPVKA 60

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           +G+ VGR+  + LD +    +     I          +A I T GL G  YI L    +E
Sbjct: 61  SGVVVGRVSSIQLDPKTYR-ANVSLNIDSQYRFSTDVSAEILTSGLLGEQYIGLQQGAEE 119

Query: 121 KKTIFQIATE 130
            +       E
Sbjct: 120 TELKNGDTIE 129


>gi|163795177|ref|ZP_02189145.1| acetyl-CoA carboxylase subunit A [alpha proteobacterium BAL199]
 gi|159179575|gb|EDP64104.1| acetyl-CoA carboxylase subunit A [alpha proteobacterium BAL199]
          Length = 155

 Score = 96.9 bits (238), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 31/117 (26%), Positives = 47/117 (40%), Gaps = 4/117 (3%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M      T +G  V+ +        Y  +   + DG   EV       V GL   S VR 
Sbjct: 1   MNRSLIETLMGAMVLGVAGLFLMFAYTTADLGRTDG--YEVYANFTT-VGGLRVGSDVRL 57

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTL 117
            GI VG +    LD E    +     + P   L   T+A+I ++GL G  +++L+  
Sbjct: 58  AGIKVGTVKRQELDPETY-LARVTFSVEPSVKLPADTSASITSEGLLGGNFVDLAPG 113


>gi|209521693|ref|ZP_03270383.1| Mammalian cell entry related domain protein [Burkholderia sp. H160]
 gi|209497884|gb|EDZ98049.1| Mammalian cell entry related domain protein [Burkholderia sp. H160]
          Length = 289

 Score = 96.9 bits (238), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 44/295 (14%), Positives = 99/295 (33%), Gaps = 14/295 (4%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K +    GLF V +      + Y  +             +    +V GL  D++VRF
Sbjct: 1   MENKAHAFWAGLFTVVLTAAIALAAYLFNVDRTV---RVPYDLIARTNVTGLFVDAAVRF 57

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G+ VGR+  +  D E+P   L +  +    P+  ST  ++  QG+ GI +I+L    ++
Sbjct: 58  RGLDVGRVQSIKFDPEHPGQILIRINVDEHAPITHSTFGSLGLQGVTGIAFIQLDDTGRD 117

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
              +       +    +   P          +     +    +    + + +   +   +
Sbjct: 118 LTPL------PSSVQKVARLPMRPGLLDQLQQRGDVLLRKLEKVTDNVNDMLSPEMVEQL 171

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
                     A+ ++ +   +        +     T + +   + S ++MI  +      
Sbjct: 172 HETAASLAQAASGVATLTSQLGPV-----AGKLPGTVDQLNRTLASTNQMITNLQRPDGP 226

Query: 241 QILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSK 295
            +    +  +             V     + +   E   +++ L  D  S  +S 
Sbjct: 227 LVRNLNKAGTAAQQAGDALAQMNVSLQDLSARVGYETLPRVNSLTEDVRSAAQSI 281


>gi|312170881|emb|CBX79140.1| Uncharacterized protein yrbD precursor [Erwinia amylovora ATCC
           BAA-2158]
          Length = 182

 Score = 96.5 bits (237), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 26/124 (20%), Positives = 50/124 (40%), Gaps = 2/124 (1%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M+SK     VG F++  L    F    ++    +       +     +V GL   S V+ 
Sbjct: 1   MQSKKSEIWVGAFLLLALCAIIFLCLRVTDLKSFGNVSTWKLYATFDNVGGLKPGSPVKV 60

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDT-PLYPSTTATIRTQGLAGITYIELSTLRK 119
            G+ +GR+  + LD +  +       I      +  +++  +RT GL G  Y+ L+    
Sbjct: 61  GGVVIGRVSDITLDAKSYSP-KVSMDIDERYNNIPDTSSLAVRTSGLLGEQYLALNIGFN 119

Query: 120 EKKT 123
           + + 
Sbjct: 120 DPEM 123


>gi|292486813|ref|YP_003529683.1| hypothetical protein EAMY_0325 [Erwinia amylovora CFBP1430]
 gi|292900789|ref|YP_003540158.1| exported protein [Erwinia amylovora ATCC 49946]
 gi|291200637|emb|CBJ47769.1| putative exported protein [Erwinia amylovora ATCC 49946]
 gi|291552230|emb|CBA19267.1| Uncharacterized protein yrbD precursor [Erwinia amylovora CFBP1430]
          Length = 182

 Score = 96.5 bits (237), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 26/124 (20%), Positives = 50/124 (40%), Gaps = 2/124 (1%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M+SK     VG F++  L    F    ++    +       +     +V GL   S V+ 
Sbjct: 1   MQSKKSEIWVGAFLLLALCAIIFLCLRVTDLKSFGNVSTWKLYATFDNVGGLKPGSPVKV 60

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDT-PLYPSTTATIRTQGLAGITYIELSTLRK 119
            G+ +GR+  + LD +  +       I      +  +++  +RT GL G  Y+ L+    
Sbjct: 61  GGVVIGRVSDITLDAKSYSP-KVSMDIDERYNNIPDTSSLAVRTSGLLGEQYLALNIGFN 119

Query: 120 EKKT 123
           + + 
Sbjct: 120 DPEM 123


>gi|91201079|emb|CAJ74137.1| similar to ABC-transporter component [Candidatus Kuenenia
           stuttgartiensis]
          Length = 181

 Score = 96.5 bits (237), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 28/135 (20%), Positives = 53/135 (39%), Gaps = 4/135 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M+  +   +VG+F+   +    +    L + N       +V       V GL  +++V  
Sbjct: 34  MKKFDVEIAVGIFIFCGILCMGYISVKLGKINFLSDNYYQVNAIFST-VKGLKKNTAVEI 92

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G+ VG++  + L+       +    IR D  L     A+IRT+GL G  Y+E++    +
Sbjct: 93  AGVEVGKVDNIVLE---NYEVVVSMKIRKDIKLQEDAIASIRTKGLLGEKYVEITPGGSD 149

Query: 121 KKTIFQIATERNQRA 135
                       +  
Sbjct: 150 HIIEHGGTLIETEPP 164


>gi|224827293|ref|ZP_03700386.1| Mammalian cell entry related domain protein [Lutiella nitroferrum
           2002]
 gi|224600506|gb|EEG06696.1| Mammalian cell entry related domain protein [Lutiella nitroferrum
           2002]
          Length = 166

 Score = 96.5 bits (237), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 25/122 (20%), Positives = 44/122 (36%), Gaps = 1/122 (0%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M+       VG+FV   +    F    ++         +  +     ++ GL   + V+ 
Sbjct: 1   MKRTTIDLWVGIFVAIGIAAVTFLSLKVANLTPQSAEASYPLYAEFDNIGGLKVKAPVKS 60

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           +G+ VGR+  + LD +    +     +         T+A I T GL G  YI L      
Sbjct: 61  SGVVVGRVASIELDTQRY-LAKVTLSLDKRYQFSRDTSAEILTSGLLGEQYIGLVQGGDP 119

Query: 121 KK 122
             
Sbjct: 120 DN 121


>gi|94264496|ref|ZP_01288283.1| Mammalian cell entry related [delta proteobacterium MLMS-1]
 gi|94266596|ref|ZP_01290278.1| Mammalian cell entry related [delta proteobacterium MLMS-1]
 gi|93452767|gb|EAT03305.1| Mammalian cell entry related [delta proteobacterium MLMS-1]
 gi|93455055|gb|EAT05282.1| Mammalian cell entry related [delta proteobacterium MLMS-1]
          Length = 148

 Score = 96.5 bits (237), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 26/117 (22%), Positives = 48/117 (41%), Gaps = 2/117 (1%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M +K     VGLF+++  F   +    L   +         +    G++ GL   + V+ 
Sbjct: 1   MIAKKLDLMVGLFILAGFFSFVYLSVNLGDFSPLSAQRQYTVQAEFGNISGLRRGAPVQI 60

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTL 117
            G+ VGR+  + L       +     I  +  L     A+++TQG+ G  YI ++  
Sbjct: 61  AGVVVGRVAAIEL--GDRQRAQVTMSIDREVELTDDAIASVKTQGIIGEKYISITPG 115


>gi|326795054|ref|YP_004312874.1| hypothetical protein Marme_1782 [Marinomonas mediterranea MMB-1]
 gi|326545818|gb|ADZ91038.1| Mammalian cell entry related domain protein [Marinomonas
           mediterranea MMB-1]
          Length = 154

 Score = 96.5 bits (237), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 26/118 (22%), Positives = 48/118 (40%), Gaps = 2/118 (1%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M +K+    VG+F+V  +    +    +S     D      I+     + GL+  + V  
Sbjct: 1   MRNKHTELLVGVFIVLGIAAFGYLAIQVSGLAFSDKKDTYNIVARFDDIGGLTERAKVTI 60

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTP-LYPSTTATIRTQGLAGITYIELSTL 117
            G+ VG +  +  D+EY    L    +  D   +   ++  I T GL G  Y+ ++  
Sbjct: 61  AGVTVGEVESISFDKEYFMG-LVTMSVHSDIDNIPTDSSIAILTSGLLGEKYLGITIG 117


>gi|121635619|ref|YP_975864.1| putative outer membrane transport protein [Neisseria meningitidis
           FAM18]
 gi|120867325|emb|CAM11096.1| putative outer membrane transport protein [Neisseria meningitidis
           FAM18]
          Length = 159

 Score = 96.5 bits (237), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 25/112 (22%), Positives = 43/112 (38%), Gaps = 2/112 (1%)

Query: 7   YTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRI-PGSVDGLSTDSSVRFNGIPV 65
              VGLFV+       F  + ++    +        +    G + GL  ++ V+  G+ V
Sbjct: 2   EFWVGLFVLIGAAAVAFLAFRVAGGAAFGNSGKTYTVYADFGDIGGLKVNAPVKSAGVLV 61

Query: 66  GRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTL 117
           GR+  + LD +    +  +  +          +A I T GL G  YI L   
Sbjct: 62  GRVGAIGLDPKSY-QARVRLDLDGKYQFSSDVSAQILTSGLLGEQYIGLQQG 112


>gi|317153920|ref|YP_004121968.1| Mammalian cell entry related domain-containing protein
           [Desulfovibrio aespoeensis Aspo-2]
 gi|316944171|gb|ADU63222.1| Mammalian cell entry related domain protein [Desulfovibrio
           aespoeensis Aspo-2]
          Length = 383

 Score = 96.5 bits (237), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 55/396 (13%), Positives = 127/396 (32%), Gaps = 50/396 (12%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M  K  Y  +G F++         I  L  + ++      +      SV+GL   S V+ 
Sbjct: 1   MIRKQDYFKLGAFIIVGTTILVAVIIILG-AGKFFKTTYTIETYFNESVNGLDVGSPVKL 59

Query: 61  NGIPVGRIVGLFL--------DQEYPNHSLAKALIRPDT---PLYPSTTATIRTQGLAGI 109
            G+ +GR+V +           QE   +   K  I PD          +  +R +   G+
Sbjct: 60  RGVNIGRVVDIDFVLNTYPGASQEERRYVYVKCEIEPDIFGEINKEKFSEAVREEVAYGL 119

Query: 110 TYIELSTLRKEKKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKII 169
                S     +  +       +   ++      IN ++ +  +T  +I  +        
Sbjct: 120 RVRPTSLGLTGQLFLNLTYDSDDNTPLLPVDWIPINNYVPSVPSTMGRIEATVT------ 173

Query: 170 ENIEKPLTTTIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDK 229
                                          +  T       D       I  +  ++D 
Sbjct: 174 ------------------------------AISKTLSGISQEDLGGIIKDIKSITGAIDD 203

Query: 230 MIKAIDLQKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFS 289
            IKA   ++  Q + +I   +   +  ++Q++      R   Q  Q +      +     
Sbjct: 204 FIKAEGGKEAGQKVLSILEETRMILARTNQILADPSTTRIIPQAAQAIAGINRIVTESGD 263

Query: 290 SKMKSKETSAFLENIADSTSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKF 349
             +++   +        + S++ +       +     +I   +  I +   ++  +  K 
Sbjct: 264 EAVEAVRETRGAMASFRTASDVLAKTLTDPRMDKAMSEIAPALENIGSAARDMAAAVSKI 323

Query: 350 AELMSKINNISALKENN--SLFKDAQRAMHTFRDTS 383
             L +++N ++A +E N  ++ +D +  +   +D S
Sbjct: 324 HALANRLNALTASEEANLHAILEDTRVILENIKDIS 359


>gi|330446813|ref|ZP_08310464.1| mlaD [Photobacterium leiognathi subsp. mandapamensis svers.1.1.]
 gi|328491004|dbj|GAA04961.1| mlaD [Photobacterium leiognathi subsp. mandapamensis svers.1.1.]
          Length = 159

 Score = 96.5 bits (237), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 23/134 (17%), Positives = 52/134 (38%), Gaps = 4/134 (2%)

Query: 3   SKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRFNG 62
           +K     VG+F+++ +       + ++    +       +     ++ GL   S V+  G
Sbjct: 4   NKRLELWVGVFMLAGIAALLVLAFKVANVQNFGSSETYTLKAHFDNIGGLKVRSPVKVGG 63

Query: 63  IPVGRIVGLFLDQEYPNHSLAKALIRPDT-PLYPSTTATIRTQGLAGITYIELSTLR--K 119
           + VG +  + LD+E     +    I         +++A+I T GL G  Y+ +S     +
Sbjct: 64  VTVGEVTSITLDKETYIP-MVTLAINKKFGYFPETSSASILTSGLLGEQYLGISPGFVDE 122

Query: 120 EKKTIFQIATERNQ 133
           +   +       + 
Sbjct: 123 DVDMLHNGDLIEDT 136


>gi|283853768|ref|ZP_06370993.1| Mammalian cell entry related domain protein [Desulfovibrio sp.
          FW1012B]
 gi|283570830|gb|EFC18865.1| Mammalian cell entry related domain protein [Desulfovibrio sp.
          FW1012B]
          Length = 336

 Score = 96.5 bits (237), Expect = 9e-18,   Method: Composition-based stats.
 Identities = 22/90 (24%), Positives = 38/90 (42%), Gaps = 4/90 (4%)

Query: 1  MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
          M +K   T +G FV+  L  +  +I  L  S  +       I+  P SV GL   + V F
Sbjct: 1  MSAKTNKTMIGAFVLGALVLAVGAIVALG-SGMFFTKKFHCIMFFPNSVSGLEVGAPVVF 59

Query: 61 NGIPVGRIVGLFLDQEYPN---HSLAKALI 87
           G+P+G +  + ++ +      +      I
Sbjct: 60 RGVPIGSVTEISIEADASRLHFYIPVVIEI 89



 Score = 51.9 bits (121), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 19/178 (10%), Positives = 55/178 (30%), Gaps = 4/178 (2%)

Query: 268 RETTQTFQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNMRSSISAIREITDQRQK 327
                    V    + L          +     +  +      + S     R        
Sbjct: 159 ESNLPEIPTVPSTFEKLTETIKQLPLQELVDRLIGAVTGIEKLVNSP-ELARMPGKIDSA 217

Query: 328 IISTINTIENITSNLNDSSQKFAELMSKINNISALKE--NNSLFKDAQRAMHTFRDTSEK 385
           + +  + +  I S +   +Q   E +   + ++   +     +   A+ A+ +F  T + 
Sbjct: 218 LNTGTDLLNEIKSKVAPLAQNLDEAVQNYSELAKHLDRRTEGISSSAKGALDSFDLTLKD 277

Query: 386 INRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFERNPQDIVWGREKG 443
               I +    + + S   + D+   + ++        +  +  ER+P+ ++ G+   
Sbjct: 278 SRVAIGNFQKIVNSNS-PTVTDLNRALGEIANAARAIRELSSYLERHPEALIQGKGGP 334


>gi|256828809|ref|YP_003157537.1| Mammalian cell entry related domain protein [Desulfomicrobium
           baculatum DSM 4028]
 gi|256577985|gb|ACU89121.1| Mammalian cell entry related domain protein [Desulfomicrobium
           baculatum DSM 4028]
          Length = 152

 Score = 96.5 bits (237), Expect = 9e-18,   Method: Composition-based stats.
 Identities = 28/119 (23%), Positives = 56/119 (47%), Gaps = 4/119 (3%)

Query: 1   MESKNY--YTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSV 58
           M++ N   + S+GLF++  L  + +    L+ +  + G    +  +    V+GL   S+V
Sbjct: 1   MKTNNSSLHLSIGLFIIIGLVCTAYLAMTLANTTFFSGDSYTITAKFTA-VNGLRAGSNV 59

Query: 59  RFNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTL 117
             +G+ VG++  + LD +    ++    I     +   +TA I+T GL G  Y+ +   
Sbjct: 60  EISGVAVGKVSSISLD-QTLYQAVITMSIENAVGIPVDSTAAIKTSGLIGDKYVSIIPG 117


>gi|311746377|ref|ZP_07720162.1| ABC transporter, permease component [Algoriphagus sp. PR1]
 gi|126575263|gb|EAZ79595.1| ABC transporter, permease component [Algoriphagus sp. PR1]
          Length = 327

 Score = 96.5 bits (237), Expect = 9e-18,   Method: Composition-based stats.
 Identities = 35/296 (11%), Positives = 79/296 (26%), Gaps = 3/296 (1%)

Query: 2   ESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRFN 61
           E+K     VG+FV   +      +  L    +       +       + GL   ++V F+
Sbjct: 4   ENKRN-VIVGIFVFVGIAILVAGVLTLGGQQKKFVKAIHLKAVF-DDIGGLQAGNNVWFS 61

Query: 62  GIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKEK 121
           G+ +G +  +    +                +   + ATI + GL G   I +       
Sbjct: 62  GVKIGTVRKINFYGDSQVEIEMNVEEEVVEFIRKDSKATISSDGLIGNKIIVIYGGTTMA 121

Query: 122 KTIFQIA-TERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
             +      E             +     N    +  + D    +      +   LT + 
Sbjct: 122 PPVEDGDRLESVMPLDTDQMMETLQVNNENLVEITNDLKDLIGKLANGEGIVGAVLTDST 181

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
            +      V     +  +      ++   +       N   DL+T     ++  D     
Sbjct: 182 LSDNFKIIVANLKQTSENSNRMLAEMNTFTQKLNKEGNLFNDLVTDTTMAVEIRDAMGSL 241

Query: 241 QILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKE 296
           +            +K      N+  +        +E    +   + +  S   +  
Sbjct: 242 KAAAENSEQMTEELKVITDKFNSQDNSIGVLLNDEEFANNLKQTMINTDSATYNLN 297


>gi|260220242|emb|CBA27585.1| Uncharacterized protein HI1085 [Curvibacter putative symbiont of
           Hydra magnipapillata]
          Length = 159

 Score = 96.2 bits (236), Expect = 9e-18,   Method: Composition-based stats.
 Identities = 21/111 (18%), Positives = 40/111 (36%), Gaps = 1/111 (0%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M+       VGLFV+       F     +    +       +     ++ GL   ++V+ 
Sbjct: 1   MQRSKNDVWVGLFVLLGALALVFLALQSANLLTFSVDKGYPVTAKFDNIGGLKPKAAVKS 60

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITY 111
            G+ VGR+  +  D +    +  +  +         ++  I T GL G  Y
Sbjct: 61  AGVVVGRVESIGFD-DKTFQAKVQLAMDKRFAFPKDSSLKILTSGLLGEQY 110


>gi|302877780|ref|YP_003846344.1| Mammalian cell entry related domain-containing protein [Gallionella
           capsiferriformans ES-2]
 gi|302580569|gb|ADL54580.1| Mammalian cell entry related domain protein [Gallionella
           capsiferriformans ES-2]
          Length = 158

 Score = 96.2 bits (236), Expect = 9e-18,   Method: Composition-based stats.
 Identities = 35/152 (23%), Positives = 56/152 (36%), Gaps = 1/152 (0%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME       VG+FVV+ +         +     Y+      +     ++ GL   +S+R 
Sbjct: 1   MERTTLDLWVGMFVVAGIGALVMLAMKVGNLGTYNVSETYQVHAYFSNIGGLKPKASIRS 60

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G+ VGR+  + LD E    +     +         T A I T GL G  YI L    + 
Sbjct: 61  AGVLVGRVTSISLDTERYE-ANVVMNVDKRYQFPKDTFANILTSGLLGEQYIGLVPGGET 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAE 152
           +        ++ Q AM+     G   +   AE
Sbjct: 120 EMIKDGDLLKQTQSAMVLEDLIGKFMYSKAAE 151


>gi|237749354|ref|ZP_04579834.1| predicted protein [Oxalobacter formigenes OXCC13]
 gi|229380716|gb|EEO30807.1| predicted protein [Oxalobacter formigenes OXCC13]
          Length = 293

 Score = 96.2 bits (236), Expect = 9e-18,   Method: Composition-based stats.
 Identities = 39/137 (28%), Positives = 64/137 (46%), Gaps = 3/137 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K++    GLF V  L  +   I W    ++        +I    S+ GL+  ++VRF
Sbjct: 2   MENKSHAFIAGLFTV-CLVAAALLIVWFLNMDRTVKQ--PYMIATNLSIPGLNPQATVRF 58

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G+ VG++  +  +++ P   L    ++ DTP+  ST AT+  QG+ GI  IEL+     
Sbjct: 59  RGLDVGKVTNIGFNKDDPGEILIYFEVKEDTPMTESTFATLSYQGVTGIASIELNDDETS 118

Query: 121 KKTIFQIATERNQRAMI 137
            K +   A       M 
Sbjct: 119 DKRLVTSAENPAHVEMR 135


>gi|41406858|ref|NP_959694.1| hypothetical protein MAP0760 [Mycobacterium avium subsp.
           paratuberculosis K-10]
 gi|118465177|ref|YP_880210.1| virulence factor Mce [Mycobacterium avium 104]
 gi|41395208|gb|AAS03077.1| hypothetical protein MAP_0760 [Mycobacterium avium subsp.
           paratuberculosis K-10]
 gi|118166464|gb|ABK67361.1| virulence factor Mce family protein [Mycobacterium avium 104]
          Length = 340

 Score = 96.2 bits (236), Expect = 9e-18,   Method: Composition-based stats.
 Identities = 33/289 (11%), Positives = 76/289 (26%), Gaps = 11/289 (3%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M ++       +F V +   + F  +   +           +      V  L    SVR 
Sbjct: 1   MRTRATLIKFAIFAVVMAMLTAFLFFIFGQYRTGATNGYSAV---FTDVSRLKPGQSVRV 57

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            GI VG +  + L  +     + K     +  L   T A +R   L G  Y+EL      
Sbjct: 58  AGIRVGTVNSVSLQPD--KKVVVKFDADRNIVLTEGTRAAVRYLNLVGDRYLELVDGPGS 115

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSS------RHIQKIIENIEK 174
            K +         R         +   +            ++      +  Q     ++ 
Sbjct: 116 PKRLPAGGQIPVSRTAPALDLDLLLGGLKPVTQGLNARDVNALTSGLLQVFQGQGGTLDS 175

Query: 175 PLTTTIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAI 234
             T   +    ++         ID +              +      + + S     +  
Sbjct: 176 LFTKATSFSNALADNDQTVQQLIDNLNIVIGTISKDGKQFSGAVDRLERLVSGLSDDRNT 235

Query: 235 DLQKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDH 283
               ++ +       ++   ++   +  T+  +            ++D 
Sbjct: 236 IGSAIDALDRGTASLADLLAQARPPLTGTIDQLNRLAPILDNDKDRLDA 284


>gi|54022505|ref|YP_116747.1| putative Mce family protein [Nocardia farcinica IFM 10152]
 gi|54014013|dbj|BAD55383.1| putative Mce family protein [Nocardia farcinica IFM 10152]
          Length = 340

 Score = 96.2 bits (236), Expect = 9e-18,   Method: Composition-based stats.
 Identities = 24/134 (17%), Positives = 47/134 (35%), Gaps = 5/134 (3%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M +      + +F + +           S+           +     S  G+   + VR 
Sbjct: 1   MRNTATTVKLAIFTLVMTLIFAGLAVVFSQMRFAREHGYHAV---FTSSSGILPGAKVRI 57

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G+PVG +  + + ++Y   +  +  +     L  ST A I+ + L G  Y+EL      
Sbjct: 58  AGVPVGSVTSVEVGKDY--LAHVEFDVDRKYRLLTSTRAQIKYENLVGDRYLELLDGPGS 115

Query: 121 KKTIFQIATERNQR 134
              +    T   +R
Sbjct: 116 ADVLKAGGTIPKER 129


>gi|238764270|ref|ZP_04625222.1| hypothetical protein ykris0001_25360 [Yersinia kristensenii ATCC
           33638]
 gi|238697551|gb|EEP90316.1| hypothetical protein ykris0001_25360 [Yersinia kristensenii ATCC
           33638]
          Length = 180

 Score = 96.2 bits (236), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 25/133 (18%), Positives = 53/133 (39%), Gaps = 2/133 (1%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M++K     VG F++  +    F    ++            I     ++ GL  +S V+ 
Sbjct: 1   MQTKKSEIWVGAFILIAILAVVFLCLKVADIKSVGNQPTYRIYANFDNIGGLKNNSPVKI 60

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDT-PLYPSTTATIRTQGLAGITYIELSTLRK 119
            G+ VGR+  + LD +  +       I+     +  +++  +RT GL G  ++ L+   +
Sbjct: 61  GGVVVGRVADITLDTKNYSP-RVAIDIQQRYNHIPDTSSLAVRTSGLLGEQFLALNVGFE 119

Query: 120 EKKTIFQIATERN 132
           +      I  +  
Sbjct: 120 DPDMGTSILKDGG 132


>gi|223937295|ref|ZP_03629201.1| Mammalian cell entry related domain protein [bacterium Ellin514]
 gi|223894080|gb|EEF60535.1| Mammalian cell entry related domain protein [bacterium Ellin514]
          Length = 325

 Score = 96.2 bits (236), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 49/316 (15%), Positives = 110/316 (34%), Gaps = 12/316 (3%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M++    T +G+FV+  +  +F  +  +   N +  P   +  R   ++  L    +V+ 
Sbjct: 1   MKN-TLETRLGIFVLLAVLAAFIILELIGGVNIF-KPGYHLRARF-NNIQDLKVGDAVKM 57

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G+PVG++  + L             +  DTP++  + ATI+  GL G  ++ L      
Sbjct: 58  AGVPVGQVEKIQLATN-EAKVEVVLRLNKDTPVHTDSKATIKFTGLMGNYFVALDFGNPN 116

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQ------KIIENIEK 174
              + Q            +T       +++      K     +           +     
Sbjct: 117 SPKMEQNQLIATTEQPDLSTLIAKLDDVASGVQNLTKSFTGDKIDNLLGPFTDFMRQNNP 176

Query: 175 PLTTTIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAI 234
            L+  IAN + IS  +A     + K+++   +   +  S          I       + +
Sbjct: 177 KLSAIIANFQGISGQIAEGKGTVGKLIYDDSLYNSAYASVTNLQNTATEIQQTVAEARKV 236

Query: 235 DLQKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKS 294
             Q  +      ++  ++  K   +   T+ + +E  Q   +    +  L++D      +
Sbjct: 237 VDQVNSGQGTVGKLLKDD--KLYVEATATMTNAKEILQKVNQGQGSVGKLINDQEFYKNA 294

Query: 295 KETSAFLENIADSTSN 310
           K T   L+   +   +
Sbjct: 295 KMTLQKLDKATEGLED 310


>gi|187922500|ref|YP_001894142.1| hypothetical protein Bphyt_0493 [Burkholderia phytofirmans PsJN]
 gi|187713694|gb|ACD14918.1| Mammalian cell entry related domain protein [Burkholderia
           phytofirmans PsJN]
          Length = 320

 Score = 95.8 bits (235), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 30/128 (23%), Positives = 59/128 (46%), Gaps = 3/128 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K++    GLF + +L     + +  +             +    +V GL TD++VR+
Sbjct: 1   MENKSHAFWAGLFTIVLLVAIALAGFLFNVDRSV---RVPYDLIARTNVTGLFTDAAVRY 57

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G+ VG++  +  D  +P   L + L+    P+  ST  ++  QG+ GI +I+L    ++
Sbjct: 58  RGLDVGKVQSIKFDPAHPGQILIRILVDTHAPITHSTFGSLGFQGVTGIAFIQLDDNGRD 117

Query: 121 KKTIFQIA 128
              +    
Sbjct: 118 PTPLASSP 125


>gi|83647975|ref|YP_436410.1| organis solvents resistance ABC transporter periplasmic protein
           [Hahella chejuensis KCTC 2396]
 gi|83636018|gb|ABC31985.1| ABC-type transport system involved in resistance to organic
           solvents, periplasmic component [Hahella chejuensis KCTC
           2396]
          Length = 149

 Score = 95.8 bits (235), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 29/118 (24%), Positives = 48/118 (40%), Gaps = 2/118 (1%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M  +    SVG F+V+ +   F     +S  +         +      V GL     V  
Sbjct: 1   MRIRTLEISVGAFIVAGIGALFLLALEVSGLSLSPTQDTYKLYAEFTDVGGLRVRGKVSL 60

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTP-LYPSTTATIRTQGLAGITYIELSTL 117
           +G+ +GR+  + LD +  + ++ +  I  D   L   + A I T GL G  YI +S  
Sbjct: 61  SGVTIGRVNSISLDPKS-SKAVVEMDIDADVNYLSADSVAVISTAGLLGEKYINVSIG 117


>gi|325109136|ref|YP_004270204.1| hypothetical protein Plabr_2582 [Planctomyces brasiliensis DSM
           5305]
 gi|324969404|gb|ADY60182.1| Mammalian cell entry related domain protein [Planctomyces
           brasiliensis DSM 5305]
          Length = 397

 Score = 95.8 bits (235), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 49/352 (13%), Positives = 107/352 (30%), Gaps = 11/352 (3%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M  +     VGLFV++ +       +     + +  P   V I     + G+   + VR 
Sbjct: 1   MSDRQLQFRVGLFVLTAMAIGVGLTFQFGNLDSFFEPRYLVGIEF-DDLSGVHPGTPVRQ 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           +GIP+G +  + +D+      L    I    PL       +  Q L G  +I+ S     
Sbjct: 60  SGIPIGEVKDVSVDR-KKQKVLVVVEILERYPLAKDARPQLV-QSLLGEAHIDFSLGTS- 116

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
            + +   A    +       P      +   E    +            + +   + T I
Sbjct: 117 PERLDAGALLAGE------MPQDPFAAVERLEKQVTETLQVFAETSNEWKAVGHNVNTLI 170

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
              +     +    +     + TT      +  +         +    K       + + 
Sbjct: 171 VTNQGSLDDVVEKAALALTELTTTMRKASETLDQTNQFVSDPEMQGAVKDAMTALPKLIQ 230

Query: 241 QILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDF-SSKMKSKETSA 299
           Q  + +  +          + N         +   ++  K+D  L     +  + ++ S 
Sbjct: 231 QTEQTVATTQQAVSTLGQTMENLRVATGPLAENSGQLTTKLDASLGQLSRTLAQLEKFST 290

Query: 300 FLENIADSTSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAE 351
            L     S   + S     R +      + + ++ ++ I S++   S K A 
Sbjct: 291 QLNEGDGSIQRLASDPQLYRNLQLSSASLAALLSNLDPIVSDMRVFSDKVAR 342


>gi|148555655|ref|YP_001263237.1| hypothetical protein Swit_2744 [Sphingomonas wittichii RW1]
 gi|148500845|gb|ABQ69099.1| Mammalian cell entry related domain protein [Sphingomonas wittichii
           RW1]
          Length = 315

 Score = 95.8 bits (235), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 50/297 (16%), Positives = 105/297 (35%), Gaps = 5/297 (1%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+++ +  VG  V+++L      I WL+  N          I    SVDGL+  S V F
Sbjct: 1   METRSNHVLVGGVVLALLVALLVFIVWLAGFNTASNQ--RYDIFFKTSVDGLAKGSPVNF 58

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           +G+PVG+I  + L  + P     +  I  DTP+   TTATI   G  G++         +
Sbjct: 59  SGVPVGKIEEIKLLPDSPEFVRVRIAIDQDTPILQGTTATIAGIGFTGVS-QINLDGAVK 117

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
                       +  + T   +      S  E  ++  + + R  + + +  +K ++  +
Sbjct: 118 GAPPITEPGPYGEPVIPTKPGALGELLNSAPELLNRISTLTERLTELLNDKNQKSISGIL 177

Query: 181 ANIETISTVLANNISHIDKMMHTTQ--VTPHSSDSKNTFNTITDLITSLDKMIKAIDLQK 238
           A+++ +S  LA+    I   +   +  +    + ++            +   +K      
Sbjct: 178 AHVDKLSGDLADRGPEIAAAVVQLKTTMEQAGNAAERVGQLAETTNGVMADDVKPAMANL 237

Query: 239 VNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSK 295
               +             +D          +T     ++ + +  +     +     
Sbjct: 238 NKATVAAQHTLETLDATITDARPGIKAFSTQTVPQINQLARNLAEMSEALGAISNKL 294



 Score = 66.1 bits (158), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 29/179 (16%), Positives = 64/179 (35%), Gaps = 3/179 (1%)

Query: 274 FQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNMRSSISAIREITDQRQKIISTIN 333
             E+      LL+  S+  +        +N    +  +        ++ D+  +I + + 
Sbjct: 140 LGELLNSAPELLNRISTLTERLTELLNDKNQKSISGILAHVDKLSGDLADRGPEIAAAVV 199

Query: 334 TIENITSNLNDSSQKFAELMSKINNISALKENNSLFKDAQRAMHTFRDTSEKINRYIPSI 393
            ++       +++++  +L    N + A  +      +  +A    + T E ++  I   
Sbjct: 200 QLKTTMEQAGNAAERVGQLAETTNGVMA-DDVKPAMANLNKATVAAQHTLETLDATITDA 258

Query: 394 GNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFERNPQDIVWGREKGSVKIYKPKH 452
              ++ FS   +  I  L R L E         N  +R     V G  K  +  YKP++
Sbjct: 259 RPGIKAFSTQTVPQINQLARNLAEMSEALGAISNKLDRGGAGAVLGGSK--LPDYKPRN 315


>gi|114564854|ref|YP_752368.1| hypothetical protein Sfri_3702 [Shewanella frigidimarina NCIMB 400]
 gi|114336147|gb|ABI73529.1| Mammalian cell entry related domain protein [Shewanella
           frigidimarina NCIMB 400]
          Length = 149

 Score = 95.8 bits (235), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 26/133 (19%), Positives = 52/133 (39%), Gaps = 2/133 (1%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M++      VGLFV+  +    F    +  ++  +     ++ +   S  GL   + V  
Sbjct: 1   MKNNYVNFLVGLFVLFGIGALVFMSITIGGASVSNSGNYTLVAKFENS-SGLKEGAFVEM 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           +G+ VG I  +  D +       K  +     +   + A+IRT G+ G  ++++ST   E
Sbjct: 60  SGVRVGLIQSINYDPKAYESV-VKISLDNAITVPDDSIASIRTSGIIGDRFVKISTGGSE 118

Query: 121 KKTIFQIATERNQ 133
                       +
Sbjct: 119 VNMADGEEFIETE 131


>gi|282850035|ref|ZP_06259417.1| virulence factor Mce family protein [Veillonella parvula ATCC
           17745]
 gi|282580224|gb|EFB85625.1| virulence factor Mce family protein [Veillonella parvula ATCC
           17745]
          Length = 419

 Score = 95.8 bits (235), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 36/345 (10%), Positives = 100/345 (28%), Gaps = 5/345 (1%)

Query: 5   NYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRFNGIP 64
                VG F +  +      I ++ R + +  P   +       V+GL   + V+F+G+ 
Sbjct: 4   TTEAKVGAFTIIGIVLFIAGILFVGRIDIWAKPQMTITGDFTQ-VNGLKNGNQVKFSGVA 62

Query: 65  VGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKEKKTI 124
           +G +  + +    P   + K  +   T +   +  ++ + G  G  +I++S  + +    
Sbjct: 63  IGTVSDIEI---TPRGVVVKMKLDEKTQIPSDSIFSLGSDGFLGDKFIQISPGQSKVYLQ 119

Query: 125 FQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTIANIE 184
              + +      +          +   E   + I+                 +T +    
Sbjct: 120 DGDSVKGEGVDAVDKAMQSAQKLMDGTEKMLQSINSIIGDPATQSALKYSLQSTAVMADN 179

Query: 185 TISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVNQILE 244
            ++                 Q     +   +    +T+L  + D++       +      
Sbjct: 180 AVAITQNMADVTAQLNQAAQQFNADGNAGNDMRAILTNLKQTTDRVDNMARTMESTVTDP 239

Query: 245 N-IQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAFLEN 303
              +        ++         +          G  ++  +++  S  K + +   L N
Sbjct: 240 KAQENIKETLHNTAQISARINKLMGGKAYQTDVNGNSVEVGMTEKKSSTKIEPSVDLLYN 299

Query: 304 IADSTSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQK 348
             D+   +   + A          + +  +      +     S K
Sbjct: 300 TTDNEFRVNGRVRAFNNKGMAEIGLSNMGDDTTFDLNAGRFISSK 344


>gi|262202878|ref|YP_003274086.1| virulence factor Mce family protein [Gordonia bronchialis DSM
           43247]
 gi|262086225|gb|ACY22193.1| virulence factor Mce family protein [Gordonia bronchialis DSM
           43247]
          Length = 344

 Score = 95.8 bits (235), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 23/103 (22%), Positives = 39/103 (37%), Gaps = 4/103 (3%)

Query: 9   SVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRFNGIPVGRI 68
            +G  +  ++      I + +      G              GL+    VR  G+ VGR+
Sbjct: 12  LLGFAIFGVIALLLTYIIYSTLERSVSGSTNTYTT-FFNDASGLAKGDDVRMAGVRVGRV 70

Query: 69  VGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITY 111
             + LD      +     ++ D P++ +T A IR Q L G  Y
Sbjct: 71  DKIELD---NGRARVDFEVQKDQPMFTNTKAAIRYQNLIGQRY 110


>gi|296134760|ref|YP_003642002.1| Mammalian cell entry related domain protein [Thiomonas intermedia
           K12]
 gi|295794882|gb|ADG29672.1| Mammalian cell entry related domain protein [Thiomonas intermedia
           K12]
          Length = 322

 Score = 95.8 bits (235), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 52/305 (17%), Positives = 103/305 (33%), Gaps = 7/305 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           MESK  YT+VGLFVV +       + W   +          +I    +V GL TDS+V +
Sbjct: 1   MESKVNYTAVGLFVVLL-GALLGGLGWWLATGGKQTATRPYLIYATDNVSGLKTDSNVLY 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G+ VG++  + +D + P     K  I    P+   T A +   G+ G++ + L      
Sbjct: 60  RGVTVGKVASIEIDPKNPALIRIKVEIDSAVPVRNDTVAQLSPLGVTGLSAVNLIGGASS 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSR------HIQKIIENIEK 174
                             +  + I   I++A  T  +IS          ++Q I + +  
Sbjct: 120 TPLPTPPGEPDPVIPYKPSVFTQIEGGINDAAITLARISQRVDALLSPANVQSISDTLRN 179

Query: 175 PLTTTIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAI 234
             T + +     + +     +      + TQ++   S        +   +  +   +  +
Sbjct: 180 LQTLSASLAANQNNINQMFANARQTSANLTQMSAQGSALMLQSQALVKRLDGVSAQLGGL 239

Query: 235 DLQKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKS 294
             Q         Q        +   V         T      + + +  L S   +  ++
Sbjct: 240 MPQIGAAANSVAQAGDTTTAFTQAGVQAMTQLQTRTLPEVDALARNLQQLSSQLGALTEN 299

Query: 295 KETSA 299
            + + 
Sbjct: 300 LKANP 304



 Score = 58.4 bits (138), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 16/165 (9%), Positives = 53/165 (32%), Gaps = 2/165 (1%)

Query: 274 FQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNMRSSISAIREITDQRQKIISTIN 333
             +    +  +     + +      +  + + +  +   S  +    I         T  
Sbjct: 147 INDAAITLARISQRVDALLSPANVQSISDTLRNLQTLSASLAANQNNINQMFANARQTSA 206

Query: 334 TIENITSNLNDSSQKFAELMSKINNISALKENNSLFKDAQRAMHTFRDTSEKINRYIPSI 393
            +  +++  +    +   L+ +++ +SA  +   L      A ++     +    +  + 
Sbjct: 207 NLTQMSAQGSALMLQSQALVKRLDGVSA--QLGGLMPQIGAAANSVAQAGDTTTAFTQAG 264

Query: 394 GNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFERNPQDIVW 438
              +       L ++  L R LQ+  +       N + NP  +++
Sbjct: 265 VQAMTQLQTRTLPEVDALARNLQQLSSQLGALTENLKANPSQLLY 309


>gi|160900966|ref|YP_001566548.1| hypothetical protein Daci_5534 [Delftia acidovorans SPH-1]
 gi|160366550|gb|ABX38163.1| Mammalian cell entry related domain protein [Delftia acidovorans
           SPH-1]
          Length = 161

 Score = 95.8 bits (235), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 23/122 (18%), Positives = 42/122 (34%), Gaps = 1/122 (0%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M+       VGLFV+       F     +     +      +     ++ GL   ++VR 
Sbjct: 1   MQQSKSDVWVGLFVLIGAAALVFLALQSANLLSLNFQKTYTLTARFDNIGGLKPKAAVRS 60

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G+ VGR+  +  D +    +     +         ++  I T GL G  YI +     +
Sbjct: 61  AGVVVGRVESITFD-DKVFQASVTMALENRYAFPKDSSLKILTSGLLGDQYIGIEAGADD 119

Query: 121 KK 122
             
Sbjct: 120 HN 121


>gi|118466491|ref|YP_881279.1| virulence factor Mce [Mycobacterium avium 104]
 gi|118167778|gb|ABK68675.1| virulence factor Mce family protein [Mycobacterium avium 104]
          Length = 342

 Score = 95.8 bits (235), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 41/301 (13%), Positives = 84/301 (27%), Gaps = 13/301 (4%)

Query: 1   MESKNYYT--SVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSV 58
           M  K       V +F    L F+F  I    +    D    + +     ++ GL + + V
Sbjct: 1   MRRKLSSIAWRVAIFTAVCLLFTFTLIAVFGQLRFEDRTGYQAV---FTNISGLKSGNFV 57

Query: 59  RFNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLR 118
           R  G+ VG++  L L ++          +     L   T A +R + L G  Y+ L    
Sbjct: 58  RIAGVEVGKVGDLSLHRD--GTVTVGFAVDKGVRLSEGTKAVVRYENLIGDRYLALEEGP 115

Query: 119 KEKKTIFQIATERNQRAMITATPSGINYFISNA------ENTSKKISDSSRHIQKIIENI 172
              + +   AT    R         +             +  +       R  Q     +
Sbjct: 116 GSPRRLPPGATIPLARTSPALDLDALIGGFRPLFRALDPDQVNALSGQLLRIFQGQGGTL 175

Query: 173 EKPLTTTIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIK 232
              L+ T     T++         I  +    +         +        +       +
Sbjct: 176 ASVLSQTSMLTSTLAGRSQLIGELITNLNTVLRTFATRDHEFSDGLDKLAQLVDGLAQRR 235

Query: 233 AIDLQKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKM 292
                 +  I       ++   +S   + + V      +         +D+LL +     
Sbjct: 236 DDISTGLAYINAAAGSITDLLSQSRQPLKDVVQHTDRMSGQVLSDRDYVDNLLKELPDIY 295

Query: 293 K 293
           +
Sbjct: 296 Q 296


>gi|229587080|ref|YP_002845581.1| ABC transporter substrate binding protein [Rickettsia africae
           ESF-5]
 gi|228022130|gb|ACP53838.1| ABC transporter substrate binding protein [Rickettsia africae
           ESF-5]
          Length = 149

 Score = 95.8 bits (235), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 28/119 (23%), Positives = 47/119 (39%), Gaps = 3/119 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M+     T +G FVV I+   F    + + S+       +V      S +G++  S V  
Sbjct: 1   MQQNIIETIIG-FVVLIIALLFLIFAYKTGSSITSSKGYQVTAHF-QSAEGIAVGSDVMI 58

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRK 119
            GI +G +  + LD    + +     I  D  +   + A + T GL G  YI +     
Sbjct: 59  AGIKIGSVKQITLDPNSFD-ASVYLNINDDVKIPKDSKAQVVTSGLLGGKYISIVPGND 116


>gi|304413073|ref|ZP_07394546.1| periplasmic component of phospholipid ABC transporter [Candidatus
           Regiella insecticola LSR1]
 gi|304283916|gb|EFL92309.1| periplasmic component of phospholipid ABC transporter [Candidatus
           Regiella insecticola LSR1]
          Length = 171

 Score = 95.8 bits (235), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 30/124 (24%), Positives = 56/124 (45%), Gaps = 2/124 (1%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M++K     VGLFV+       F    ++            I  I  +V GL  +S V+ 
Sbjct: 1   MQTKKSEIGVGLFVLVAFIAVIFLCLKVADIKSIGNQSTYRIYAIFNNVGGLKINSPVKI 60

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDT-PLYPSTTATIRTQGLAGITYIELSTLRK 119
            G+ +GR+  + LD++  N       I+ +   +  S++  IRT GL G  ++ L+   +
Sbjct: 61  GGVVIGRVADISLDKKNYNP-RVAIDIQENYNHIPNSSSLAIRTAGLLGEQFLALNVGFE 119

Query: 120 EKKT 123
           +++ 
Sbjct: 120 DQEM 123


>gi|269797587|ref|YP_003311487.1| hypothetical protein Vpar_0524 [Veillonella parvula DSM 2008]
 gi|269094216|gb|ACZ24207.1| Mammalian cell entry related domain protein [Veillonella parvula
           DSM 2008]
          Length = 419

 Score = 95.8 bits (235), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 36/345 (10%), Positives = 100/345 (28%), Gaps = 5/345 (1%)

Query: 5   NYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRFNGIP 64
                VG F +  +      I ++ R + +  P   +       V+GL   + V+F+G+ 
Sbjct: 4   TTEAKVGAFTIIGIVLFIAGILFVGRIDIWAKPQMTITGDFTQ-VNGLKNGNQVKFSGVA 62

Query: 65  VGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKEKKTI 124
           +G +  + +    P   + K  +   T +   +  ++ + G  G  +I++S  + +    
Sbjct: 63  IGTVSDIEI---TPRGVVVKMKLDEKTQIPSDSMFSLGSDGFLGDKFIQISPGQSKVYLQ 119

Query: 125 FQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTIANIE 184
              + +      +          +   E   + I+                 +T +    
Sbjct: 120 DGDSVKGEGVDAVDKAMQSAQKLMDGTEKMLQSINSIIGDPATQSALKYSLQSTAVMADN 179

Query: 185 TISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVNQILE 244
            ++                 Q     +   +    +T+L  + D++       +      
Sbjct: 180 AVAITQNMADVTAQLNQAAQQFNADGNAGNDMRAILTNLKQTTDRVDNMARTMESTVTDP 239

Query: 245 N-IQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAFLEN 303
              +        ++         +          G  ++  +++  S  K + +   L N
Sbjct: 240 KAQENIKETLHNTAQISARINKLMGGKAYQTDVNGNSVEVGMTEKKSFTKIEPSVDLLYN 299

Query: 304 IADSTSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQK 348
             D+   +   + A          + +  +      +     S K
Sbjct: 300 TTDNEFRVNGRVRAFNNKGMAEIGLSNMGDDTTFDLNAGRFISSK 344


>gi|254486700|ref|ZP_05099905.1| paraquat-inducible protein B, putative [Roseobacter sp. GAI101]
 gi|214043569|gb|EEB84207.1| paraquat-inducible protein B, putative [Roseobacter sp. GAI101]
          Length = 694

 Score = 95.8 bits (235), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 43/412 (10%), Positives = 121/412 (29%), Gaps = 23/412 (5%)

Query: 40  EVIIRIPGSVDGLSTDSSVRFNGIPVGRIVGLF--LDQEYPNHSLAKALIRPDTPLYPST 97
           E+ +    ++ GL+  + V  +G+ +G +  L   +D      S  +             
Sbjct: 295 ELSVIFEDNISGLAVGAPVELSGLNIGEVESLSGIVDYNQFGDSRVRLNATLSIQPARLG 354

Query: 98  TATIRTQGLAGITYIELSTLRKEKKTIFQIATERNQRAMITATPSGINYFISNAENTSKK 157
                +   A     +        +           +  +   P      +  A ++   
Sbjct: 355 LPGEVSAASALSLLQDRVANGLRARLASASLLTGGLKVEMILVPDAPPARLVEAGDSYPV 414

Query: 158 ISDSSRHIQKIIENIEKPLTTTIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTF 217
           +  +          +E   T             A  + +  +M   +     +     T 
Sbjct: 415 MPTTENETSDAAATVEGVFTRINNLPIEELLNSAIGLMNSAQMFIGSDELQQTPKDVRTL 474

Query: 218 NTITDLITSLDKMIKAIDLQKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEV 277
                 + S D +           +     V++    + + ++++ V  V     +F   
Sbjct: 475 INEVTGLVSSDSVKNIPVTLNATLLRVETLVATLEQEQMAKRLLDAVDSVSAAADSFTTS 534

Query: 278 GQKIDHLLSDFSSKMKSKETSAFLENIADSTSNMRSSISAIREITDQRQKIISTINTIEN 337
            + +  L+++  +   +       + + + T+  RS+   I                   
Sbjct: 535 TEGVPALIAEIETVAANAGKLELQQLVDELTALTRSADQVIGT------------PDAVA 582

Query: 338 ITSNLNDSSQKFAELMSKINNISALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNL 397
           +  +L ++  +    + ++    A++  N     A+ A      +++ + + +  + +  
Sbjct: 583 LPGSLKNALDELNYTLQELREGGAIENVNQTLASARNAADNIAVSAQDLPQIVDRLSSLF 642

Query: 398 QNFS---------QSGLNDIQNLVRKLQETVNHFDDCLNNFERNPQDIVWGR 440
              S                Q+ +R +Q+  +         ERNP  ++ GR
Sbjct: 643 TQASRTIEGYNQGDQISRTAQDTMRDIQKAADALASLARTIERNPNSLLLGR 694



 Score = 49.5 bits (115), Expect = 0.001,   Method: Composition-based stats.
 Identities = 42/449 (9%), Positives = 125/449 (27%), Gaps = 42/449 (9%)

Query: 41  VIIRIPGSVDG-LSTDSSVRFNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTT- 98
           + I      +G L+ D+ + + GI VGR+    +        +   +      L  S+T 
Sbjct: 164 LQIAFRTVGNGQLTDDAPILYRGIEVGRVGKAQISPGGNFAIVEALIYEEHRNLVNSSTR 223

Query: 99  -----------------------ATIRTQGLAGITYIELSTLRKEKKTIFQIATERNQRA 135
                                  AT+   G+   T++      ++        ++   R+
Sbjct: 224 FWDTSGFSLSIGPGGAEVDFESIATLVGGGITFDTFVSGGDRVQDGTVFEIFPSKEEARS 283

Query: 136 MITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTIANIETISTVLANNIS 195
            +          +S     +         ++    NI +  + +              ++
Sbjct: 284 SVFNASEVDPLELSVIFEDNISGLAVGAPVELSGLNIGEVESLSGIVDYNQFGDSRVRLN 343

Query: 196 HIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVNQILENIQVSSNNFVK 255
               +       P    + +  + + D + +  +   A        +   + +  +    
Sbjct: 344 ATLSIQPARLGLPGEVSAASALSLLQDRVANGLRARLASASLLTGGLKVEMILVPDAPPA 403

Query: 256 SSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNMRSSI 315
              +  ++   +  T     +    ++ + +  ++    +  ++ +  +  +   + S  
Sbjct: 404 RLVEAGDSYPVMPTTENETSDAAATVEGVFTRINNLPIEELLNSAIGLMNSAQMFIGSDE 463

Query: 316 SAIREITDQRQKIISTINTIENITSNL----NDSSQKFAELMSKINNISALKENNSLFKD 371
                   +      T     +   N+    N +  +   L++ +      K        
Sbjct: 464 LQQTPKDVRTLINEVTGLVSSDSVKNIPVTLNATLLRVETLVATLEQEQMAKRLLDAVDS 523

Query: 372 AQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVN----------- 420
              A  +F  ++E +   I  I     N  +  L  + + +  L  + +           
Sbjct: 524 VSAAADSFTTSTEGVPALIAEIETVAANAGKLELQQLVDELTALTRSADQVIGTPDAVAL 583

Query: 421 --HFDDCLNNFERNPQDIVWGREKGSVKI 447
                + L+      Q++  G    +V  
Sbjct: 584 PGSLKNALDELNYTLQELREGGAIENVNQ 612



 Score = 45.3 bits (104), Expect = 0.018,   Method: Composition-based stats.
 Identities = 14/91 (15%), Positives = 30/91 (32%), Gaps = 3/91 (3%)

Query: 11  GLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTD-SSVRFNGIPVGRIV 69
           G   V I+             + Y+    E+ +       G+    + +R+  + VGR+ 
Sbjct: 20  GASFVWIIPILALFAALSVAWSSYNARGPEIYVEFDKGA-GIKAGETELRYRDVTVGRVE 78

Query: 70  GLFLDQEYPNHSLAKALIRPDTPLYPSTTAT 100
            +    E     +A   +  D   +   +A 
Sbjct: 79  EVGFS-EGLGKVVATIRVDKDVAPFIDNSAA 108


>gi|195952558|ref|YP_002120848.1| Mammalian cell entry related domain protein [Hydrogenobaculum sp.
           Y04AAS1]
 gi|195932170|gb|ACG56870.1| Mammalian cell entry related domain protein [Hydrogenobaculum sp.
           Y04AAS1]
          Length = 305

 Score = 95.8 bits (235), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 42/293 (14%), Positives = 104/293 (35%), Gaps = 6/293 (2%)

Query: 2   ESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRFN 61
           E K  YT +G F+V  +     +IY+ +     +  +    I    SV GLS  S V++ 
Sbjct: 3   EGKPRYTLIGFFIVFGIGVVVATIYFSTSF-FKNRNLNTYYIFTKYSVAGLSIGSPVKYK 61

Query: 62  GIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKEK 121
           G+ VG++  + + ++       K  +  +  L     A++   G+ G++YI+L   +  K
Sbjct: 62  GVDVGKVNAIKIAKDQET-IKIKISVERNLDLKKDVIASLGITGITGLSYIDLEHEKGVK 120

Query: 122 KTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTIA 181
                   +  +  +I   PS +    +          +  +++  +          T+ 
Sbjct: 121 AFYD----KDLEAYVIPMKPSELQQISNYIPQILYSAYNLIKNLNNLTSYKNTKKFDTLF 176

Query: 182 NIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVNQ 241
           +    +    N++    K   +      ++ +K         I +  +    +      +
Sbjct: 177 DNINDTIKNLNSLIKDSKNSLSNTNKVLTAFNKKINELDVKDINNTVEKYNLLADNLNKE 236

Query: 242 ILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKS 294
             +   +  +    S     N    + +T +  Q+  +++  L+    +   +
Sbjct: 237 TTKLDTLLKSLKTNSDMLTNNIYPQINKTLKDIQKTSKEMRILIKHIKNHPNA 289


>gi|126663826|ref|ZP_01734821.1| ABC transporter, permease component [Flavobacteria bacterium BAL38]
 gi|126624090|gb|EAZ94783.1| ABC transporter, permease component [Flavobacteria bacterium BAL38]
          Length = 324

 Score = 95.8 bits (235), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 46/306 (15%), Positives = 116/306 (37%), Gaps = 15/306 (4%)

Query: 1   ME-SKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVR 59
           ME +      +GLF++    F   +IY++       G  + +     G+V GL   ++VR
Sbjct: 1   MEKTDQQKIRLGLFIIIGSLFFLAAIYFVGNKQNLFGNTSNLKAVF-GNVSGLQVGNNVR 59

Query: 60  FNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRK 119
           + G+ +G +  + +  +   +       +    +     ATI + GL G   I +   + 
Sbjct: 60  YAGMDIGTVKSIEMVNDTTINVSMAIEDKMLIHIKKDAIATIGSDGLVGNMIINIIPGKG 119

Query: 120 EKKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTT 179
            +  +      ++             Y  S+ +   K +  ++++   +  ++ K     
Sbjct: 120 NENAVIPGDIIQS-------------YSKSSTDEMLKTLDVTNKNAALLTADLLKITHEI 166

Query: 180 IANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKV 239
                T+  ++ +++   D       +   +  +  +   +  +I  L++    I + K 
Sbjct: 167 NKGNGTVGVLIRDSLMAQDLKATMNYLKETTKGTTASVANLNKMIADLNQKDNVIGVLKD 226

Query: 240 NQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSA 299
            ++   ++   +N  KSS ++   V ++  T    +E    +++L +D +   K   T  
Sbjct: 227 KEVAIKVKTIIDNLEKSSGEIDKVVTNLNTTITNIKEGKGALNYLSNDPNLVKKIDSTMI 286

Query: 300 FLENIA 305
            L   +
Sbjct: 287 NLNEAS 292


>gi|15893029|ref|NP_360743.1| ABC transporter substrate binding protein [Rickettsia conorii str.
           Malish 7]
 gi|34581283|ref|ZP_00142763.1| ABC transporter substrate binding protein [Rickettsia sibirica 246]
 gi|157828951|ref|YP_001495193.1| ABC transporter substrate binding protein [Rickettsia rickettsii
           str. 'Sheila Smith']
 gi|165933676|ref|YP_001650465.1| toluene transport system protein [Rickettsia rickettsii str. Iowa]
 gi|238650382|ref|YP_002916234.1| toluene transport system protein [Rickettsia peacockii str. Rustic]
 gi|15620230|gb|AAL03644.1| ABC transporter substrate binding protein [Rickettsia conorii str.
           Malish 7]
 gi|28262668|gb|EAA26172.1| ABC transporter substrate binding protein [Rickettsia sibirica 246]
 gi|157801432|gb|ABV76685.1| ABC transporter substrate binding protein [Rickettsia rickettsii
           str. 'Sheila Smith']
 gi|165908763|gb|ABY73059.1| toluene transport system protein [Rickettsia rickettsii str. Iowa]
 gi|238624480|gb|ACR47186.1| toluene transport system protein [Rickettsia peacockii str. Rustic]
          Length = 149

 Score = 95.4 bits (234), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 28/119 (23%), Positives = 48/119 (40%), Gaps = 3/119 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M+     T +G FVV I+   F    + + S+       +V      S +G++  S V  
Sbjct: 1   MQQNIIETIIG-FVVLIIALLFLIFAYKTGSSITSSKGYQVTAHF-QSAEGIAVGSDVMI 58

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRK 119
           +GI +G +  + LD    + +     I  D  +   + A + T GL G  YI +     
Sbjct: 59  SGIKIGSVKQITLDPNSFD-ASVYLNINDDVKIPKDSKAQVVTSGLLGGKYISIVPGND 116


>gi|294338721|emb|CAZ87053.1| putative ABC-type transport system involved in resistance to
           organic solvents, periplasmic component [Thiomonas sp.
           3As]
          Length = 322

 Score = 95.4 bits (234), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 52/305 (17%), Positives = 102/305 (33%), Gaps = 7/305 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           MESK  YT+VGLFVV +       + W   +          +I    +V GL TDS+V +
Sbjct: 1   MESKVNYTAVGLFVVLL-GALLGGLGWWLATGGKQTATRPYLIYATDNVSGLKTDSNVLY 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G+ VG++  + +D + P     K  I    P+   T A +   G+ G++ + L      
Sbjct: 60  RGVTVGKVASIEIDPKNPALIRIKVEIDSAVPVRSDTVAQLSPLGVTGLSAVNLIGGASS 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSR------HIQKIIENIEK 174
                             +  + I   I++A  T  +IS          ++Q I + +  
Sbjct: 120 TPLPTPPGEPDPVIPYKPSVFTQIEGGINDAAITLARISQRVDALLSPANVQSISDTLRN 179

Query: 175 PLTTTIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAI 234
             T + +     + +     +      + TQ++   S        +   +  +   +   
Sbjct: 180 LQTLSASLAANQNNINQMFANARQTSANLTQMSAQGSALMLQSQALVKRLDGVSAQLGGS 239

Query: 235 DLQKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKS 294
             Q         Q        +   V         T      + + +  L S   +  ++
Sbjct: 240 MPQIGAAANSVAQAGDTTTAFTQAGVQAMTQLQTRTLPEVDALARNLQQLSSQLGALTEN 299

Query: 295 KETSA 299
            + + 
Sbjct: 300 LKANP 304



 Score = 57.3 bits (135), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 15/165 (9%), Positives = 52/165 (31%), Gaps = 2/165 (1%)

Query: 274 FQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNMRSSISAIREITDQRQKIISTIN 333
             +    +  +     + +      +  + + +  +   S  +    I         T  
Sbjct: 147 INDAAITLARISQRVDALLSPANVQSISDTLRNLQTLSASLAANQNNINQMFANARQTSA 206

Query: 334 TIENITSNLNDSSQKFAELMSKINNISALKENNSLFKDAQRAMHTFRDTSEKINRYIPSI 393
            +  +++  +    +   L+ +++ +SA  +          A ++     +    +  + 
Sbjct: 207 NLTQMSAQGSALMLQSQALVKRLDGVSA--QLGGSMPQIGAAANSVAQAGDTTTAFTQAG 264

Query: 394 GNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFERNPQDIVW 438
              +       L ++  L R LQ+  +       N + NP  +++
Sbjct: 265 VQAMTQLQTRTLPEVDALARNLQQLSSQLGALTENLKANPSQLLY 309


>gi|226329326|ref|ZP_03804844.1| hypothetical protein PROPEN_03231 [Proteus penneri ATCC 35198]
 gi|225202512|gb|EEG84866.1| hypothetical protein PROPEN_03231 [Proteus penneri ATCC 35198]
          Length = 178

 Score = 95.4 bits (234), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 28/148 (18%), Positives = 59/148 (39%), Gaps = 3/148 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M+SK     VGLFV+  L    F    ++   +        +    G++ GL   S V+ 
Sbjct: 1   MQSKKIEVWVGLFVLIALAAVIFLCLKVADIKEMGNQPTYRVYASFGNIGGLKERSPVKI 60

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIR---PDTPLYPSTTATIRTQGLAGITYIELSTL 117
            G+ +GR+  + L +E   +   +  +        +  S++ +IRT GL G  ++ L+  
Sbjct: 61  GGVVIGRVSSITLKEEDEGNYRPEVALDILSIYDHIPESSSLSIRTSGLLGEQFLALNLG 120

Query: 118 RKEKKTIFQIATERNQRAMITATPSGIN 145
             ++     +  +  +     +     +
Sbjct: 121 FYDEALDSTLLKDGGRITNTNSAMVLED 148


>gi|227112742|ref|ZP_03826398.1| hypothetical protein PcarbP_07259 [Pectobacterium carotovorum
           subsp. brasiliensis PBR1692]
          Length = 188

 Score = 95.4 bits (234), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 27/133 (20%), Positives = 55/133 (41%), Gaps = 2/133 (1%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M++K     VG+F++  L    F    ++            +     ++ GL   S +R 
Sbjct: 1   MQTKKTEVWVGVFMLIALAAILFLCLKVADLKSIGSEPTYRLYATFDNIGGLKARSPIRI 60

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDT-PLYPSTTATIRTQGLAGITYIELSTLRK 119
            G+ VGR+  + LD++          I+     +  +++  IRT GL G  Y+ L+   +
Sbjct: 61  GGVVVGRVADISLDEKTY-LPRVAMDIQQRYDHIPDTSSLAIRTSGLLGEQYLALNIGFE 119

Query: 120 EKKTIFQIATERN 132
           +++    I  +  
Sbjct: 120 DEEMGTAILKDGG 132


>gi|41408213|ref|NP_961049.1| hypothetical protein MAP2115c [Mycobacterium avium subsp.
           paratuberculosis K-10]
 gi|41396568|gb|AAS04432.1| hypothetical protein MAP_2115c [Mycobacterium avium subsp.
           paratuberculosis K-10]
          Length = 342

 Score = 95.4 bits (234), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 41/301 (13%), Positives = 84/301 (27%), Gaps = 13/301 (4%)

Query: 1   MESKNYYT--SVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSV 58
           M  K       V +F    L F+F  I    +    D    + +     ++ GL + + V
Sbjct: 1   MRRKLSSIAWRVAIFTAVCLLFTFTLIAVFGQLRFEDRTGYQAV---FTNISGLKSGNFV 57

Query: 59  RFNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLR 118
           R  G+ VG++  L L ++          +     L   T A +R + L G  Y+ L    
Sbjct: 58  RIAGVEVGKVGDLTLHRD--GTVTVGFAVDKGVRLSEGTKAVVRYENLIGDRYLALEEGP 115

Query: 119 KEKKTIFQIATERNQRAMITATPSGINYFISNA------ENTSKKISDSSRHIQKIIENI 172
              + +   AT    R         +             +  +       R  Q     +
Sbjct: 116 GSPRRLPPGATIPLARTSPALDLDALIGGFRPLFRALDPDQVNALSGQLLRIFQGQGGTL 175

Query: 173 EKPLTTTIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIK 232
              L+ T     T++         I  +    +         +        +       +
Sbjct: 176 ASVLSQTSMLTSTLAGRSQLIGELITNLNTVLRTFATRDHEFSDGLDKLAQLVDGLAQRR 235

Query: 233 AIDLQKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKM 292
                 +  I       ++   +S   + + V      +         +D+LL +     
Sbjct: 236 DDISTGLAYINAAAGSITDLLSQSRQPLKDVVQQTDRMSGQVLSDRDYVDNLLKELPDIY 295

Query: 293 K 293
           +
Sbjct: 296 Q 296


>gi|295675323|ref|YP_003603847.1| Mammalian cell entry related domain protein [Burkholderia sp.
           CCGE1002]
 gi|295435166|gb|ADG14336.1| Mammalian cell entry related domain protein [Burkholderia sp.
           CCGE1002]
          Length = 325

 Score = 95.4 bits (234), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 47/306 (15%), Positives = 105/306 (34%), Gaps = 14/306 (4%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K +    GLF V +      + Y  +             +    +V GL  D++VRF
Sbjct: 1   MENKAHAFWAGLFTVVLTAAIALAAYLFNVDRTV---RVPYDLIARTNVTGLFADAAVRF 57

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G+ VGR+  +  D  +P   L + ++    P+  ST  ++  QG+ GI +I+L    ++
Sbjct: 58  RGLDVGRVQSIKFDPAHPGQILIRIMVDEHAPITHSTFGSLGLQGVTGIAFIQLDDTGRD 117

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
              +       +    +   P          +     +    +    + + +   +   +
Sbjct: 118 LTPLH------SSVHQVAQLPMRPGLLDQLQQRGDVLLRKLEKVTDNVNDMLSPEMVEQL 171

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
                     A+ ++ + + M        +S    T + +   + S ++MI  ++     
Sbjct: 172 HETAASIAQAASGVATLTREMAPV-----ASKLPGTIDQLNHTLASTNQMITGLNRPDGP 226

Query: 241 QILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAF 300
                 +V +                   + +   E   +++ L  D  S  +S + +A 
Sbjct: 227 LQRNLNKVGTAAQQAGEALTQMNTTMQDLSARVGFETLPRVNSLTEDVRSAAQSIDRAAD 286

Query: 301 LENIAD 306
             N   
Sbjct: 287 TFNTNP 292



 Score = 48.8 bits (113), Expect = 0.002,   Method: Composition-based stats.
 Identities = 20/163 (12%), Positives = 51/163 (31%), Gaps = 6/163 (3%)

Query: 281 IDHLLSDFSSKMKSKETSAFLENIADSTSNMRSSISAIREITDQRQKIISTINTIENITS 340
           +D L       ++  E      N   S   +         I      + +    +  + S
Sbjct: 138 LDQLQQRGDVLLRKLEKVTDNVNDMLSPEMVEQLHETAASIAQAASGVATLTREMAPVAS 197

Query: 341 NLNDSSQKFAELMSKINNISALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNF 400
            L  +  +    ++  N +             QR ++     +++    +  +   +Q+ 
Sbjct: 198 KLPGTIDQLNHTLASTNQMITGLNRPD--GPLQRNLNKVGTAAQQAGEALTQMNTTMQDL 255

Query: 401 SQ----SGLNDIQNLVRKLQETVNHFDDCLNNFERNPQDIVWG 439
           S       L  + +L   ++      D   + F  NP+ +++G
Sbjct: 256 SARVGFETLPRVNSLTEDVRSAAQSIDRAADTFNTNPRSVLFG 298


>gi|323700844|ref|ZP_08112756.1| Mammalian cell entry related domain protein [Desulfovibrio sp.
           ND132]
 gi|323460776|gb|EGB16641.1| Mammalian cell entry related domain protein [Desulfovibrio
           desulfuricans ND132]
          Length = 383

 Score = 95.4 bits (234), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 51/401 (12%), Positives = 132/401 (32%), Gaps = 50/401 (12%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M  K  Y  +GL+++         +  L  + +Y      +      SV+GLS  S V+ 
Sbjct: 1   MVRKKDYFKLGLYIILGTGMLLAVVVILG-AGRYFQTTFPLETYFDESVNGLSVGSPVKL 59

Query: 61  NGIPVGRIVGLFLDQE--------YPNHSLAKALIRPDT--PLYPSTTAT-IRTQGLAGI 109
            G+ VGR+  +                +   +  + PD    +        +  +   G+
Sbjct: 60  RGVQVGRVAEINFVSNIYHDAKSPQSRYVYVRCEVNPDLFKEMTDDEFVEHVAREAKRGM 119

Query: 110 TYIELSTLRKEKKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKII 169
                S     +  +  I  +      +    +    +I +  +T  ++ ++   I K +
Sbjct: 120 RIRPTSLGLTGQLFLNTIYQDPKTNPPLPIDWTPEYAYIPSVPSTLSRVEEAVTTISKTL 179

Query: 170 ENIEKPLTTTIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDK 229
            ++ +    +I                                       +  ++ ++D 
Sbjct: 180 SSLRQEDLQSI------------------------------------IKDVKSIVGTIDD 203

Query: 230 MIKAIDLQKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFS 289
            +K    ++    + +I  S+ + +  +D+++           T   +            
Sbjct: 204 FMKTEGGREAGNRVLDILQSTRSILGRTDRLLADPAAETLIPHTASILSNVDRITSESAD 263

Query: 290 SKMKSKETSAFLENIADSTSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKF 349
           + +K+   +          S + S       +     +I  ++  I   +S+L  +  K 
Sbjct: 264 NIIKAAAETRAAIASFKQASQVLSKTLTDPRMDKAMAEIAPSLENISRASSDLAAAVTKV 323

Query: 350 AELMSKINNISALKENN--SLFKDAQRAMHTFRDTSEKINR 388
             L++++N ++A +E N  S+ +D +  M   ++ ++   R
Sbjct: 324 HTLINRLNGMAASQEANVRSIIEDTREVMQNVKELTDDAKR 364


>gi|307824570|ref|ZP_07654795.1| Mammalian cell entry related domain protein [Methylobacter
           tundripaludum SV96]
 gi|307734554|gb|EFO05406.1| Mammalian cell entry related domain protein [Methylobacter
           tundripaludum SV96]
          Length = 155

 Score = 95.0 bits (233), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 29/129 (22%), Positives = 49/129 (37%), Gaps = 2/129 (1%)

Query: 3   SKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRFNG 62
           +    T VGLFV + +   FF    +S  + +    +  +     +  GL   S V   G
Sbjct: 4   TSTQDTLVGLFVAAGIVGLFFLALQVSNLSSFTEQNSYTVTARFENSGGLKVKSPVSAAG 63

Query: 63  IPVGRIVGLFLDQEYPNHSLAKALIRPDT-PLYPSTTATIRTQGLAGITYIELSTLRKEK 121
           + +G++  +  D +       +  I      L   TTA++ T GL G  Y+ L     E+
Sbjct: 64  VKIGKVSAIHFDPKTYESV-VQLSIDSQYNTLPDDTTASVFTAGLLGEQYVNLEAGGSEE 122

Query: 122 KTIFQIATE 130
                   E
Sbjct: 123 HLKDGGKIE 131


>gi|254773838|ref|ZP_05215354.1| virulence factor Mce family protein [Mycobacterium avium subsp.
           avium ATCC 25291]
          Length = 340

 Score = 95.0 bits (233), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 33/289 (11%), Positives = 76/289 (26%), Gaps = 11/289 (3%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M ++       +F V +   + F  +   +           +      V  L    SVR 
Sbjct: 1   MRTRATLIKFAVFAVVMAMLTAFLFFIFGQYRTGATNGYSAV---FTDVSRLKPGQSVRV 57

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            GI VG +  + L  +     + K     +  L   T A +R   L G  Y+EL      
Sbjct: 58  AGIRVGTVNSVSLQPD--KKVVVKFDADRNIVLTEGTRAAVRYLNLVGDRYLELVDGPGS 115

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSS------RHIQKIIENIEK 174
            K +         R         +   +            ++      +  Q     ++ 
Sbjct: 116 PKRLPAGGQIPVSRTAPALDLDLLLGGLKPVTQGLNARDVNALTSGLLQVFQGQGGTLDS 175

Query: 175 PLTTTIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAI 234
             T   +    ++         ID +              +      + + S     +  
Sbjct: 176 LFTKATSFSNALADNDQTVQQLIDNLNIVIGTISKDGKQFSGAVDRLERLVSGLSDDRNT 235

Query: 235 DLQKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDH 283
               ++ +       ++   ++   +  T+  +            ++D 
Sbjct: 236 IGSAIDALDRGTASLADLLAQARPPLTGTIDQLNRLAPILDNDKDRLDA 284


>gi|322378618|ref|ZP_08053054.1| ABC transport system substrate binding protein [Helicobacter suis
           HS1]
 gi|322380553|ref|ZP_08054719.1| ABC transport system substrate-binding protein [Helicobacter suis
           HS5]
 gi|321147015|gb|EFX41749.1| ABC transport system substrate-binding protein [Helicobacter suis
           HS5]
 gi|321148925|gb|EFX43389.1| ABC transport system substrate binding protein [Helicobacter suis
           HS1]
          Length = 291

 Score = 95.0 bits (233), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 37/284 (13%), Positives = 105/284 (36%), Gaps = 5/284 (1%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME    YT +G   ++ +      I WL   +  D      ++     ++G+  ++ + +
Sbjct: 1   MERHVNYTLIGGIFLACMVCMVVFILWLGHFDLEDKDYMGYVMYTDKDLNGIGANTPINY 60

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            GI +G +  +  D+ +         I+   P++  ++  + +QGL G+ Y+ L     +
Sbjct: 61  KGIQIGSVRHVAFDKGHLGMVKLDLRIQSRVPIHKDSSLKVESQGLVGLKYLSLIQSDSK 120

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
           +      +   ++R +            S    +++ +       Q +       ++ TI
Sbjct: 121 EFY----SKNDSERVLRYEQSFLEKLTSSAGHISNEVLYIIKSIEQILSPQNIDNISKTI 176

Query: 181 ANIETISTVLANNISHIDKMMHTTQVT-PHSSDSKNTFNTITDLITSLDKMIKAIDLQKV 239
           A+I+ ++  L N    +++++     T   ++ +    +   +   +L +    + +   
Sbjct: 177 ASIQKVTGGLDNTRLALERLLDKATQTAEQATKTLKKGDGFLESGRTLAEHGDQLVVNIN 236

Query: 240 NQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDH 283
            ++ +              Q+  ++ ++    Q    +  K D 
Sbjct: 237 KKVEDKQYDFKTMLTPLIMQMELSLRNIDNFVQKGSSLIDKFDA 280



 Score = 37.2 bits (83), Expect = 5.5,   Method: Composition-based stats.
 Identities = 19/162 (11%), Positives = 49/162 (30%), Gaps = 9/162 (5%)

Query: 281 IDHLLSDFSSKMKSKETSAFLENIADSTSNMRSSISAIREITDQRQKIISTINTIENITS 340
           ++ L S                    S  N+ +    I  I      + +T   +E +  
Sbjct: 139 LEKLTSSAGHISNEVLYIIKSIEQILSPQNIDNISKTIASIQKVTGGLDNTRLALERLLD 198

Query: 341 NLNDSSQKFAELMSKINNISALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNF 400
               ++++  + + K +         +   D              IN+ +     + +  
Sbjct: 199 KATQTAEQATKTLKKGDGFLESGRTLAEHGD---------QLVVNINKKVEDKQYDFKTM 249

Query: 401 SQSGLNDIQNLVRKLQETVNHFDDCLNNFERNPQDIVWGREK 442
               +  ++  +R +   V      ++ F+ NP   ++G  K
Sbjct: 250 LTPLIMQMELSLRNIDNFVQKGSSLIDKFDANPYKTIFGDRK 291


>gi|297537488|ref|YP_003673257.1| Mammalian cell entry related domain-containing protein
           [Methylotenera sp. 301]
 gi|297256835|gb|ADI28680.1| Mammalian cell entry related domain protein [Methylotenera sp. 301]
          Length = 182

 Score = 95.0 bits (233), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 22/117 (18%), Positives = 38/117 (32%), Gaps = 1/117 (0%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M+       VG+FV   +         +             +     +V  L   + V+ 
Sbjct: 1   MDRTKIDLWVGIFVALGVAALLGLAMKVGNLTSGKIGETYSVTAAFENVGSLKPHAPVKS 60

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTL 117
            G+ VGR+  +  + +    ++    I         T A I T GL G  Y+ L   
Sbjct: 61  AGVAVGRVDSIAFNSKTYE-AIVTIKIDKRYNFPKDTFANIYTAGLLGEQYVGLEAG 116


>gi|111021671|ref|YP_704643.1| MCE family protein [Rhodococcus jostii RHA1]
 gi|110821201|gb|ABG96485.1| MCE family protein [Rhodococcus jostii RHA1]
          Length = 338

 Score = 95.0 bits (233), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 35/295 (11%), Positives = 79/295 (26%), Gaps = 11/295 (3%)

Query: 4   KNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRFNGI 63
           +     + +F   +           S+                  V GL     VR  G+
Sbjct: 2   RATTVKLLIFATVMSVIFAGLALVFSQYRFSSSDGYHAT---FTDVSGLKPGDKVRIAGV 58

Query: 64  PVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKEKKT 123
           PVG +  + +D +    +     +     L+  T AT+R + L G  Y+EL       + 
Sbjct: 59  PVGAVEKVSIDDDN--LADVDFTVDTKYSLFDGTKATVRYENLVGDRYMELLEGAGSVEP 116

Query: 124 IFQIATERNQRAMITATPSGINYFISNA------ENTSKKISDSSRHIQKIIENIEKPLT 177
           +    +   +          +             +  +       +  Q     +   L 
Sbjct: 117 LPDGGSIPVENTSPALDLDLLLGGFKPLLRALDPQQVNDLSQALVQVFQGQGGTLVSLLG 176

Query: 178 TTIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQ 237
           +T +   T++         I  +           D   +       + S     +     
Sbjct: 177 STSSFTNTLADRDQLIGEVITNLNQVLGTINDRGDQFRSTLDQLQQLVSGLSQDRDQIGD 236

Query: 238 KVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKM 292
            + +I       +N    +   + +T+ +   T    Q     +D +  +     
Sbjct: 237 AIPRIAGATGDLANLLEGARPPLQSTIAEANRTATQLQAGEDDLDWVFQNLPDAY 291


>gi|116747851|ref|YP_844538.1| hypothetical protein Sfum_0403 [Syntrophobacter fumaroxidans MPOB]
 gi|116696915|gb|ABK16103.1| Mammalian cell entry related domain protein [Syntrophobacter
           fumaroxidans MPOB]
          Length = 146

 Score = 95.0 bits (233), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 25/133 (18%), Positives = 50/133 (37%), Gaps = 4/133 (3%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M   +   +VG+F +  +    +    +        P   V      S+ GL   ++V  
Sbjct: 1   MYRPSLEITVGVFFILGVVCMAYLSLVVGGPGALGEPHYRVNALF-NSITGLRRGAAVEI 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G+ VG+++ + L+      +     IR    L   T A+IRT+G+ G  +++L      
Sbjct: 60  AGVRVGKVLDITLENN---QARVVMAIRDGVRLSDDTVASIRTKGIIGEIFVKLIPGGSG 116

Query: 121 KKTIFQIATERNQ 133
           +           +
Sbjct: 117 RDIGPGDTLIETE 129


>gi|319942211|ref|ZP_08016527.1| toluene tolerance protein TTG2C [Sutterella wadsworthensis 3_1_45B]
 gi|319804264|gb|EFW01156.1| toluene tolerance protein TTG2C [Sutterella wadsworthensis 3_1_45B]
          Length = 156

 Score = 95.0 bits (233), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 24/117 (20%), Positives = 46/117 (39%), Gaps = 2/117 (1%)

Query: 2   ESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQY-DGPMAEVIIRIPGSVDGLSTDSSVRF 60
            ++    +VGLF+V     + F     +    +  G     +     ++ GL   ++V+ 
Sbjct: 3   SNRKLEAAVGLFIVLGFLAALFMALQAANLGSFTFGQKTYAVTADFDNIGGLKARAAVKS 62

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTL 117
            G+ VGR+  +  D E    +     +    P    ++A I T GL G  Y+ +   
Sbjct: 63  AGVVVGRVRSIVFDPETF-QARVVMDMDARYPFPDDSSAKILTAGLLGEQYVGIEAG 118


>gi|84687032|ref|ZP_01014915.1| paraquat-inducible protein, putative [Maritimibacter alkaliphilus
           HTCC2654]
 gi|84665006|gb|EAQ11487.1| paraquat-inducible protein, putative [Rhodobacterales bacterium
           HTCC2654]
          Length = 702

 Score = 95.0 bits (233), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 48/430 (11%), Positives = 126/430 (29%), Gaps = 30/430 (6%)

Query: 29  SRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRFNGIPVGRIVGL-----FLDQEYPNHSLA 83
           S  +       E+++    SV GLS  S V   G+ +G +  +       D        A
Sbjct: 285 SAFSNPFENAVELVVEFKDSVSGLSAGSPVNLRGVRIGSVSAINAIVREGDNGREVRLRA 344

Query: 84  KALIRPDTP-LYPSTTATIRTQGLAGITYIELSTLRKEKKTIFQIATERNQRAMITATPS 142
              I P    L                   E    R   +++F  A       +  A P+
Sbjct: 345 TLSIDPSRLGLGDDDVEETTVIDFLSEAVREGLRARLGFQSLFSQALVVELVRVPEAEPA 404

Query: 143 ---GINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTIANIETISTVLANNISHIDK 199
               +        +   ++ +     + ++  I+      + +    +       +  + 
Sbjct: 405 ALVLLPDLPPQIPSVQSELPNLGATAEGLLARIDNLPVEEVLDQAIATMAAIETFAADEG 464

Query: 200 MMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVNQILENIQVSSNNFVKSSDQ 259
           +           D         D+     ++  A+   +          + +  + +   
Sbjct: 465 LREAPDALVSLLDDARGLVGSEDIQALPGEINAAVSDLRTIISTMEQAGAVDQVLSAFKS 524

Query: 260 VINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNMRSSISAIR 319
           V +  + V            ++  L+    +           E +  +   + S+   I 
Sbjct: 525 VDDAANSVTAFAGDVSGAADEVTELIKRLQALTDKANELELNEFLTSARELVESADRLID 584

Query: 320 EITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNISALKENNSLFKDAQRAMH-- 377
               +            ++ ++L  +  +    ++ +    A++  N+    A  A    
Sbjct: 585 SDATR------------DLPASLTAALDEARGALADLREGGAVENINATLASAGDAAEAV 632

Query: 378 -----TFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNL--VRKLQETVNHFDDCLNNFE 430
                +  + + +I+  +    + + ++  +   + + L  +R++Q             E
Sbjct: 633 EEAAGSLPEIANRIDLLVNETRSVVASYGTNSNFNRETLNSLREIQNAAEALSKLARALE 692

Query: 431 RNPQDIVWGR 440
           RNP  I++GR
Sbjct: 693 RNPNSILFGR 702



 Score = 48.4 bits (112), Expect = 0.002,   Method: Composition-based stats.
 Identities = 35/415 (8%), Positives = 104/415 (25%), Gaps = 32/415 (7%)

Query: 46  PGSVDGLSTDSSVRFNGIPVGRIVGLFLDQEYPNHS-LAKALIRPDTPLYPSTTATIRTQ 104
                 L+  + +   GI VGRI    L          A      +  L  +T   + + 
Sbjct: 171 TDDAAQLTAGAPIFHKGIEVGRIEQPELLFTRDGVVFDAFIEEPYNELLNSATRFWLTSG 230

Query: 105 G----------LAGITYIELSTLRKEKKTIFQIATERNQRAMITATPSGINYFISNAENT 154
                      L+  +   L        T+F       +  +     S      S   N 
Sbjct: 231 FSLSLGTGGLDLSVGSLANLVRGGLSFDTVFSGGVPVTEGQVFELYESEDAARSSAFSNP 290

Query: 155 SKKISDSSRHIQKI---------IENIEKPLTTTIANIETISTVLANNISHIDKMMHTTQ 205
            +   +     +           +      + +  A    +          +   +    
Sbjct: 291 FENAVELVVEFKDSVSGLSAGSPVNLRGVRIGSVSAINAIVREGDNGREVRLRATLSIDP 350

Query: 206 VTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVNQILENIQVSSNNFVKSSDQVINTVH 265
                 D      T+ D ++   +      L   +   + + V      ++    +  + 
Sbjct: 351 SRLGLGDDDVEETTVIDFLSEAVREGLRARLGFQSLFSQALVVELVRVPEAEPAALVLLP 410

Query: 266 DVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNMRSSISAIREITDQR 325
           D+     + Q     +        +++ +      L+    + + + +  +         
Sbjct: 411 DLPPQIPSVQSELPNLGATAEGLLARIDNLPVEEVLDQAIATMAAIETFAADEGLREAPD 470

Query: 326 QKIISTINTIENI-TSNLNDSSQKFAELMSKINNISALKENNSLFKDAQRAMHTFRDTSE 384
             +    +    + + ++     +    +S +  I +  E          A  +  D + 
Sbjct: 471 ALVSLLDDARGLVGSEDIQALPGEINAAVSDLRTIISTMEQAGAVDQVLSAFKSVDDAAN 530

Query: 385 KINRYIPSIGNNLQNFSQSGLN-----------DIQNLVRKLQETVNHFDDCLNN 428
            +  +   +       ++               ++   +   +E V   D  +++
Sbjct: 531 SVTAFAGDVSGAADEVTELIKRLQALTDKANELELNEFLTSARELVESADRLIDS 585



 Score = 42.6 bits (97), Expect = 0.14,   Method: Composition-based stats.
 Identities = 11/108 (10%), Positives = 35/108 (32%), Gaps = 15/108 (13%)

Query: 2   ESKN-----YYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTD- 55
           E++        + V L  ++ L  +    +       +      + I    +  G+  D 
Sbjct: 12  ETRTRSAWRNLSWVWLVPLAALAVTLGVAWK-----TWADRGRPIEIVF-ENASGVVADE 65

Query: 56  SSVRFNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTP--LYPSTTATI 101
           ++VR+  + +G +  +    +  +  +    +       L  +    +
Sbjct: 66  TTVRYRDVVIGSVERVGFVAD-LSSIVVTVRVDRTIADSLPENARFWV 112


>gi|294793370|ref|ZP_06758515.1| putative ABC transport system substrate-binding protein
           [Veillonella sp. 6_1_27]
 gi|294795189|ref|ZP_06760323.1| putative ABC transport system substrate-binding protein
           [Veillonella sp. 3_1_44]
 gi|294453981|gb|EFG22356.1| putative ABC transport system substrate-binding protein
           [Veillonella sp. 3_1_44]
 gi|294455801|gb|EFG24166.1| putative ABC transport system substrate-binding protein
           [Veillonella sp. 6_1_27]
          Length = 419

 Score = 95.0 bits (233), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 36/343 (10%), Positives = 101/343 (29%), Gaps = 5/343 (1%)

Query: 7   YTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRFNGIPVG 66
              VG F +  +      I ++ R + +  P   +       V+GL   + V+F+G+ +G
Sbjct: 6   EAKVGAFTIIGIVLFIAGILFVGRIDIWAKPQMTITGDFTQ-VNGLKNGNQVKFSGVAIG 64

Query: 67  RIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKEKKTIFQ 126
            +  + +    P   + K  +   T +   +  ++ + G  G  +I++S  + +      
Sbjct: 65  TVSDIEI---TPRGVVVKMKLDEKTQIPSDSIFSLGSDGFLGDKFIQISPGQSKVYLQDG 121

Query: 127 IATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTIANIETI 186
            + +      +          +   E   + I+                 +T +     +
Sbjct: 122 DSVKGEGVDAVDKAMQSAQKLMDGTEKMLQSINSIIGDPATQSALKYSLQSTAVMADNAV 181

Query: 187 STVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVNQILEN- 245
           +                 Q     +   +    +T+L  + D++       +        
Sbjct: 182 AITQNMADVTAQLNQAAQQFNADGNAGNDMRAILTNLKQTTDRVDNMARTMESTVTDPKA 241

Query: 246 IQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAFLENIA 305
            +        ++         +          G+ ++  +++  S  K + +   L N  
Sbjct: 242 QENIKETLHNTAQISARINKLMGGKAYQTDVNGKSVEVGMTEKKSSTKIEPSVDLLYNTT 301

Query: 306 DSTSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQK 348
           D+   +   + A          + +  +      +     S K
Sbjct: 302 DNEFRVNGRVRAFNNKGMAEIGLSNIGDDTTFDLNAGRFISSK 344


>gi|229495558|ref|ZP_04389291.1| mce related protein [Porphyromonas endodontalis ATCC 35406]
 gi|229317541|gb|EEN83441.1| mce related protein [Porphyromonas endodontalis ATCC 35406]
          Length = 302

 Score = 95.0 bits (233), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 47/294 (15%), Positives = 101/294 (34%), Gaps = 7/294 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M+  +    +G F +  +   +F + +L     +    +    R   +V+GLS  S V+ 
Sbjct: 1   MQDPSKLVKIGFFTLLAIALLYFGLNYLKGLAVFGRECSYY-ARFT-NVEGLSVASPVKI 58

Query: 61  NGIPVGRIVGLFLD--QEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLR 118
           NG  VG + GL  +   +    +L +  I  D  +   T A+I+   + G   ++L    
Sbjct: 59  NGYKVGTVQGLEFEIAPDGTASTLVQVNIDRDYKIPRGTRASIKAA-IFGGAQLDLQLAT 117

Query: 119 KEKKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTT 178
            ++        E N+ A    +  G       A+   K  S  S   Q +     K    
Sbjct: 118 SQQILAEGDFLETNEGAGDPLSTLGNEILPRVAQLIPKVDSILSSTQQLLATPELKQSIH 177

Query: 179 TIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTIT--DLITSLDKMIKAIDL 236
                   +      +  +   +        +       +T+T  D  +     I    +
Sbjct: 178 EAHATLASARSSMQKLDGLMTALQGYTRQDVAPMLGKANSTLTRIDNFSQQLDSINVRQI 237

Query: 237 QKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSS 290
               +   N   + +  + S +  +  V +  +  +  + +  + D L++DF +
Sbjct: 238 MTNLETTSNELHALSQQLNSKEGTLGKVINDEKLYEDLRSLLTRTDSLVTDFKA 291


>gi|89901708|ref|YP_524179.1| hypothetical protein Rfer_2937 [Rhodoferax ferrireducens T118]
 gi|89346445|gb|ABD70648.1| Mammalian cell entry related [Rhodoferax ferrireducens T118]
          Length = 162

 Score = 95.0 bits (233), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 22/117 (18%), Positives = 40/117 (34%), Gaps = 1/117 (0%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M+       VGLFV+       F     +            +     ++ GL   +++R 
Sbjct: 1   MQRSKNDVWVGLFVLIGAAAILFLALQAANLLTLSFEKTYQVSAKFDNIGGLKPKAAIRS 60

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTL 117
            G+ VGR+  +  D +    +     +         ++  I T GL G  Y+ L   
Sbjct: 61  AGVVVGRVEKIVFD-DKSFQARVTLALEKQYVFPKDSSLKILTSGLLGEQYLGLEPG 116


>gi|298369698|ref|ZP_06981015.1| mce family protein [Neisseria sp. oral taxon 014 str. F0314]
 gi|298282255|gb|EFI23743.1| mce family protein [Neisseria sp. oral taxon 014 str. F0314]
          Length = 175

 Score = 95.0 bits (233), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 28/120 (23%), Positives = 45/120 (37%), Gaps = 5/120 (4%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSR---SNQYDGPMAEVIIRIPGSVDGLSTDSS 57
           M+       VGLFV+       F  + ++     +   G    V       + GL T++ 
Sbjct: 9   MKKSILEFWVGLFVLLGAVAVGFLAFRVAGGTAISGSSGKSYTVYAEFSD-IGGLKTNAP 67

Query: 58  VRFNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTL 117
           V+  G+ VGR+  + LD +    +     +          +A I T GL G  YI L   
Sbjct: 68  VKSAGVLVGRVASISLDPKTY-QAKVSLNLNSQYKFSSDVSAQILTSGLLGEQYIGLQQG 126


>gi|238758307|ref|ZP_04619485.1| hypothetical protein yaldo0001_1940 [Yersinia aldovae ATCC 35236]
 gi|238703430|gb|EEP95969.1| hypothetical protein yaldo0001_1940 [Yersinia aldovae ATCC 35236]
          Length = 188

 Score = 95.0 bits (233), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 27/133 (20%), Positives = 55/133 (41%), Gaps = 2/133 (1%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M++K     VG+F++  +    F    ++            I     ++ GL T+S V+ 
Sbjct: 1   MQTKKSEVWVGVFILIAILAVVFLCLKVADIKSVGNQPTYRIYANFDNIGGLKTNSPVKI 60

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDT-PLYPSTTATIRTQGLAGITYIELSTLRK 119
            G+ VGR+  + LD +          I+     +  +++  +RT GL G  ++ LS   +
Sbjct: 61  GGVVVGRVAEITLDTKNYTP-RVAMDIQQRYNHIPDTSSLAVRTSGLLGEQFLALSVGFE 119

Query: 120 EKKTIFQIATERN 132
           + +    I  +  
Sbjct: 120 DPEMGTGIVKDGG 132


>gi|188996339|ref|YP_001930590.1| Mammalian cell entry related domain protein [Sulfurihydrogenibium
           sp. YO3AOP1]
 gi|188931406|gb|ACD66036.1| Mammalian cell entry related domain protein [Sulfurihydrogenibium
           sp. YO3AOP1]
          Length = 515

 Score = 95.0 bits (233), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 55/377 (14%), Positives = 133/377 (35%), Gaps = 25/377 (6%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M++      VG+FV+ I   + + I   S            +        GLS  + V+ 
Sbjct: 1   MKTSQ---KVGIFVLLISILTGYLIIKFSGKELGQSFKTYYV--YFDDAQGLSKGADVQV 55

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G+  GR+  +  +        A   I+ + PLY + T +IRT GL G  YI +      
Sbjct: 56  LGVKAGRVEDIAFE---NGKVKALLKIKEEIPLYKNATVSIRTYGLMGDKYIYIDPGSPN 112

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
              + +    +NQ              +++ E    ++  S++   ++++N+ K L    
Sbjct: 113 AGNLAENQVIQNQ------------AKVASTEEMINQVQISAQKFAQLMDNLNKALGDDR 160

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
                       + ++   + +   +    ++ +     I   + S+ + +        N
Sbjct: 161 LKKLIEDFDKFASNTNDVVVENKEDIRQSIANIRQITADIRQQLPSIIQNLDKTLENTKN 220

Query: 241 QILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAF 300
              EN +          D  +       +T  +  +   +I+  +S+       ++    
Sbjct: 221 ITAENREDMRKLIANLKDLSVALKEKAPKTLDSVDKAATQIEQAVSENR-----QDLKLS 275

Query: 301 LENIADSTSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNIS 360
           +ENI  ++ N+   ++ + E      K+++  +   N+   +   ++ F  +      + 
Sbjct: 276 IENIRKASQNLNELLAKVNEGKGTLGKLVNQDDMYNNVNEGIKSFAEPFKVVKESNLEVI 335

Query: 361 ALKENNSLFKDAQRAMH 377
              E ++   D++    
Sbjct: 336 MQGEKHTGNDDSKAGAA 352


>gi|260596177|ref|YP_003208748.1| hypothetical protein CTU_03850 [Cronobacter turicensis z3032]
 gi|260215354|emb|CBA27352.1| Uncharacterized protein yrbD [Cronobacter turicensis z3032]
          Length = 183

 Score = 95.0 bits (233), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 26/120 (21%), Positives = 50/120 (41%), Gaps = 2/120 (1%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M++K +   VG F++  L  + F    ++            +     ++ GL + S VR 
Sbjct: 1   MQTKKFEIWVGAFMLVALLAALFICLKVADVTSLRAEPTYRLYATFDNIGGLKSHSPVRI 60

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDT-PLYPSTTATIRTQGLAGITYIELSTLRK 119
            G+ +GR+  + LD +          I      +  +++  IRT GL G  Y+ L+   +
Sbjct: 61  GGVVIGRVSDITLDPKTY-LPRVAMDIEQRYDHIPDTSSLAIRTSGLLGEQYLALNVGFE 119


>gi|253686688|ref|YP_003015878.1| Mammalian cell entry related domain protein [Pectobacterium
           carotovorum subsp. carotovorum PC1]
 gi|251753266|gb|ACT11342.1| Mammalian cell entry related domain protein [Pectobacterium
           carotovorum subsp. carotovorum PC1]
          Length = 188

 Score = 95.0 bits (233), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 26/133 (19%), Positives = 54/133 (40%), Gaps = 2/133 (1%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M++K     VG+F++  L    F    ++            +     ++ GL   S +R 
Sbjct: 1   MQTKKTEVWVGVFMLIALAAILFLCLKVADLKSIGSEPTYRLYATFDNIGGLKARSPIRI 60

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDT-PLYPSTTATIRTQGLAGITYIELSTLRK 119
            G+ +GR+  + LD++          I+     +  +++  IRT GL G  Y+ L+   +
Sbjct: 61  GGVVIGRVADISLDEKTY-LPRVAMDIQQRYDHIPDTSSLAIRTSGLLGEQYLSLNIGFE 119

Query: 120 EKKTIFQIATERN 132
           ++     I  +  
Sbjct: 120 DEDMGTTILKDGG 132


>gi|270159894|ref|ZP_06188550.1| toluene tolerance protein Ttg2C [Legionella longbeachae D-4968]
 gi|289165352|ref|YP_003455490.1| toluene transporter subunit: membrane component of ABC superfamily
           [Legionella longbeachae NSW150]
 gi|269988233|gb|EEZ94488.1| toluene tolerance protein Ttg2C [Legionella longbeachae D-4968]
 gi|288858525|emb|CBJ12406.1| toluene transporter subunit: membrane component of ABC superfamily
           [Legionella longbeachae NSW150]
          Length = 158

 Score = 95.0 bits (233), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 23/134 (17%), Positives = 50/134 (37%), Gaps = 2/134 (1%)

Query: 2   ESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRFN 61
           + +    SVGLF++  +         +S  + +       +      + GL   + V   
Sbjct: 3   KQRYVDFSVGLFMLLGVLALLVMTMKVSNFSNFMSQDHYQVTAGFTDIGGLKVRAPVTVA 62

Query: 62  GIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLY-PSTTATIRTQGLAGITYIELSTLRKE 120
           G+ +G +  + L      ++     +R D  +    T+A I T+GL G  YI +    ++
Sbjct: 63  GVKIGEVTHIELQP-GELNAKVTMRLRSDKKIPYEDTSARILTEGLLGSNYISIVPGFED 121

Query: 121 KKTIFQIATERNQR 134
           +++           
Sbjct: 122 EESKDHPYLRNGDV 135


>gi|251791364|ref|YP_003006085.1| mammalian cell entry related domain-containing protein [Dickeya
           zeae Ech1591]
 gi|247539985|gb|ACT08606.1| Mammalian cell entry related domain protein [Dickeya zeae Ech1591]
          Length = 214

 Score = 95.0 bits (233), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 26/146 (17%), Positives = 55/146 (37%), Gaps = 2/146 (1%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M++K +   VG+F++  L    F    ++            +     ++ GL   S V+ 
Sbjct: 1   MQTKKHEIGVGVFMLIALCAIVFLCLKVADLKSLGQQQTYRLYATFDNIGGLKARSPVKI 60

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDT-PLYPSTTATIRTQGLAGITYIELSTLRK 119
            G+ +GR+  + LD +          I      +  +++  IRT GL G  Y+ L+   +
Sbjct: 61  GGVVIGRVADISLDTKTY-LPRVAMDIDKRYDHIPDTSSLAIRTSGLLGEQYLALNVGFE 119

Query: 120 EKKTIFQIATERNQRAMITATPSGIN 145
           ++     I  +        +     +
Sbjct: 120 DEDMGTSILKDGGTIQDTKSAMVLED 145


>gi|239814163|ref|YP_002943073.1| hypothetical protein Vapar_1156 [Variovorax paradoxus S110]
 gi|239800740|gb|ACS17807.1| Mammalian cell entry related domain protein [Variovorax paradoxus
           S110]
          Length = 163

 Score = 95.0 bits (233), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 23/117 (19%), Positives = 43/117 (36%), Gaps = 1/117 (0%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M+  N    VGLFV+       F     +     +      +     ++ GL   ++V+ 
Sbjct: 1   MQRSNNDIWVGLFVLIGGAALLFLALQSANLLSLNFQKTYNVTARFDNIGGLKPQTAVKS 60

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTL 117
            G+ VGR+  +  D +    +     ++        ++  I T GL G  YI +   
Sbjct: 61  AGVVVGRVESISFD-DKSFQASVTLALQNRYSFPKDSSLKILTSGLLGEQYIGIEAG 116


>gi|120406149|ref|YP_955978.1| virulence factor Mce family protein [Mycobacterium vanbaalenii
           PYR-1]
 gi|119958967|gb|ABM15972.1| virulence factor Mce family protein [Mycobacterium vanbaalenii
           PYR-1]
          Length = 341

 Score = 95.0 bits (233), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 45/308 (14%), Positives = 101/308 (32%), Gaps = 9/308 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M  K    +VG+F V++L  +   +                          L     VR 
Sbjct: 1   MRDK-TLINVGVFTVAMLLVAAMLVVVFGEFRFASEDKYHAT---FTDASRLKAGQDVRI 56

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G+PVG + GL L+ +          +     LY ST A +R + L G  Y+E+++   +
Sbjct: 57  AGVPVGTVEGLTLNPDNT--VDVAFTVNDRYQLYTSTKAVVRYENLVGDRYLEITSGPGD 114

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
              + +  T  +    +                   KI++ S  + ++++     L+  +
Sbjct: 115 LVKLPKGGTITHTEPALDLDALLGGLKPVVKGLDGAKINEISNAVIELLQGEGGALSAML 174

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
           +N    +  LA     I  +++       + D K       +      + +     +  +
Sbjct: 175 SNTSAFTQNLAARDQLIGDVINNLNTVLGTVDEKGAE---FNASVDQLQKLITGLAEGRD 231

Query: 241 QILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAF 300
            I   I   +      +  +  +   V+   +  +   Q++D    D +  ++    +  
Sbjct: 232 PIAGAIGPLATAENDLTAMLEASRRPVQGVIENVRPFAQRMDERKGDVNKVIEPLAENYL 291

Query: 301 LENIADST 308
             N   + 
Sbjct: 292 RLNALGAY 299


>gi|330432402|gb|AEC17461.1| conserved hypothetical protein [Gallibacterium anatis UMN179]
          Length = 169

 Score = 94.6 bits (232), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 25/121 (20%), Positives = 49/121 (40%), Gaps = 3/121 (2%)

Query: 1   MESKNYY-TSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVR 59
           M++   Y   VGLF++  +    F    ++    +       +     ++ GL   + V+
Sbjct: 1   MKNAMKYEFWVGLFLLLGIAALVFLGLKVANIQNFSESQTYRVEATFDNIGGLKVRAPVK 60

Query: 60  FNGIPVGRIVGLFLDQEYPNHSLAKALIRPDT-PLYPSTTATIRTQGLAGITYIELSTLR 118
             G+ VGR+  + LD           +I      +  +++ +I+T GL G  YI L+   
Sbjct: 61  IGGVVVGRVSKIELDPTTY-LPKVTLVIDQQYNQIPDNSSLSIKTAGLLGEQYIALNIGF 119

Query: 119 K 119
            
Sbjct: 120 D 120


>gi|183597952|ref|ZP_02959445.1| hypothetical protein PROSTU_01301 [Providencia stuartii ATCC 25827]
 gi|188022724|gb|EDU60764.1| hypothetical protein PROSTU_01301 [Providencia stuartii ATCC 25827]
          Length = 169

 Score = 94.6 bits (232), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 26/119 (21%), Positives = 50/119 (42%), Gaps = 2/119 (1%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M+SK     VG F++  +    F    ++            I     ++ GL   S V+ 
Sbjct: 1   MQSKKSEVWVGCFILLAIAAIIFLCLKVADIKSLGSQSTYQISASFENIGGLKEGSPVKV 60

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDT-PLYPSTTATIRTQGLAGITYIELSTLR 118
            G+ +GR+  + L++E       K  +  +   +  +++ +IRT GL G  YI ++   
Sbjct: 61  GGVVIGRVASITLNKETY-VPDVKIDLLSEYNNIPDTSSLSIRTSGLLGEQYIAMNIGP 118


>gi|254489713|ref|ZP_05102909.1| mce related protein [Methylophaga thiooxidans DMS010]
 gi|224465122|gb|EEF81375.1| mce related protein [Methylophaga thiooxydans DMS010]
          Length = 154

 Score = 94.6 bits (232), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 33/135 (24%), Positives = 54/135 (40%), Gaps = 2/135 (1%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M++K+    VG+FV + L   F     +S    +       +     ++ GL   S+V  
Sbjct: 1   MQNKSTEIFVGMFVAAGLAALFMLAMKVSNLGDFTDETGYQVTAEFENIGGLKVRSAVTM 60

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTP-LYPSTTATIRTQGLAGITYIELSTLRK 119
            G+ VGR+  + L     N +     + P    L   T+A+I T GL G  YI L    +
Sbjct: 61  AGVRVGRVASINLHPVTYN-AEVTINMYPQFDNLPLDTSASIYTAGLLGEQYIGLVAGAE 119

Query: 120 EKKTIFQIATERNQR 134
           E+        +  Q 
Sbjct: 120 EEFLQDGDVIDLTQP 134


>gi|323524593|ref|YP_004226746.1| mammalian cell entry related domain-containing protein
           [Burkholderia sp. CCGE1001]
 gi|323381595|gb|ADX53686.1| Mammalian cell entry related domain protein [Burkholderia sp.
           CCGE1001]
          Length = 320

 Score = 94.6 bits (232), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 30/128 (23%), Positives = 61/128 (47%), Gaps = 3/128 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K++    GLF V +L     + +  +             +    +V GL TD++VR+
Sbjct: 1   MENKSHAFWAGLFTVVLLGAIATAAFLFNVDRAV---RVPYDLIARTNVTGLFTDAAVRY 57

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G+ VG++  +  D+++P   + + L+    P+  ST  ++  QG+ GI +I+L    ++
Sbjct: 58  RGLDVGKVQSIKFDRDHPGQIVIRILVDTHAPITHSTFGSLGFQGVTGIAFIQLDDTGRD 117

Query: 121 KKTIFQIA 128
              +    
Sbjct: 118 PSPLASSP 125


>gi|15604561|ref|NP_221079.1| hypothetical protein RP724 [Rickettsia prowazekii str. Madrid E]
 gi|3861256|emb|CAA15155.1| unknown [Rickettsia prowazekii]
 gi|292572368|gb|ADE30283.1| ABC transporter substrate binding protein [Rickettsia prowazekii
           Rp22]
          Length = 149

 Score = 94.6 bits (232), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 26/119 (21%), Positives = 47/119 (39%), Gaps = 3/119 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M+     T +G  V+ I        Y  + ++       +VI     + +G++  S V  
Sbjct: 1   MQQNIVETIIGFLVLIIGLLFLIFAYK-TGTSIITSRGYQVIANF-QNAEGIAVGSDVMI 58

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRK 119
           +GI VG +  + LD +   ++     I  D  +   + A + T GL G  YI +     
Sbjct: 59  SGIKVGSVTQITLDPDRF-YASVYLNINDDVKIPKDSKAQVVTSGLLGGKYIAIIPGNG 116


>gi|332163078|ref|YP_004299655.1| hypothetical protein YE105_C3458 [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|318604042|emb|CBY25540.1| uncharacterized ABC transporter, periplasmic component YrbD
           [Yersinia enterocolitica subsp. palearctica Y11]
 gi|325667308|gb|ADZ43952.1| hypothetical protein YE105_C3458 [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|330862751|emb|CBX72893.1| uncharacterized protein yrbD [Yersinia enterocolitica W22703]
          Length = 186

 Score = 94.6 bits (232), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 25/133 (18%), Positives = 53/133 (39%), Gaps = 2/133 (1%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M++K     VG F++  +    F    ++            I     ++ GL  +S V+ 
Sbjct: 1   MQTKKSEVWVGAFILIAILAVVFLCLKVADIKAVGNQPTYRIYANFDNIGGLKNNSPVKI 60

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDT-PLYPSTTATIRTQGLAGITYIELSTLRK 119
            G+ VGR+  + LD +  +       I+     +  +++  +RT GL G  ++ L+   +
Sbjct: 61  GGVVVGRVAEITLDTKNYSP-RVAMDIQQRYNHIPDTSSLAVRTSGLLGEQFLALNVGFE 119

Query: 120 EKKTIFQIATERN 132
           +      I  +  
Sbjct: 120 DPDMGTGILKDGG 132


>gi|317494032|ref|ZP_07952448.1| hypothetical protein HMPREF0864_03217 [Enterobacteriaceae bacterium
           9_2_54FAA]
 gi|316917805|gb|EFV39148.1| hypothetical protein HMPREF0864_03217 [Enterobacteriaceae bacterium
           9_2_54FAA]
          Length = 179

 Score = 94.6 bits (232), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 25/146 (17%), Positives = 54/146 (36%), Gaps = 2/146 (1%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M++K     VG+F++  L    F    ++            I     ++ GL   S ++ 
Sbjct: 1   MQTKKSEIWVGVFMLIALCAVVFLCLQVANVKSLGNEPTYRIYATFDNIGGLKARSPIKI 60

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDT-PLYPSTTATIRTQGLAGITYIELSTLRK 119
            G+ +GR+  + LD +          I      +  +++  IRT GL G  ++ L+   +
Sbjct: 61  GGVVIGRVADITLDPKTY-LPRVAMDINEQYNNIPDTSSLAIRTSGLLGEQFLALNVGFE 119

Query: 120 EKKTIFQIATERNQRAMITATPSGIN 145
           + +    I  +        +     +
Sbjct: 120 DPEMGTAILKDGGTIQDTKSAMVLED 145


>gi|313672873|ref|YP_004050984.1| mammalian cell entry related domain protein [Calditerrivibrio
           nitroreducens DSM 19672]
 gi|312939629|gb|ADR18821.1| Mammalian cell entry related domain protein [Calditerrivibrio
           nitroreducens DSM 19672]
          Length = 526

 Score = 94.6 bits (232), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 44/345 (12%), Positives = 101/345 (29%), Gaps = 4/345 (1%)

Query: 7   YTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRFNGIPVG 66
              VG FV+  L    +    +   N        +   +  +  GL+TD+ V+F G+ VG
Sbjct: 6   EAKVGFFVIVSLIVLGYMTTKVGDFNFGKDKGYSIKAVL-NNASGLNTDAPVKFKGVNVG 64

Query: 67  RIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKEKKTIFQ 126
           ++  + L+       +A+ LI     +       +R+ G  G  Y EL  L ++      
Sbjct: 65  KVKNISLE---DGKVVAEMLIEDKYKIPAKVRVIVRSSGFLGEKYAELEELPEQTGEYLA 121

Query: 127 IATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTIANIETI 186
             +       +T      N     A++     S     +          +T       T 
Sbjct: 122 AGSIVKDTKDVTDFDQLGNKLGDIADDIKAITSSLRDVLATTEGKENMKVTLDNIRQTTD 181

Query: 187 STVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVNQILENI 246
                   +          +   +   KN      + I  L   +K +      Q  +  
Sbjct: 182 VLKNIMAYNEARINAVIKNIEAITVVVKNMATDNQENINQLLANLKDVSQTLKEQTPQIA 241

Query: 247 QVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAFLENIAD 306
              ++      D V  +  ++ ++ +  + V  K++  + + +S                
Sbjct: 242 GKVNSITGNIDDLVTGSKGNLEDSIKNIKTVTAKLEKTVDNINSITDKINKGEGTIGKLI 301

Query: 307 STSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAE 351
           + +    +++   +        +       N        + +   
Sbjct: 302 NDNQTVDNLNETLKGVRNLFTKMDEFKFYLNFEGEKLMDTGETKG 346


>gi|261819644|ref|YP_003257750.1| hypothetical protein Pecwa_0290 [Pectobacterium wasabiae WPP163]
 gi|261603657|gb|ACX86143.1| Mammalian cell entry related domain protein [Pectobacterium
           wasabiae WPP163]
          Length = 188

 Score = 94.6 bits (232), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 26/133 (19%), Positives = 55/133 (41%), Gaps = 2/133 (1%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M++K     VG+F++  L    F    ++            +     ++ GL   S +R 
Sbjct: 1   MQTKKTEVWVGVFMLIALAGILFLCLKVADLKSIGSEPTYRLYATFDNIGGLKARSPIRI 60

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDT-PLYPSTTATIRTQGLAGITYIELSTLRK 119
            G+ +GR+  + LD++          I+     +  +++  IRT GL G  Y+ L+   +
Sbjct: 61  GGVVIGRVADISLDEKTY-LPRVAMDIQQRYDHIPDTSSLAIRTSGLLGEQYLALNMGFE 119

Query: 120 EKKTIFQIATERN 132
           +++    I  +  
Sbjct: 120 DEEMGTTILKDGG 132


>gi|123443933|ref|YP_001007904.1| hypothetical protein YE3750 [Yersinia enterocolitica subsp.
           enterocolitica 8081]
 gi|122090894|emb|CAL13776.1| putative membrane protein [Yersinia enterocolitica subsp.
           enterocolitica 8081]
          Length = 186

 Score = 94.6 bits (232), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 25/133 (18%), Positives = 53/133 (39%), Gaps = 2/133 (1%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M++K     VG F++  +    F    ++            I     ++ GL  +S V+ 
Sbjct: 1   MQTKKSEVWVGAFILIAILAVVFLCLKVADIKAVGNQPTYRIYANFDNIGGLKNNSPVKI 60

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDT-PLYPSTTATIRTQGLAGITYIELSTLRK 119
            G+ VGR+  + LD +  +       I+     +  +++  +RT GL G  ++ L+   +
Sbjct: 61  GGVVVGRVAEITLDTQNYSP-RVAMDIQQRYNHIPDTSSLAVRTSGLLGEQFLALNVGFE 119

Query: 120 EKKTIFQIATERN 132
           +      I  +  
Sbjct: 120 DPDMGTGILKDGG 132


>gi|160895816|ref|YP_001561398.1| hypothetical protein Daci_0367 [Delftia acidovorans SPH-1]
 gi|160361400|gb|ABX33013.1| Mammalian cell entry related domain protein [Delftia acidovorans
           SPH-1]
          Length = 320

 Score = 94.6 bits (232), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 28/113 (24%), Positives = 58/113 (51%), Gaps = 3/113 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K++  + G+FV+ +         WL+R  +      E  +     + GL   ++VR+
Sbjct: 1   MENKSHAMAAGIFVLVVAALLAGLAIWLTRDTR---QYNEYELSTKDGISGLQAQAAVRY 57

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIE 113
            G+ VG++  +  D +   + L +  I  +TP+ P+T A +  QG+ G+ +++
Sbjct: 58  KGVAVGKVTQIGFDPQTNGNVLIRIAIGVNTPITPTTFAVLGYQGVTGLAHVQ 110



 Score = 42.6 bits (97), Expect = 0.14,   Method: Composition-based stats.
 Identities = 14/200 (7%), Positives = 43/200 (21%), Gaps = 25/200 (12%)

Query: 264 VHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNMRSSISAIREITD 323
              V        +   +    L    S +      +   ++      +    +       
Sbjct: 100 YQGVTGLAHVQLDDADQPQPQLPPGPSGLPRLPLRSSPLSMLADQGQVLLERADEISRRL 159

Query: 324 QRQKIISTINTIENITSNLNDSSQKFAELMSKINNISALKENNSLFKDAQRAMHTFRDTS 383
                      +     N+  ++    +L   ++      +   L  DA   + +    S
Sbjct: 160 SDMLDTDNQKRVSQALENIAAAAAGVQQLTQNLDRTL-STQVPQLAADAHNTLQSLEKAS 218

Query: 384 EKINRYIPSIGNNLQNFSQS------------------------GLNDIQNLVRKLQETV 419
              +     +   ++  +                           +         +    
Sbjct: 219 NGASAVASELQQTVRRVNAQDGPLEQIAQSTRALTRMADSLGRSTVPHANRAADDVSRAA 278

Query: 420 NHFDDCLNNFERNPQDIVWG 439
                  + F  NPQ +++G
Sbjct: 279 RQMGTAASRFSDNPQAVIYG 298


>gi|15606676|ref|NP_214056.1| hypothetical protein aq_1533 [Aquifex aeolicus VF5]
 gi|2983901|gb|AAC07452.1| putative protein [Aquifex aeolicus VF5]
          Length = 300

 Score = 94.6 bits (232), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 29/112 (25%), Positives = 53/112 (47%), Gaps = 2/112 (1%)

Query: 2   ESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRFN 61
           E +  Y  VGLF++  L  + F ++ ++            +I    SV+GL+T ++V + 
Sbjct: 6   EGRVNYILVGLFILLGLGVTLFVLFLMTDI-MEREKFRPYLIYTTQSVEGLNTGAAVYYK 64

Query: 62  GIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIE 113
           G+ VG++  + + +        K LI  D  +     AT+  QG+ G+ YI 
Sbjct: 65  GVQVGKVKEIKIAKNQ-ELIKIKVLIDKDFKVRDGLVATLGVQGITGLAYIN 115


>gi|108797099|ref|YP_637296.1| virulence factor MCE-like protein [Mycobacterium sp. MCS]
 gi|119866184|ref|YP_936136.1| virulence factor Mce family protein [Mycobacterium sp. KMS]
 gi|126432722|ref|YP_001068413.1| virulence factor Mce family protein [Mycobacterium sp. JLS]
 gi|108767518|gb|ABG06240.1| Mammalian cell entry [Mycobacterium sp. MCS]
 gi|119692273|gb|ABL89346.1| virulence factor Mce family protein [Mycobacterium sp. KMS]
 gi|126232522|gb|ABN95922.1| virulence factor Mce family protein [Mycobacterium sp. JLS]
          Length = 343

 Score = 94.2 bits (231), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 45/296 (15%), Positives = 91/296 (30%), Gaps = 9/296 (3%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M+       +G F + +L F+   I    +                 +V GL     VR 
Sbjct: 1   MKITGTALKLGAFSLVLLLFTAIIIVVFGQMR--FDRTTGYSAIFT-NVSGLRPGQFVRA 57

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           +G+ VG++  + L  E  +       +    PL+  +TA++R   L G  Y+EL     +
Sbjct: 58  SGVEVGKVSKIELI-EGGSRVKVDFKVDRSLPLFDESTASVRYLNLIGDRYLELKRGDSD 116

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNA-----ENTSKKISDSSRHIQKIIENIEKP 175
           +K          +        + I  F         E  +          Q     I   
Sbjct: 117 RKMPSGGTIPVERTEPALDLDALIGGFRPLFRALDPEKVNNIARSIITVFQGQGGTINDI 176

Query: 176 LTTTIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAID 235
           L  T +    ++         I  +      T    +  +      + + +  K      
Sbjct: 177 LDQTASLTSALADRDQAIGEVIRNLNTVLDTTVRHQEQFDETLVNFERLITGLKNRADPI 236

Query: 236 LQKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSK 291
              V  I +     ++   ++   + +TV  +  T Q   E   +++ +L    + 
Sbjct: 237 ASSVADISDAAGTVADLLAENRSLLQDTVGYLEATQQPLVEQKGQLNDILVRLPNA 292


>gi|323528334|ref|YP_004230486.1| Mammalian cell entry related domain-containing protein
           [Burkholderia sp. CCGE1001]
 gi|323385336|gb|ADX57426.1| Mammalian cell entry related domain protein [Burkholderia sp.
           CCGE1001]
          Length = 431

 Score = 94.2 bits (231), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 45/427 (10%), Positives = 112/427 (26%), Gaps = 24/427 (5%)

Query: 19  FFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSS-VRFNGIPVGRIVGLFLDQEY 77
             +F    WL     +    A V +    +  G+  D + V   G+ VG +  + L  + 
Sbjct: 27  IAAFAVTGWLG-VRAFVREGATVTVSF-DNAYGMKPDDTIVTLRGVKVGAVSQIALAPDG 84

Query: 78  PNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKEKKTIFQIATERNQRAMI 137
             H  A+  I      Y  +          G  +                A       ++
Sbjct: 85  -QHVQAELRIDRAEKKYLRS----------GTKFFLRGAHVDLSDPASMKAMLSGPEIVM 133

Query: 138 TATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTIANIETISTVLANNISHI 197
                         +            +  ++                +       ++ +
Sbjct: 134 DPGSGEPASHFDGLDRRPALAPGHGPIVTYLVRFDGAVGELKNGAKVQLRGFDVGTVTSV 193

Query: 198 DKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVNQILENIQVSSNNFVKSS 257
                       +        +   ++ +               +   +       +   
Sbjct: 194 RLNYDARTGALSTPVQIALNPSQLGIVGAPPPANGDWRPLVDGMLGRLVSTGLRARLSQD 253

Query: 258 DQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNMRSSISA 317
             VI       +  Q         +  LS   S   +         +A +   ++     
Sbjct: 254 PPVIGADKINLDFVQGAPAATLASEDGLSVIPSAPAA----NLDTTMAKANEVIQKIDDL 309

Query: 318 IREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNISALKENNSLFKDAQRAMH 377
               T ++ + I+      + +  + DS       +++I+          +       + 
Sbjct: 310 PIRQTGEQVRSIAAHINALSSSPQIRDSLTHIDHSVAQIDRTL-----QQVTPQIGPLVT 364

Query: 378 TFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFERNPQDIV 437
             R+T+    R + +    L     S  ND+   +++L +T        +  +R+P+ +V
Sbjct: 365 QLRETASSAERTVAAANRTL-GADASSQNDLPATLQELTDTARSIRALADYLDRHPEALV 423

Query: 438 WGREKGS 444
            GR+K +
Sbjct: 424 EGRQKEA 430


>gi|118616796|ref|YP_905128.1| MCE-family protein Mce1B [Mycobacterium ulcerans Agy99]
 gi|118568906|gb|ABL03657.1| MCE-family protein Mce1B [Mycobacterium ulcerans Agy99]
          Length = 346

 Score = 94.2 bits (231), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 26/128 (20%), Positives = 45/128 (35%), Gaps = 4/128 (3%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M+       +G+F + ++ FS   I    +                 +  GL     VR 
Sbjct: 1   MKITGTAIRLGIFSLVLMLFSVMIIIVFGQIR--FDRTYAYSAEFS-NASGLRPGQFVRA 57

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           +G+ +G++  + L  +          +    PLY ST+A IR   L G  Y+EL     +
Sbjct: 58  SGVEIGKVKSVSLI-DGGKRVRVNFDVDRSVPLYQSTSAQIRYLDLIGNRYLELKRGEGD 116

Query: 121 KKTIFQIA 128
                   
Sbjct: 117 GSDRIMPP 124


>gi|254818329|ref|ZP_05223330.1| virulence factor Mce family protein [Mycobacterium intracellulare
           ATCC 13950]
          Length = 340

 Score = 94.2 bits (231), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 37/289 (12%), Positives = 75/289 (25%), Gaps = 11/289 (3%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M ++        F V +   + F  +   +     G            V  L    SVR 
Sbjct: 1   MRTRATLIKFATFAVVMAVLTAFLFFIFGQYRT--GATTGYSAVF-NDVSRLKPGESVRV 57

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            GI VG +  + L  +     + K     +  L   + A +R   L G  Y+EL      
Sbjct: 58  AGIRVGTVDSVSLRPD--KKVVVKFDADRNVVLTEGSRAAVRYLNLVGDRYLELLDGPGS 115

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKK------ISDSSRHIQKIIENIEK 174
            K +         R         +   +                +   +  Q     IE 
Sbjct: 116 PKRLPAGGQIPVSRTAPALDLDLLLGGLKPVTQGLNPHDVNALTAGLLQVFQGQGGTIES 175

Query: 175 PLTTTIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAI 234
             T T +    ++         ID +              +      + + S     +  
Sbjct: 176 LFTKTTSFSNALADNDQTVQQLIDNLNTVIGTIAKDGKQFSGAIDRLEQLVSGLSNDRDT 235

Query: 235 DLQKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDH 283
               ++ +       ++   ++   +  T+  +            +ID 
Sbjct: 236 IGSAIDALDRGTASLADLLAEARPPLSGTIAQLNRLAPILDNDKDRIDT 284


>gi|254435434|ref|ZP_05048941.1| mce related protein [Nitrosococcus oceani AFC27]
 gi|207088545|gb|EDZ65817.1| mce related protein [Nitrosococcus oceani AFC27]
          Length = 145

 Score = 94.2 bits (231), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 28/108 (25%), Positives = 44/108 (40%), Gaps = 2/108 (1%)

Query: 11  GLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRFNGIPVGRIVG 70
           GLFV + L   F     +S  +         ++    ++ GL   S V   G+ +GR+V 
Sbjct: 2   GLFVAAGLVAFFMLAMRVSNLSLVAQENTYSVVAEFQNIGGLKVRSPVTLAGVTIGRVVS 61

Query: 71  LFLDQEYPN-HSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTL 117
           + +D +            + D  L   T+A+I T GL G  YI L   
Sbjct: 62  IQIDPQTYGAQVRMHIEAQYDY-LPEDTSASIYTSGLLGEQYIALEPG 108


>gi|292490487|ref|YP_003525926.1| ABC transporter periplasmic protein [Nitrosococcus halophilus Nc4]
 gi|291579082|gb|ADE13539.1| Mammalian cell entry related domain protein [Nitrosococcus
           halophilus Nc4]
          Length = 155

 Score = 94.2 bits (231), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 32/119 (26%), Positives = 48/119 (40%), Gaps = 3/119 (2%)

Query: 1   ME-SKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVR 59
           M  S+     VGLFV + L   F     +S  +         +I    ++ GL   S V 
Sbjct: 1   MRQSRTVELVVGLFVAAGLGALFMLAMKVSNLSLVAQEDTYSVIAKFQNIGGLKVRSPVT 60

Query: 60  FNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTP-LYPSTTATIRTQGLAGITYIELSTL 117
             G+ +GR+  + +D +    +  K  I      L   T+A+I T GL G  YI L   
Sbjct: 61  LAGVTIGRVAAIQIDSQTYE-AEVKMRIESRYDYLPEDTSASIYTAGLLGEQYIALEPG 118


>gi|227326639|ref|ZP_03830663.1| hypothetical protein PcarcW_04669 [Pectobacterium carotovorum
           subsp. carotovorum WPP14]
          Length = 188

 Score = 94.2 bits (231), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 27/133 (20%), Positives = 56/133 (42%), Gaps = 2/133 (1%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M++K     VG+F++  L    F    ++            +     ++ GL + S +R 
Sbjct: 1   MQTKKTEVWVGVFMLIALAAILFLCLKVADLKSIGNEPTYRLYATFDNIGGLKSRSPIRI 60

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDT-PLYPSTTATIRTQGLAGITYIELSTLRK 119
            G+ VGR+  + LD++          I+     +  +++  IRT GL G  Y+ L+   +
Sbjct: 61  GGVVVGRVADISLDEKTY-LPRVAMDIQQRYDHIPDTSSLAIRTSGLLGEQYLALNIGFE 119

Query: 120 EKKTIFQIATERN 132
           +++    I  +  
Sbjct: 120 DEEMGTAILKDGG 132


>gi|238789752|ref|ZP_04633534.1| hypothetical protein yfred0001_29020 [Yersinia frederiksenii ATCC
           33641]
 gi|238722111|gb|EEQ13769.1| hypothetical protein yfred0001_29020 [Yersinia frederiksenii ATCC
           33641]
          Length = 185

 Score = 94.2 bits (231), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 25/133 (18%), Positives = 55/133 (41%), Gaps = 2/133 (1%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M++K     VG+F++  +    F    ++            I     ++ GL ++S V+ 
Sbjct: 1   MQTKKSEVWVGVFILIAILAVIFLCLKVADIKSVGNQPTYRIYANFDNIGGLKSNSPVKI 60

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDT-PLYPSTTATIRTQGLAGITYIELSTLRK 119
            G+ VGR+  + LD +  +       I+     +  +++  +RT GL G  ++ L+   +
Sbjct: 61  GGVVVGRVAEITLDTQNYSP-RVAMDIQQRYNHIPDTSSLAVRTSGLLGEQFLALNVGFE 119

Query: 120 EKKTIFQIATERN 132
           +      I  +  
Sbjct: 120 DPDMGTSILKDGG 132


>gi|87200856|ref|YP_498113.1| hypothetical protein Saro_2843 [Novosphingobium aromaticivorans DSM
           12444]
 gi|87136537|gb|ABD27279.1| Mammalian cell entry related protein [Novosphingobium
           aromaticivorans DSM 12444]
          Length = 319

 Score = 94.2 bits (231), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 43/305 (14%), Positives = 97/305 (31%), Gaps = 9/305 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++  +  VGL  + +L  +     W++R NQ  G + E  I    SVDGL+  S V F
Sbjct: 1   METRANHIWVGLVTLLLLAGTALLTVWIARINQ--GDLHEYDIFFKQSVDGLAKGSEVSF 58

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYI-----ELS 115
           +G+P G++  + L +  P     +  +    P+   TTA+++       T       + +
Sbjct: 59  SGVPSGQVKDIELWERDPEFVRVRIAVDKKVPILQGTTASLQGSFTGVSTIQLSGAVKGA 118

Query: 116 TLRKEKKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKP 175
                     + A       + T          +      +  + + R    + +  +K 
Sbjct: 119 PPIDCPDENRRAACPEGVPVIPTKRSGLGEILSNAPLLLERLATLTERLTMVLSDKNQKS 178

Query: 176 LTTTIANIETISTVLANNISHIDKMMHTTQV--TPHSSDSKNTFNTITDLITSLDKMIKA 233
           +   ++N + ++  LA+    + + +   Q      +    +         + L+     
Sbjct: 179 IENILSNTDRLTGNLADASPDVKRTLAELQATLRQANYTLASFEKLTNSADSMLNDEGNG 238

Query: 234 IDLQKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMK 293
           +  Q    +      +       S+           T    +   + +            
Sbjct: 239 LAQQLRKTLKSAQGAADELQGTLSEARPAARQLNERTLPAAEAAIRDLQATTRSLREVTD 298

Query: 294 SKETS 298
                
Sbjct: 299 RLNDQ 303


>gi|78485325|ref|YP_391250.1| hypothetical protein Tcr_0981 [Thiomicrospira crunogena XCL-2]
 gi|78363611|gb|ABB41576.1| ATP-binding cassette (ABC) superfamily transporter, solute-binding
           component [Thiomicrospira crunogena XCL-2]
          Length = 158

 Score = 94.2 bits (231), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 30/124 (24%), Positives = 48/124 (38%), Gaps = 3/124 (2%)

Query: 1   MESKNY-YTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVR 59
           M  +      VG FV+  +         +S            I  +  ++ GL   S V+
Sbjct: 1   MTRRKIIEIWVGAFVLLAMISLIMIALKVSNFQGLQEKPTYQINALFSNIGGLKVRSPVK 60

Query: 60  FNGIPVGRIVGLFLDQEYPNHSLAKALIRPDT-PLYPSTTATIRTQGLAGITYIELSTLR 118
            +G+ VGR+  + +D+     +  K  I  D   L   T+A+I T GL G  YI L    
Sbjct: 61  ISGVVVGRVSDISVDKVTY-QARVKMQIYKDYDELPLDTSASILTSGLLGDQYIGLEPGA 119

Query: 119 KEKK 122
            +  
Sbjct: 120 DDVY 123


>gi|284049031|ref|YP_003399370.1| Mammalian cell entry related domain protein [Acidaminococcus
           fermentans DSM 20731]
 gi|283953252|gb|ADB48055.1| Mammalian cell entry related domain protein [Acidaminococcus
           fermentans DSM 20731]
          Length = 417

 Score = 93.8 bits (230), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 34/301 (11%), Positives = 88/301 (29%), Gaps = 8/301 (2%)

Query: 4   KNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRFNGI 63
           K     VG   +  +      + +L   + + G   ++ +     V+GL   + VRF G+
Sbjct: 2   KADEVKVGAVTLGGIVILALMLTFLGVFS-FAGRTYKLNVMF-DDVNGLKVGNEVRFAGV 59

Query: 64  PVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKEKKT 123
           PVG++  + +D    +       +     +  ++   I   G+ G  ++ ++  +     
Sbjct: 60  PVGKVDDIVVDG---SKVKVVMKMDEKQKIPRNSQFAIGMDGVMGTKFVTIAPPKIATGL 116

Query: 124 IFQIATERNQRA---MITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
           +F+       +    +     S                +       +         T  +
Sbjct: 117 VFKAGETITGQQAGGIDKLMDSSGKVLDKLEVVVDAFSNVFGDKNVQKSMREGFVQTGEV 176

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
           A      T     ++  ++    T V      S +  + +               +    
Sbjct: 177 AKNMNDFTKALATMAQQNQGDIHTMVGQMKEMSIHMNSIMDKADADGATGQNVAAMAANM 236

Query: 241 QILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAF 300
                   ++   +++      T  D++ET +  +    K D +L   +      +    
Sbjct: 237 ADASKKLQNTAAALQNVVTDPQTQQDLKETIRHAKSTSVKADKILGVVTDAQVQADVLYN 296

Query: 301 L 301
            
Sbjct: 297 D 297


>gi|91205183|ref|YP_537538.1| ABC transporter substrate binding protein [Rickettsia bellii
           RML369-C]
 gi|91068727|gb|ABE04449.1| ABC transporter substrate binding protein [Rickettsia bellii
           RML369-C]
          Length = 149

 Score = 93.8 bits (230), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 27/122 (22%), Positives = 49/122 (40%), Gaps = 3/122 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M+     T +G F V I+ F F    + + S+  +    ++      S +G+S  S V  
Sbjct: 1   MKQNIIETIIG-FAVLIIAFLFLIFAYKTGSSMTNAKGYQLTASF-QSAEGISVGSDVMI 58

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           +GI +G +  +FLD      +     +  +  +   + A + T GL G  YI +      
Sbjct: 59  SGIKIGNVKKIFLDPTSY-FATVYLNVNENVKIPKDSKAQVVTSGLLGGKYIAIVPGNDN 117

Query: 121 KK 122
             
Sbjct: 118 DY 119


>gi|118475119|ref|YP_891670.1| putative ABC transport system periplasmic substrate-binding protein
           [Campylobacter fetus subsp. fetus 82-40]
 gi|28974223|gb|AAO64224.1| putative ABC transport system periplasmic substrate-binding protein
           Cf0018 [Campylobacter fetus]
 gi|118414345|gb|ABK82765.1| putative ABC transport system periplasmic substrate-binding protein
           [Campylobacter fetus subsp. fetus 82-40]
          Length = 304

 Score = 93.8 bits (230), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 44/303 (14%), Positives = 94/303 (31%), Gaps = 1/303 (0%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+KN Y   GLF   +L    F + +++     +G      I      +G+  DS VRF
Sbjct: 1   MENKNSYFIAGLFFCIVLAMLTFFVLYMNIKGN-EGETRYYYIETKELPNGIKNDSQVRF 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G+P G +  ++           K  ++ D P+   + A +  QG++GI YI +S     
Sbjct: 60  IGVPAGIVKDIYFSDPKSATIEIKMSLKKDLPIKRDSVAVVEVQGISGIAYINISKGSDS 119

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
            +          +         G +     +   +           + + N+   + +  
Sbjct: 120 AEVFSPNDKPSIKMGQGLLAKIGDSAINLGSRIDASLSKIDRALSDENLNNLSNSIASLN 179

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
             +  ++ V     S+    +    V   +  S   F  +         + K       +
Sbjct: 180 TILSNLAKVSNEQNSNNINKLLENSVAISNRVSAIKFEELNKNAADFLNIAKKSAKSFED 239

Query: 241 QILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAF 300
                +   S+        +  T+    +T      +  ++ + L               
Sbjct: 240 TQTLLMSKLSSGEYDFKSFLTPTLSATNDTLLQLDSLIMELKNTLFRLEDNPYEFFFKDT 299

Query: 301 LEN 303
             +
Sbjct: 300 SGD 302


>gi|325983136|ref|YP_004295538.1| Mammalian cell entry related domain-containing protein
           [Nitrosomonas sp. AL212]
 gi|325532655|gb|ADZ27376.1| Mammalian cell entry related domain protein [Nitrosomonas sp.
           AL212]
          Length = 155

 Score = 93.8 bits (230), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 29/117 (24%), Positives = 45/117 (38%), Gaps = 1/117 (0%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M+       VGLFVV  +         +   N Y+   + VI     ++ GL   + V+ 
Sbjct: 1   MQRTTMDLWVGLFVVMGIIALMILSLKVGNLNVYNPSQSYVITGNFENIGGLKIRAPVKS 60

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTL 117
            G+ VGR+  +    E  +       +         T A+I T GL G  YI L+  
Sbjct: 61  AGVVVGRVTNIQFSTETYDAV-VTMSMDARFQFPKDTFASILTSGLLGEQYIGLAAG 116


>gi|242310200|ref|ZP_04809355.1| conserved hypothetical protein [Helicobacter pullorum MIT 98-5489]
 gi|239523497|gb|EEQ63363.1| conserved hypothetical protein [Helicobacter pullorum MIT 98-5489]
          Length = 265

 Score = 93.8 bits (230), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 27/166 (16%), Positives = 57/166 (34%), Gaps = 3/166 (1%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++  Y  +G F V +L      I W+ + ++      E  I       G+  ++ V++
Sbjct: 1   MEARLNYVLLGSFFVIVLLALAGFILWMGKYDRNLSEYREYYIYNKELPAGIRIETPVKY 60

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G+PVG +    L  +          ++ +  L   +   +  QG+ G  +  L      
Sbjct: 61  LGLPVGFVKQYELSGD---KVEIIIWVKKEIVLNEGSKVVVERQGITGGGFFALIQGEGA 117

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQ 166
                Q A    +   I    +     +   E + ++ +       
Sbjct: 118 PFGDSQKAILGFKENWIEQVGTKAEKVMGQLEVSLERFNRLLSEQN 163


>gi|183980444|ref|YP_001848735.1| MCE-family protein Mce1B [Mycobacterium marinum M]
 gi|183173770|gb|ACC38880.1| MCE-family protein Mce1B [Mycobacterium marinum M]
          Length = 346

 Score = 93.8 bits (230), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 26/128 (20%), Positives = 45/128 (35%), Gaps = 4/128 (3%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M+       +G+F + ++ FS   I    +                 +  GL     VR 
Sbjct: 1   MKITGTAIRLGIFSLVLMLFSVMIIIVFGQIR--FDRTYAYSAEFS-NASGLRPGQFVRA 57

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           +G+ +G++  + L  +          +    PLY ST+A IR   L G  Y+EL     +
Sbjct: 58  SGVEIGKVKSVSLI-DGGKRVRVNFDVDRSVPLYQSTSAQIRYLDLIGNRYLELKRGEGD 116

Query: 121 KKTIFQIA 128
                   
Sbjct: 117 GSDRIMPP 124


>gi|85860997|ref|YP_463199.1| paraquat-inducible protein B [Syntrophus aciditrophicus SB]
 gi|85724088|gb|ABC79031.1| paraquat-inducible protein B [Syntrophus aciditrophicus SB]
          Length = 328

 Score = 93.8 bits (230), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 21/94 (22%), Positives = 40/94 (42%), Gaps = 4/94 (4%)

Query: 1  MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
          M  K   T +G FVV  +     ++  L  S ++     + ++   GSV GL+  S V F
Sbjct: 1  MSGKENKTLIGAFVVGAIAILVLAVLVLG-SGKFLSRSQKYVLFFDGSVKGLNVGSPVTF 59

Query: 61 NGIPVGRIVGLFLDQEYPNHSL---AKALIRPDT 91
           G+ +G +  + +  +    +L       + P+ 
Sbjct: 60 RGVKIGEVTDISVVIDQKQRALRIPVLIRLDPEL 93



 Score = 57.6 bits (136), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 23/203 (11%), Positives = 68/203 (33%), Gaps = 4/203 (1%)

Query: 240 NQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSA 299
              +    + + +F  ++      +        T     Q++   +     +      ++
Sbjct: 122 QNFVTGQLMVALDFFPNAPPRYVGMKKQYAEIPTIPTALQELQRTVEHLPLREIVVSLNS 181

Query: 300 FLENIADSTSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNI 359
            ++ I    +++ +  +        +       +  E I   +   SQ        +  +
Sbjct: 182 AVQGIDRIVNSVDTRKTTQTLEAALKDIQTLVRHIDERIEPLVAGLSQTSGAAEETL--V 239

Query: 360 SALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSG--LNDIQNLVRKLQE 417
            + +   S+ KD +  + + + T E     +      LQ +S     + ++   +R+L  
Sbjct: 240 ESKETAASVRKDMKELVASTKTTLESAQAVLKQSEQTLQAYSGDSPLVVEMNKTLRELGA 299

Query: 418 TVNHFDDCLNNFERNPQDIVWGR 440
           T        +  ER+P+ ++ G+
Sbjct: 300 TSRSLRHLSDYLERHPESLLRGK 322


>gi|152996433|ref|YP_001341268.1| hypothetical protein Mmwyl1_2411 [Marinomonas sp. MWYL1]
 gi|150837357|gb|ABR71333.1| Mammalian cell entry related domain protein [Marinomonas sp. MWYL1]
          Length = 154

 Score = 93.8 bits (230), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 23/123 (18%), Positives = 47/123 (38%), Gaps = 2/123 (1%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M SK     VG F++  +    +    +S            ++     + GL+  + V  
Sbjct: 1   MRSKRSELLVGCFIILGVVALVYLAVQVSGLAFSSKKDTYQVVARFDDIAGLTNRAKVSI 60

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDT-PLYPSTTATIRTQGLAGITYIELSTLRK 119
            G+ VG +  +  D++    +L    I  D   +   ++  + T GL G  Y+ +S    
Sbjct: 61  AGVAVGNVESITFDKKLY-MALVTMNIDSDVNNIPTDSSIAVLTSGLLGEKYLGISIGAD 119

Query: 120 EKK 122
           ++ 
Sbjct: 120 DEM 122


>gi|282898550|ref|ZP_06306538.1| conserved hypothetical protein [Cylindrospermopsis raciborskii
           CS-505]
 gi|281196418|gb|EFA71327.1| conserved hypothetical protein [Cylindrospermopsis raciborskii
           CS-505]
          Length = 470

 Score = 93.8 bits (230), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 52/442 (11%), Positives = 128/442 (28%), Gaps = 31/442 (7%)

Query: 10  VGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRFNGIPVGRIV 69
           VGL  +  L        WL+R         +VI+       G+     VR+ G+ VG I 
Sbjct: 15  VGLIFLIGLGAFGVIFLWLNRVTP-GRSSYQVIVEF-ADAGGMQKGDPVRYRGVKVGSIA 72

Query: 70  GLFLDQEYPNHSLAKALI-RPDTPLYPSTTATIRTQGLAGITYIELSTLRKEKKTIFQIA 128
            +      PN    +  I  P+  +   +       GL   + ++++ L     T+    
Sbjct: 73  RMT---TKPNAVEVELEINDPNLLIPADSRIEANQSGLISESIVDITPLGD--VTLDPNT 127

Query: 129 TERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTIANIETIST 188
            +   +                 +  +       +          +     I  +   ST
Sbjct: 128 AKPLDKDCNPGLIICHQSGKLRGQIGTSVDRLIRQSSDFADRYGNQQFYDNINRLLITST 187

Query: 189 VLANNISHIDKMMHTTQVTPH-----SSDSKNTFNTITDLITSLDKMIKAIDLQKVNQIL 243
             A +I+ + + +     +        SD+  T    T+ +T+  K   A          
Sbjct: 188 DAAASIAKLSRELQIASRSFQGEVGKFSDTAVTIQRATNELTATTKQTAAQINTTAGDFS 247

Query: 244 ENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAFLEN 303
              + +        D +      +  T     E   K+   ++  S  +        L+N
Sbjct: 248 TAAKQAGKLINNLDDLLTTNRSALVSTLNNINETSNKLRQTVNALSPAVTRLTQGDILKN 307

Query: 304 IADSTSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNISALK 363
           +   ++N   +  ++++ +       + I  ++        + +   ++ S ++ ++   
Sbjct: 308 LEILSANAAEASISLKDASKTLADPKN-IVLLQQTLDAARVTFENTQKITSDLDELTGDP 366

Query: 364 ENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFD 423
           +           ++    ++  +                  L+ I+  + + Q       
Sbjct: 367 KFRQNLLQLVNGLNKLLSSTGDMQEQTK---------VALTLDSIKLSINQGQSKSETTS 417

Query: 424 DC--------LNNFERNPQDIV 437
           D             E+    +V
Sbjct: 418 DLGVSNHGVEAEKLEKQENRVV 439


>gi|238019667|ref|ZP_04600093.1| hypothetical protein VEIDISOL_01541 [Veillonella dispar ATCC 17748]
 gi|237863708|gb|EEP64998.1| hypothetical protein VEIDISOL_01541 [Veillonella dispar ATCC 17748]
          Length = 419

 Score = 93.5 bits (229), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 37/345 (10%), Positives = 99/345 (28%), Gaps = 5/345 (1%)

Query: 5   NYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRFNGIP 64
                VG F +  +      I ++ R + +  P   +       V+GL   + V+++G+ 
Sbjct: 4   TTEAKVGAFTIIGIALFIAGILFVGRIDIWAKPQMTITGDFAQ-VNGLKNGNQVKYSGVA 62

Query: 65  VGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKEKKTI 124
           +G +  + +        + K  +   T +   +T T+ + G  G  +I++S  + +    
Sbjct: 63  IGNVSDIEITPHG---VVVKMKLDEKTQIPSDSTFTLGSDGFLGDKFIQISPGQSKVFLK 119

Query: 125 FQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTIANIE 184
              + +      +          +   E   + I++                +T      
Sbjct: 120 DGDSVKGEGADAMDKAMQSAQKLMDGTEKMLQSINNIIGDPATQNALKHSLQSTATMADN 179

Query: 185 TISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVNQILE 244
            ++                 Q     +   +    +T+L  + D++       +      
Sbjct: 180 AVAITQNMADVTAQLNQAAQQFNADGNAGNDMRAILTNLKQTTDRVDNMARSMESTVTDP 239

Query: 245 N-IQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAFLEN 303
              +        ++         +          G  +D    +  S  K + +   L N
Sbjct: 240 KAQENIKETLHNTAQISARINKLMGGKAYQTDASGNVVDGNNVEKKSSTKVEPSVDLLYN 299

Query: 304 IADSTSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQK 348
             D    +   + A  +       + +  +  +   +     S K
Sbjct: 300 TTDDEFRINGRVRAYNDKGMAELGLSNIGDGTKFDLNAGRFISSK 344


>gi|37523684|ref|NP_927061.1| hypothetical protein glr4115 [Gloeobacter violaceus PCC 7421]
 gi|35214689|dbj|BAC92056.1| glr4115 [Gloeobacter violaceus PCC 7421]
          Length = 380

 Score = 93.5 bits (229), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 45/420 (10%), Positives = 118/420 (28%), Gaps = 43/420 (10%)

Query: 1   MESKN-YYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVR 59
           M  +      VGL ++  +        WLS    +        I      +GL+  + VR
Sbjct: 1   MNRRGIREGLVGLLILVGVGIFVGLYLWLSG--GFRQGGYRFTITF-RDANGLNVGAPVR 57

Query: 60  FNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRK 119
             G+ VG++    +       +      RPD  +   +   +   GL G T++E+     
Sbjct: 58  LRGVRVGQVQA-TIPGISSVKADVLID-RPDVFIPKDSQFVVSQSGLIGETFVEIFPSDT 115

Query: 120 EKKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTT 179
                       N+R   +     +    S+    +             +          
Sbjct: 116 AVVPPNTTVETLNERCEKSVASEPLVCPQSSVIGRTPPRFQELVRSLDALATRLDQ---- 171

Query: 180 IANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKV 239
                             D +  T      ++D+ ++ +                  ++V
Sbjct: 172 ---------------DFFDSLQTTVVKFGQTADNLSSLSRTAAKDFDALAETARAASREV 216

Query: 240 NQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSA 299
                  Q      +     +++    + +T         ++  L    S  +  +    
Sbjct: 217 PAFGRAAQALEKTLLDVDIILLDNRASLSQTLANLNRASAEVSQLTGQLSGSITPERLDQ 276

Query: 300 FLENIADSTSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNI 359
            + N  ++ +N+RS   AI +           + ++ +   +   +     ++ + ++ +
Sbjct: 277 IVSNTNEAVANLRSLSVAISDPAT--------VASLRSTLDSARATLDNIKKITTDLDEL 328

Query: 360 SALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETV 419
           +   +               R   + +   + S   +    S     D ++ +  + +T 
Sbjct: 329 TGDPQFR----------TNLRRLIDGLGNLVSSEPGDPNGSSVFANADYRDGLAGVADTA 378


>gi|327540667|gb|EGF27239.1| protein containing Mammalian cell entry related domain
           [Rhodopirellula baltica WH47]
          Length = 510

 Score = 93.5 bits (229), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 42/430 (9%), Positives = 116/430 (26%), Gaps = 29/430 (6%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M+       VG+ V++ +  +    +              + +  P S DG++ ++ V  
Sbjct: 1   MDDSRLRFGVGVLVIAAIGIAVILTFLFGAFPAILNREYTLNVYFP-SADGININAPVYR 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           +G+ +GR+  ++L +E          +     +       I    L              
Sbjct: 60  DGVKIGRVDDIWLQEE--GGVRLILSMDESVSMTHQYIPQIGIGSLITGDSKLEFRKADR 117

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
           ++ +       +            +Y     E+    I      +     ++        
Sbjct: 118 RELVGLFDDNPDLIEQPYTDGELFDYG-KKLEDPFSLIFGMEDELVSTFRSVRGAGDAIQ 176

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
                I  ++ +    I            ++   +    +     S+           + 
Sbjct: 177 DIGSDIKGLVRDVRGVIG--------LSPTAPVSSPSVPMGGFPQSMAPAPAWARPIVLA 228

Query: 241 QILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAF 300
             L     +S   ++             +      +         +   + + ++     
Sbjct: 229 SHLSPQDGASKGVIQQVAMQQTLPQQGMQQPTLPPQGFTPPQGFGTQLGTPLPAQPGMQT 288

Query: 301 LENIADSTSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNIS 360
              I     +   ++     +    + II       N++  ++       E+   +    
Sbjct: 289 PPTITQLAGDASQAVKEFSFLVRDIRSIIGDPQIQRNVSDTVDRLPGVLDEVKVTLE--- 345

Query: 361 ALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVN 420
                     DA+    TFR+    +      +G   ++      N++Q+ +R ++ T  
Sbjct: 346 ----------DARETFETFRE----VGGQFEQVGIVAEDAVSQTANELQSTLRSVRSTAK 391

Query: 421 HFDDCLNNFE 430
            F+    N E
Sbjct: 392 SFEGTAENIE 401


>gi|51597809|ref|YP_072000.1| hypothetical protein YPTB3517 [Yersinia pseudotuberculosis IP
           32953]
 gi|153948335|ref|YP_001399443.1| mce family protein [Yersinia pseudotuberculosis IP 31758]
 gi|170022765|ref|YP_001719270.1| hypothetical protein YPK_0514 [Yersinia pseudotuberculosis YPIII]
 gi|51591091|emb|CAH22755.1| Conserved putative membrane protein [Yersinia pseudotuberculosis IP
           32953]
 gi|152959830|gb|ABS47291.1| mce family protein [Yersinia pseudotuberculosis IP 31758]
 gi|169749299|gb|ACA66817.1| Mammalian cell entry related domain protein [Yersinia
           pseudotuberculosis YPIII]
          Length = 185

 Score = 93.5 bits (229), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 25/136 (18%), Positives = 53/136 (38%), Gaps = 2/136 (1%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M++K     VG+F++  +    F    ++            I     ++ GL   S V+ 
Sbjct: 1   MQTKKSEVWVGMFILIAILAVVFLCLKVADIKSVGNQPTYRIYANFDNIGGLKNHSPVKI 60

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDT-PLYPSTTATIRTQGLAGITYIELSTLRK 119
            G+ VGR+  + LD +          I+     +  +++  +RT GL G  ++ L+   +
Sbjct: 61  GGVVVGRVAEITLDTKNYTP-RVAIDIQQRYNHIPDTSSLAVRTSGLLGEQFLALNVGFE 119

Query: 120 EKKTIFQIATERNQRA 135
           + +    I  +     
Sbjct: 120 DPEMGTSILKDGGTIQ 135


>gi|91786697|ref|YP_547649.1| hypothetical protein Bpro_0795 [Polaromonas sp. JS666]
 gi|91695922|gb|ABE42751.1| Mammalian cell entry related protein [Polaromonas sp. JS666]
          Length = 168

 Score = 93.5 bits (229), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 22/117 (18%), Positives = 41/117 (35%), Gaps = 1/117 (0%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M+       VGLFV+       F     +         +  +     ++ GL   ++V+ 
Sbjct: 1   MQRSKNDVWVGLFVLIGGAAMLFLALKSANLLTLSFDTSYRVTAKFDNIGGLKPRAAVKS 60

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTL 117
            G+ VGR+  +  D +    +     +         ++  I T GL G  YI +   
Sbjct: 61  AGVVVGRVENITFD-DKSYQASVHLAMESRYAFPKDSSLKILTSGLLGEQYIGVEAG 116


>gi|329120838|ref|ZP_08249498.1| ABC superfamily ATP binding cassette transporter, binding protein
           [Neisseria bacilliformis ATCC BAA-1200]
 gi|327459710|gb|EGF06051.1| ABC superfamily ATP binding cassette transporter, binding protein
           [Neisseria bacilliformis ATCC BAA-1200]
          Length = 166

 Score = 93.5 bits (229), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 26/132 (19%), Positives = 45/132 (34%), Gaps = 5/132 (3%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYD---GPMAEVIIRIPGSVDGLSTDSS 57
           M+       VGLFV++      F    ++    +         V       + GL T + 
Sbjct: 1   MKRNILEFWVGLFVLAGAAALGFLSLRVAGGGGFGGGASQGYTVYAEFSD-IGGLKTQAP 59

Query: 58  VRFNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTL 117
           ++ +G+ VGR+  + LD +    +     +          +A I T GL G  YI L   
Sbjct: 60  IKASGVLVGRVQSITLDPQTYR-AKVALQLDKQYQFSSDVSAQILTSGLLGEQYIGLMQG 118

Query: 118 RKEKKTIFQIAT 129
              +        
Sbjct: 119 GDPENLAPGDTI 130


>gi|32474657|ref|NP_867651.1| hypothetical protein RB7131 [Rhodopirellula baltica SH 1]
 gi|32445196|emb|CAD75198.1| hypothetical protein RB7131 [Rhodopirellula baltica SH 1]
          Length = 510

 Score = 93.5 bits (229), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 41/430 (9%), Positives = 115/430 (26%), Gaps = 29/430 (6%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M+       VG+ V++ +  +    +              + +  P S DG++ ++ V  
Sbjct: 1   MDDSRLRFGVGVLVIAAIGIAVILTFLFGAFPAILNREYTLNVYFP-SADGININAPVYR 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           +G+ +GR+  ++L +E          +     +       I    L              
Sbjct: 60  DGVKIGRVDDIWLQEE--GGVRLILSMDESVSMTHQYIPQIGIGSLITGDSKLEFRKADR 117

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
           ++ +       +            +Y     E+    I      +     ++        
Sbjct: 118 RELVGLFDDNPDLIEQPYTDGELFDYG-KKLEDPFSLIFGMEDELVSTFRSVRGAGDAIQ 176

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
                I  ++ +    I            ++   +    +     S+           + 
Sbjct: 177 DIGSDIKGLVRDVRGVIG--------LSPTAPVSSPSVPMGGFPQSMAPAPAWARPIVLA 228

Query: 241 QILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAF 300
                   +S   ++             +      +         +   + + ++     
Sbjct: 229 SHSSRQDGASKGVIQQVAMQQTLPQQGMQQPTLPPQGFTPPQGFGTQLGTPLPAQPGMQT 288

Query: 301 LENIADSTSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNIS 360
              I     +   ++     +    + II       N++  ++       E+   +    
Sbjct: 289 PPTITQLAGDASQAVKEFSFLVRDIRSIIGDPQIQRNVSDTVDRLPGVLDEVKVTLE--- 345

Query: 361 ALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVN 420
                     DA+    TFR+    +      +G   ++      N++Q+ +R ++ T  
Sbjct: 346 ----------DARETFETFRE----VGGQFEQVGIVAEDAVSQTANELQSTLRSVRSTAK 391

Query: 421 HFDDCLNNFE 430
            F+    N E
Sbjct: 392 SFEGTAENIE 401


>gi|108809721|ref|YP_653637.1| hypothetical protein YPA_3730 [Yersinia pestis Antiqua]
 gi|108813615|ref|YP_649382.1| hypothetical protein YPN_3455 [Yersinia pestis Nepal516]
 gi|145597640|ref|YP_001161716.1| hypothetical protein YPDSF_0324 [Yersinia pestis Pestoides F]
 gi|153997348|ref|ZP_02022448.1| putative membrane protein [Yersinia pestis CA88-4125]
 gi|162420534|ref|YP_001605690.1| hypothetical protein YpAngola_A1144 [Yersinia pestis Angola]
 gi|165928106|ref|ZP_02223938.1| mce family protein [Yersinia pestis biovar Orientalis str.
           F1991016]
 gi|165937492|ref|ZP_02226055.1| mce family protein [Yersinia pestis biovar Orientalis str. IP275]
 gi|166011288|ref|ZP_02232186.1| mce family protein [Yersinia pestis biovar Antiqua str. E1979001]
 gi|166211980|ref|ZP_02238015.1| mce family protein [Yersinia pestis biovar Antiqua str. B42003004]
 gi|167400514|ref|ZP_02306023.1| mce family protein [Yersinia pestis biovar Antiqua str. UG05-0454]
 gi|167420732|ref|ZP_02312485.1| mce family protein [Yersinia pestis biovar Orientalis str.
           MG05-1020]
 gi|167426980|ref|ZP_02318733.1| mce family protein [Yersinia pestis biovar Mediaevalis str.
           K1973002]
 gi|167470183|ref|ZP_02334887.1| mce family protein [Yersinia pestis FV-1]
 gi|218930585|ref|YP_002348460.1| hypothetical protein YPO3573 [Yersinia pestis CO92]
 gi|229836871|ref|ZP_04457036.1| predicted ABC-type organic solvent transporter [Yersinia pestis
           Pestoides A]
 gi|229839229|ref|ZP_04459388.1| predicted ABC-type organic solvent transporter [Yersinia pestis
           biovar Orientalis str. PEXU2]
 gi|229899794|ref|ZP_04514935.1| predicted ABC-type organic solvent transporter [Yersinia pestis
           biovar Orientalis str. India 195]
 gi|229904109|ref|ZP_04519220.1| predicted ABC-type organic solvent transporter [Yersinia pestis
           Nepal516]
 gi|270488544|ref|ZP_06205618.1| Mce family protein [Yersinia pestis KIM D27]
 gi|294505305|ref|YP_003569367.1| hypothetical protein YPZ3_3196 [Yersinia pestis Z176003]
 gi|108777263|gb|ABG19782.1| membrane protein [Yersinia pestis Nepal516]
 gi|108781634|gb|ABG15692.1| putative membrane protein [Yersinia pestis Antiqua]
 gi|115349196|emb|CAL22161.1| putative membrane protein [Yersinia pestis CO92]
 gi|145209336|gb|ABP38743.1| membrane protein [Yersinia pestis Pestoides F]
 gi|149288985|gb|EDM39065.1| putative membrane protein [Yersinia pestis CA88-4125]
 gi|162353349|gb|ABX87297.1| mce family protein [Yersinia pestis Angola]
 gi|165914597|gb|EDR33211.1| mce family protein [Yersinia pestis biovar Orientalis str. IP275]
 gi|165919880|gb|EDR37181.1| mce family protein [Yersinia pestis biovar Orientalis str.
           F1991016]
 gi|165989672|gb|EDR41973.1| mce family protein [Yersinia pestis biovar Antiqua str. E1979001]
 gi|166206726|gb|EDR51206.1| mce family protein [Yersinia pestis biovar Antiqua str. B42003004]
 gi|166961538|gb|EDR57559.1| mce family protein [Yersinia pestis biovar Orientalis str.
           MG05-1020]
 gi|167049882|gb|EDR61290.1| mce family protein [Yersinia pestis biovar Antiqua str. UG05-0454]
 gi|167054020|gb|EDR63848.1| mce family protein [Yersinia pestis biovar Mediaevalis str.
           K1973002]
 gi|229678227|gb|EEO74332.1| predicted ABC-type organic solvent transporter [Yersinia pestis
           Nepal516]
 gi|229687286|gb|EEO79361.1| predicted ABC-type organic solvent transporter [Yersinia pestis
           biovar Orientalis str. India 195]
 gi|229695595|gb|EEO85642.1| predicted ABC-type organic solvent transporter [Yersinia pestis
           biovar Orientalis str. PEXU2]
 gi|229705814|gb|EEO91823.1| predicted ABC-type organic solvent transporter [Yersinia pestis
           Pestoides A]
 gi|262363368|gb|ACY60089.1| hypothetical protein YPD4_3185 [Yersinia pestis D106004]
 gi|262367254|gb|ACY63811.1| hypothetical protein YPD8_3141 [Yersinia pestis D182038]
 gi|270337048|gb|EFA47825.1| Mce family protein [Yersinia pestis KIM D27]
 gi|294355764|gb|ADE66105.1| hypothetical protein YPZ3_3196 [Yersinia pestis Z176003]
 gi|320017115|gb|ADW00687.1| putative ABC-type organic solvent transporter [Yersinia pestis
           biovar Medievalis str. Harbin 35]
          Length = 185

 Score = 93.5 bits (229), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 25/136 (18%), Positives = 53/136 (38%), Gaps = 2/136 (1%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M++K     VG+F++  +    F    ++            I     ++ GL   S V+ 
Sbjct: 1   MQTKKSEVWVGMFILIAILAVIFLCLKVADIKSVGNQPTYRIYANFDNIGGLKNHSPVKI 60

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDT-PLYPSTTATIRTQGLAGITYIELSTLRK 119
            G+ VGR+  + LD +          I+     +  +++  +RT GL G  ++ L+   +
Sbjct: 61  GGVVVGRVAEITLDTKNYTP-RVAIDIQQRYNHIPDTSSLAVRTSGLLGEQFLALNVGFE 119

Query: 120 EKKTIFQIATERNQRA 135
           + +    I  +     
Sbjct: 120 DPEMGTSILKDGGTIQ 135


>gi|223040189|ref|ZP_03610468.1| mce related protein [Campylobacter rectus RM3267]
 gi|222878550|gb|EEF13652.1| mce related protein [Campylobacter rectus RM3267]
          Length = 310

 Score = 93.5 bits (229), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 30/117 (25%), Positives = 52/117 (44%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M +K  YT +GLF V ++     + +WL    +         I+      G+  DS+V+F
Sbjct: 1   MGNKINYTLIGLFFVLVVSALGIAAWWLGGYGKKADDYRSYFIKTTSLPSGIKKDSTVKF 60

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTL 117
            G+  G +  +    E       +  +R D P+   +TA+   QG+ GI Y+ +S  
Sbjct: 61  IGVDAGSVKDIRFADEKEALIELELSVRKDIPIRTDSTASAEIQGITGIGYLNISRG 117


>gi|238796192|ref|ZP_04639702.1| hypothetical protein ymoll0001_34480 [Yersinia mollaretii ATCC
           43969]
 gi|238719885|gb|EEQ11691.1| hypothetical protein ymoll0001_34480 [Yersinia mollaretii ATCC
           43969]
          Length = 207

 Score = 93.5 bits (229), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 26/133 (19%), Positives = 54/133 (40%), Gaps = 2/133 (1%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M++K     VG F++  +    F    ++            I     ++ GL T+S V+ 
Sbjct: 1   MQTKRSEVWVGAFILIAILAVIFLCLQVADIKSVGNQPTYRIYANFDNIGGLKTNSPVKI 60

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDT-PLYPSTTATIRTQGLAGITYIELSTLRK 119
            G+ VGR+  + LD +  +       I+     +  +++  +RT GL G  ++ L+   +
Sbjct: 61  GGVVVGRVAYITLDTQNYSP-RVAIDIQQRYNHIPDTSSLAVRTSGLLGEQFLALNVGFE 119

Query: 120 EKKTIFQIATERN 132
           +      I  +  
Sbjct: 120 DPDMGTSILKDGG 132


>gi|116749876|ref|YP_846563.1| hypothetical protein Sfum_2448 [Syntrophobacter fumaroxidans MPOB]
 gi|116698940|gb|ABK18128.1| Mammalian cell entry related domain protein [Syntrophobacter
           fumaroxidans MPOB]
          Length = 333

 Score = 93.5 bits (229), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 27/133 (20%), Positives = 51/133 (38%), Gaps = 1/133 (0%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M+       VGL ++         I+ +S           + +  P   DG++  S V +
Sbjct: 1   MQVFRSEIRVGLLILVSFVVLMAGIFAVSDLRSLWYKKKTIELLFPY-ADGITKGSPVWY 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G+ VG +  + + Q   +       I PD  +   + A IR  G+ G  Y+E+S    +
Sbjct: 60  AGLEVGEVSNIRIAQGASDRIAVTVTISPDARVRKDSRADIRNLGMMGAKYVEISPGSPD 119

Query: 121 KKTIFQIATERNQ 133
            + +    T   +
Sbjct: 120 AELLGPGETLEGK 132


>gi|50119257|ref|YP_048424.1| hypothetical protein ECA0297 [Pectobacterium atrosepticum SCRI1043]
 gi|49609783|emb|CAG73217.1| putative exported protein [Pectobacterium atrosepticum SCRI1043]
          Length = 188

 Score = 93.5 bits (229), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 26/133 (19%), Positives = 54/133 (40%), Gaps = 2/133 (1%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M++K     VG+F++  L    F    ++            +     ++ GL   S +R 
Sbjct: 1   MQTKKTEVWVGVFMLIALAAILFLCLKVADLKSIGNEPTYRLYATFDNIGGLKARSPIRI 60

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDT-PLYPSTTATIRTQGLAGITYIELSTLRK 119
            G+ +GR+  + LD++          I+     +  +++  IRT GL G  Y+ L+   +
Sbjct: 61  GGVVIGRVADISLDEKTY-LPRVAMDIQQRYDHIPDTSSLAIRTSGLLGEQYLALNMGFE 119

Query: 120 EKKTIFQIATERN 132
           ++     I  +  
Sbjct: 120 DEDMGTTILKDSG 132


>gi|253572013|ref|ZP_04849417.1| conserved hypothetical protein [Bacteroides sp. 1_1_6]
 gi|251838193|gb|EES66280.1| conserved hypothetical protein [Bacteroides sp. 1_1_6]
          Length = 297

 Score = 93.5 bits (229), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 34/290 (11%), Positives = 92/290 (31%), Gaps = 9/290 (3%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M+       +G+  +  L    + I WL   + +             +V+GL+  S V  
Sbjct: 1   MKYITKEVRIGIAGIVALCVLVYGINWLKGIHMFQPSSYFY--AKFQNVNGLTKSSPVFA 58

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           +G+ VG +  +  D   P + + +  +  +  +   ++A + ++ + G+    L      
Sbjct: 59  DGVRVGIVRDIEYDYVNPGNVIVEVELDTELRIPKGSSAELVSELMGGVRMNILLANNPR 118

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
           +K               T     +             +      +  +   +      ++
Sbjct: 119 EKYAI------GDTIPGTLNNGMMESVAKLMPQIESMLPKLDSILTSLNNIVGDKSIPSM 172

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
            +    +T     +S   K + +  +   +       +    +  +L ++  +   QKV+
Sbjct: 173 LHSIETTTANLAVVSSQMKGLMSKDIPQLTGKLNTIGDNFVAISGNLKEVDYSAIFQKVD 232

Query: 241 QILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSS 290
             L N+++ +       + +    +D            +    LL D  +
Sbjct: 233 ATLANVKMITEKLNSKDNTIGLLFNDP-ALYNNLNATTENAASLLEDLKA 281


>gi|86608565|ref|YP_477327.1| mce related protein [Synechococcus sp. JA-2-3B'a(2-13)]
 gi|86557107|gb|ABD02064.1| mce related protein [Synechococcus sp. JA-2-3B'a(2-13)]
          Length = 407

 Score = 93.5 bits (229), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 43/430 (10%), Positives = 127/430 (29%), Gaps = 64/430 (14%)

Query: 1   MESKN-YYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVR 59
           M S+     +VGL +++          W+    ++     +  +    +V GL+  SSVR
Sbjct: 1   MRSRAVREGAVGLLILAGALGFAGLFLWIYNL-RFGSRGFQFTVTYT-NVVGLTEGSSVR 58

Query: 60  FNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRK 119
             G+ +GR+  +       +    +  I     +   +    +  GL G T ++    + 
Sbjct: 59  LRGVTIGRVERIVPQP---SQVEVQVTIDQPLVIPRDSLFLTKQTGLVGETVMD-ILPQG 114

Query: 120 EKKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTT 179
             +         +  +        +       +     I       +   + +   L  T
Sbjct: 115 RGQAATGSPLAADCDSSQIICDGDVVEGKPGVDFGQLLIRLDQLLTRINDDELFDTLNAT 174

Query: 180 IANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKV 239
           +  +  ++  +A+    +++ +                                      
Sbjct: 175 LEGLTRVANSVADLSETVEERV-------------------------------------- 196

Query: 240 NQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSA 299
              L    +    F  ++  + +    VR T ++ Q    +   L+    + + +     
Sbjct: 197 -AALRTEDLDLLQFTTAATAIQDAAGAVRGTARSLQAAADQFTALVDQNRTSLNAA---- 251

Query: 300 FLENIADSTSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNI 359
                 ++   + + + A+                +  I + +  +++  A+    +  I
Sbjct: 252 -----LENIQQVSADLQAMSSAVRPLVTDPQLQADVRQILAEVRAAAENVAQATEDLQQI 306

Query: 360 SALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETV 419
           +A   +       ++ + + R T + + +    I     +             R ++E V
Sbjct: 307 AASLNDPGTLATLRQTLDSARITFQNMQKITADIDELTGD---------PQFRRGIRELV 357

Query: 420 NHFDDCLNNF 429
               + +++ 
Sbjct: 358 LGLSNLVSSV 367


>gi|255011255|ref|ZP_05283381.1| hypothetical protein Bfra3_19086 [Bacteroides fragilis 3_1_12]
 gi|313149066|ref|ZP_07811259.1| conserved hypothetical protein [Bacteroides fragilis 3_1_12]
 gi|313137833|gb|EFR55193.1| conserved hypothetical protein [Bacteroides fragilis 3_1_12]
          Length = 297

 Score = 93.1 bits (228), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 37/283 (13%), Positives = 92/283 (32%), Gaps = 5/283 (1%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M+       +G+  ++ L    F I +L   N +       +     +V+GL+  S V  
Sbjct: 1   MKLITKEVRIGIAGIAALCLLVFGINYLKGINMFKPASYFYVK--FHNVNGLAQSSPVFA 58

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           +G+ VG +  +  D   P + + +  +  D  +   ++A +  + + G+    L      
Sbjct: 59  DGVRVGIVRDIAYDYNQPENVIVEVEVDTDLRIPKGSSAELVPELMGGVRMNILLANNPR 118

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRH---IQKIIENIEKPLT 177
           ++ +            +    + +   +         I  S       Q I   +     
Sbjct: 119 ERYMVGDTIPGTLNNGMMEKVAAMMPAVEKMLPKLDSILTSLNTIMADQSIPATLHSIEK 178

Query: 178 TTIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQ 237
           TT     T   +     + I ++         +    +      D  T+  K+   +   
Sbjct: 179 TTANLEVTSRQLKVLMNNDIPQLTGKLNTIGDNFIVISGNLKEIDYATTFKKIDATLSNV 238

Query: 238 KVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQK 280
           K+     N + ++   + +  Q+ N ++       +  E  ++
Sbjct: 239 KMLTEKLNSKDNTVGLLLNDPQLYNNLNQTTINAASLLEDLKE 281


>gi|29347552|ref|NP_811055.1| hypothetical protein BT_2142 [Bacteroides thetaiotaomicron
           VPI-5482]
 gi|298383756|ref|ZP_06993317.1| mce related protein [Bacteroides sp. 1_1_14]
 gi|29339452|gb|AAO77249.1| conserved hypothetical protein, with a conserved domain
           [Bacteroides thetaiotaomicron VPI-5482]
 gi|298263360|gb|EFI06223.1| mce related protein [Bacteroides sp. 1_1_14]
          Length = 297

 Score = 93.1 bits (228), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 34/290 (11%), Positives = 91/290 (31%), Gaps = 9/290 (3%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M+       +G+  +  L    + I WL   + +             +V+GL+  S V  
Sbjct: 1   MKYITKEVRIGIAGIVALCVLVYGINWLKGIHMFQPSSYFY--AKFQNVNGLTKSSPVFA 58

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           +G+ VG +  +  D   P + + +  +  +  +   ++A + ++ + G+    L      
Sbjct: 59  DGVRVGIVRDIEYDYVNPGNVIVEVELDTELRIPKGSSAELVSELMGGVRMNILLANNPR 118

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
           +K               T     +             +      +  +   +      + 
Sbjct: 119 EKYAI------GDTIPGTLNNGMMESVAKLMPQIESMLPKLDSILTSLNNIVGDKSIPST 172

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
            +    +T     +S   K + +  +   +       +    +  +L ++  +   QKV+
Sbjct: 173 LHSIETTTANLAVVSSQMKGLMSKDIPQLTGKLNTIGDNFVAISGNLKEVDYSAIFQKVD 232

Query: 241 QILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSS 290
             L N+++ +       + +    +D            +    LL D  +
Sbjct: 233 ATLANVKMITEKLNSKDNTIGLLFNDP-ALYNNLNATTENAASLLEDLKA 281


>gi|317050886|ref|YP_004112002.1| mammalian cell entry related domain-containing protein
           [Desulfurispirillum indicum S5]
 gi|316945970|gb|ADU65446.1| Mammalian cell entry related domain protein [Desulfurispirillum
           indicum S5]
          Length = 523

 Score = 93.1 bits (228), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 50/358 (13%), Positives = 118/358 (32%), Gaps = 11/358 (3%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M        VGL V+       ++   L            V       V GL+  + V+ 
Sbjct: 1   MNITA-EAKVGLLVIVAFALLTYASVQLGDLRLDGDNYYAVEFAF-EDVAGLNRGARVKM 58

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           +G+ +G +  + L+       +  A +    P+  +  A I T+G+ G  Y+ +  +   
Sbjct: 59  SGVSIGSVESILLE---NGKVIVSASVERKYPVAENAPARILTEGVLGEKYLSIDHVPGA 115

Query: 121 KKTIFQIA-----TERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKP 175
           +  +           R     + AT   +   +S      +    S +  + I E I   
Sbjct: 116 RAFLGDGQRSQHFNSREGTEDLMATLGKVAADVSQITENLRTSIGSPQTNENINEMIFYL 175

Query: 176 LTTTIANIETISTVLANNISHIDKMMHTTQV-TPHSSDSKNTFNTITDLITSLDKMIKAI 234
              +    + ++    N    +D + H T+     ++ +++  N + + +  L + ++  
Sbjct: 176 RELSFNLSQIVAANQENLNRTLDNVAHITETLREITTRNEHNINALIENMEVLTRSLRQQ 235

Query: 235 DLQKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKS 294
             + ++        +   F +    +     D+R TT  F ++   +       S   + 
Sbjct: 236 TPEVMSSARSAFDSADGAFGELHGILAENRADIRTTTHNFGQLSGDLSTTSRHLSEITEK 295

Query: 295 KETSAFLENIADSTSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAEL 352
             T         +T  +  S+ A     ++   +I  + T   + S       +   +
Sbjct: 296 INTGDGTLGKLVNTDELHESLLAASRGIEEMTGMIGGLRTDITVRSEFLTEQSENRGI 353


>gi|157826201|ref|YP_001493921.1| ABC transporter substrate binding protein [Rickettsia akari str.
           Hartford]
 gi|157800159|gb|ABV75413.1| ABC transporter substrate binding protein [Rickettsia akari str.
           Hartford]
          Length = 149

 Score = 93.1 bits (228), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 25/119 (21%), Positives = 50/119 (42%), Gaps = 3/119 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M+     T +G  V+  +   F    + + S+  +    +V +    S +G++  S V  
Sbjct: 1   MKQNIIETIIGCIVLI-IALLFLIFAYNTGSSITNSKGYQVTVNF-QSAEGIAVGSDVMI 58

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRK 119
           +GI +G +  + LD +   ++     I  D  +   + A + T+GL G  YI +     
Sbjct: 59  SGIKIGIVKKITLDPKSF-YASVYLNINDDVKIPKDSKAQVVTRGLLGGKYISIVPGND 116


>gi|74316267|ref|YP_314007.1| ABC-type transport system periplasmic component [Thiobacillus
           denitrificans ATCC 25259]
 gi|74055762|gb|AAZ96202.1| ABC-type transport system periplasmic component [Thiobacillus
           denitrificans ATCC 25259]
          Length = 315

 Score = 93.1 bits (228), Expect = 8e-17,   Method: Composition-based stats.
 Identities = 48/301 (15%), Positives = 102/301 (33%), Gaps = 2/301 (0%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME++  YT VG  V+++L     +I WL+         +  I     S+DGL+  S+V+ 
Sbjct: 1   METEGRYTLVGSLVLAVLASMTLAIVWLAGGADKIAYQSYTIYFRHQSLDGLAVGSAVKM 60

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            GI VG + G              A I  D P++    A I+   + GI  +E+     +
Sbjct: 61  RGIKVGVVEGFRFADGDDEAVRVTARIDEDVPVHAGAAAYIKRNLVTGIAAVEIDNGPGK 120

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
              + +         +   +        + ++          +    + +  ++ ++ T+
Sbjct: 121 GPLLSEPPAGERYPVIAEGSSDLDKVATAVSKLAVSGAQVLDKMNTLLSDENQRSVSRTL 180

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
           AN+  +S  LA N   +D  +   +    + + +    +I    T  +  I  +      
Sbjct: 181 ANLNELSGHLAANKQSLDAAVQGIR--DAADEFRFAGASINQAATRAEGSITVVGENAQA 238

Query: 241 QILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAF 300
            I E           ++       H     T     V + +       ++  +       
Sbjct: 239 AITEARDAIQKLERDATQISDRLEHFTETGTLELTNVSRDVRTSADTLTTTGQRLSNPRG 298

Query: 301 L 301
           +
Sbjct: 299 I 299


>gi|313894614|ref|ZP_07828177.1| virulence factor Mce family protein [Veillonella sp. oral taxon 158
           str. F0412]
 gi|313440804|gb|EFR59233.1| virulence factor Mce family protein [Veillonella sp. oral taxon 158
           str. F0412]
          Length = 419

 Score = 93.1 bits (228), Expect = 8e-17,   Method: Composition-based stats.
 Identities = 38/345 (11%), Positives = 101/345 (29%), Gaps = 5/345 (1%)

Query: 5   NYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRFNGIP 64
                VG F +  +      I ++ R + +  P   +       V+GL   + V+F+G+ 
Sbjct: 4   TTEAKVGAFTIIGIALFIAGILFVGRIDIWAKPQMTITGDFAQ-VNGLKNGNQVKFSGVA 62

Query: 65  VGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKEKKTI 124
           +G +  + +    P   + K  +   T +   +  T+ + G  G  +I++S  + +    
Sbjct: 63  IGSVSDIEI---TPRGVVVKMKLDEKTQIPSDSIFTLGSDGFLGDKFIQISPGQSKVYLQ 119

Query: 125 FQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTIANIE 184
              + +      +          +   E   + I+                 +T +    
Sbjct: 120 DGDSVKGEGVDAMEKAMQSAQKLMDGTEKMLQSINSIIGDPATQNALKHSLQSTAVMADN 179

Query: 185 TISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVNQILE 244
            ++                 Q     +   +    +T+L  + D++       +      
Sbjct: 180 AVAITENMANVTAQLNQAAQQFNADGNAGNDMRAILTNLKQTTDRVDNMARSMESTVTDP 239

Query: 245 NIQ-VSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAFLEN 303
             Q         ++         +          G  ++   ++  S  K + +   L N
Sbjct: 240 KAQANIQETLHNTAQISARINKLMGGKAYRTDANGNVVEVGTTEKKSSSKVEPSVDMLYN 299

Query: 304 IADSTSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQK 348
             D+   +   + A  +       + +  +  +   +     S K
Sbjct: 300 TTDNEFRINGRLRAFNDKGMAEIGLSNIGDDTKFDLNAGKFISSK 344


>gi|312898373|ref|ZP_07757763.1| virulence factor Mce family protein [Megasphaera micronuciformis
           F0359]
 gi|310620292|gb|EFQ03862.1| virulence factor Mce family protein [Megasphaera micronuciformis
           F0359]
          Length = 411

 Score = 93.1 bits (228), Expect = 8e-17,   Method: Composition-based stats.
 Identities = 37/281 (13%), Positives = 99/281 (35%), Gaps = 9/281 (3%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M++      VG+  V  +   FF +  LS ++ +      V +      +GL   ++VR+
Sbjct: 1   MKNMTAEVKVGIMTVVGVLLLFFVVVGLSHADLFRSSGLTVHVAFSD-ANGLQAGNTVRY 59

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G+ VG++  +   ++          ++  T +   + A I T GL G   + ++  +  
Sbjct: 60  VGVNVGKVESVTAGKDG---VEVTLKLKKGTEIPKDSKAVITTDGLMGEKLVSITPGQDT 116

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
           +  +    T +  +             + N  N   K  +S    +K    +   +    
Sbjct: 117 QHLVTDGGTLQGDKVKSVDDVMDNANKLLNNVNDMMKNVNSVIGDEKTQGAMRGSIQNIA 176

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
                ++ +LA N  ++ +M           +           +++  +        +  
Sbjct: 177 GITGNVNDMLAANAGNVQQMTANMAAITGQLNESVQRMDGDGKMSADMR-----SSLENI 231

Query: 241 QILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKI 281
           +++ +        +++      +  D+R+T     ++ +K+
Sbjct: 232 KVITDRFTVIAGEMENIATDPQSSADIRKTLHNTAQISEKV 272


>gi|170691588|ref|ZP_02882753.1| Mammalian cell entry related domain protein [Burkholderia graminis
           C4D1M]
 gi|170143793|gb|EDT11956.1| Mammalian cell entry related domain protein [Burkholderia graminis
           C4D1M]
          Length = 320

 Score = 93.1 bits (228), Expect = 8e-17,   Method: Composition-based stats.
 Identities = 29/128 (22%), Positives = 60/128 (46%), Gaps = 3/128 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME+K++    GLF + +L     + +  +             +    +V GL TD++VR+
Sbjct: 1   MENKSHAFWAGLFTIVLLGAIATAAFLFNVDRAV---RVPYDLIARTNVTGLFTDAAVRY 57

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G+ VG++  +  D+ +P   + + L+    P+  ST  ++  QG+ GI +I+L    ++
Sbjct: 58  RGLDVGKVQSIKFDRAHPGQIVIRILVDTHAPITHSTFGSLGFQGVTGIAFIQLDDTGRD 117

Query: 121 KKTIFQIA 128
              +    
Sbjct: 118 PSPLASSP 125


>gi|22124064|ref|NP_667487.1| hypothetical protein y0144 [Yersinia pestis KIM 10]
 gi|21956811|gb|AAM83738.1|AE013614_12 hypothetical protein y0144 [Yersinia pestis KIM 10]
          Length = 190

 Score = 93.1 bits (228), Expect = 8e-17,   Method: Composition-based stats.
 Identities = 25/136 (18%), Positives = 53/136 (38%), Gaps = 2/136 (1%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M++K     VG+F++  +    F    ++            I     ++ GL   S V+ 
Sbjct: 6   MQTKKSEVWVGMFILIAILAVIFLCLKVADIKSVGNQPTYRIYANFDNIGGLKNHSPVKI 65

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDT-PLYPSTTATIRTQGLAGITYIELSTLRK 119
            G+ VGR+  + LD +          I+     +  +++  +RT GL G  ++ L+   +
Sbjct: 66  GGVVVGRVAEITLDTKNYTP-RVAIDIQQRYNHIPDTSSLAVRTSGLLGEQFLALNVGFE 124

Query: 120 EKKTIFQIATERNQRA 135
           + +    I  +     
Sbjct: 125 DPEMGTSILKDGGTIQ 140


>gi|296166532|ref|ZP_06848963.1| virulence factor mce family protein [Mycobacterium parascrofulaceum
           ATCC BAA-614]
 gi|295898144|gb|EFG77719.1| virulence factor mce family protein [Mycobacterium parascrofulaceum
           ATCC BAA-614]
          Length = 350

 Score = 93.1 bits (228), Expect = 8e-17,   Method: Composition-based stats.
 Identities = 38/286 (13%), Positives = 92/286 (32%), Gaps = 6/286 (2%)

Query: 4   KNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRFNGI 63
           ++    V +F  ++L  S   +                       V  L +   VR  G+
Sbjct: 10  RSMMIKVSIFAAAMLLVSAALVVVFGDFRFGPENTYHAT---FTDVSRLKSGQKVRIAGV 66

Query: 64  PVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKEKKT 123
           PVG + G+ L+ +          I     LY ST A IR + L G  Y+E+++   E + 
Sbjct: 67  PVGAVSGVKLNPDNT--IDVTFGIDERYTLYSSTRAVIRYENLVGDRYLEITSGPGELRK 124

Query: 124 IFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTIANI 183
           +   AT  +Q          +   +             +     +IE ++         +
Sbjct: 125 LPPGATINSQHTQPALDLDALLGGLRPVLKGL-DADKVNTISSAVIELLQGQGGALSNVL 183

Query: 184 ETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVNQIL 243
              S   +        +            + +  +          + + +   +K + I 
Sbjct: 184 ADASAFSSALGQRDQLIGDVINNLNTVLKTVDQRSAQFSASVEQLQQLISGLAKKKDDIA 243

Query: 244 ENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFS 289
             I   ++     ++ + N+   ++   +  + +  ++D+  ++ +
Sbjct: 244 GAIPPLASTTTDLTELLKNSRRPLQGILENTRPLATELDNRKAELN 289


>gi|157827481|ref|YP_001496545.1| ABC transporter substrate binding protein [Rickettsia bellii OSU
           85-389]
 gi|157802785|gb|ABV79508.1| ABC transporter substrate binding protein [Rickettsia bellii OSU
           85-389]
          Length = 149

 Score = 93.1 bits (228), Expect = 9e-17,   Method: Composition-based stats.
 Identities = 27/122 (22%), Positives = 49/122 (40%), Gaps = 3/122 (2%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M+     T +G F V I+ F F    + + S+  +    ++      S +G+S  S V  
Sbjct: 1   MKQNIIETIIG-FAVLIIAFLFLIFAYKTGSSMTNAKGYQLNASF-QSAEGISVGSDVMI 58

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           +GI +G +  +FLD      +     +  +  +   + A + T GL G  YI +      
Sbjct: 59  SGIKIGNVKKIFLDPTSY-FATVYLNVNENVKIPKDSKAQVVTSGLLGGKYIAIVPGNDN 117

Query: 121 KK 122
             
Sbjct: 118 DY 119


>gi|303230938|ref|ZP_07317681.1| virulence factor Mce family protein [Veillonella atypica
           ACS-049-V-Sch6]
 gi|302514320|gb|EFL56319.1| virulence factor Mce family protein [Veillonella atypica
           ACS-049-V-Sch6]
          Length = 419

 Score = 93.1 bits (228), Expect = 9e-17,   Method: Composition-based stats.
 Identities = 32/275 (11%), Positives = 86/275 (31%), Gaps = 4/275 (1%)

Query: 5   NYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRFNGIP 64
                VG F +  +      I ++ R + +  P   +       V+GL   + V+F+G+ 
Sbjct: 4   TTEAKVGAFTIVGIVLFVLGIIFVGRIDVFAKPQMTITGDFAQ-VNGLKNGNQVKFSGVA 62

Query: 65  VGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKEKKTI 124
           +G +  + +        + K  I   T +   +T T+ + G  G  +I++S  +      
Sbjct: 63  IGTVSDIEITPSG---VMVKMKIDDKTQIPSDSTFTLGSDGFLGDKFIQISPGKSTVYLH 119

Query: 125 FQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTIANIE 184
              + +      +          ++  E   + I+      +          +T +    
Sbjct: 120 DGDSVKGEGIDAMDKAMQSAQKLMAGTEQMLQSINTIIGDPKTQDALKHSLQSTAVMADN 179

Query: 185 TISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVNQILE 244
            ++                 Q     +   +    +T++  + D++       +      
Sbjct: 180 AVAVTQNMADVTAQLNQAAQQFNADGNAGNDMRAILTNIKQTTDRVDHMARSMEGTVTDP 239

Query: 245 NIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQ 279
             Q +    + +++Q+   V+ +        E   
Sbjct: 240 KAQENIKATLHNTEQISARVNKLLGGKPYASETSN 274


>gi|295699944|ref|YP_003607837.1| hypothetical protein BC1002_4342 [Burkholderia sp. CCGE1002]
 gi|295439157|gb|ADG18326.1| Mammalian cell entry related domain protein [Burkholderia sp.
           CCGE1002]
          Length = 431

 Score = 93.1 bits (228), Expect = 9e-17,   Method: Composition-based stats.
 Identities = 39/427 (9%), Positives = 109/427 (25%), Gaps = 24/427 (5%)

Query: 19  FFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSS-VRFNGIPVGRIVGLFLDQEY 77
             +F    WL            V +    +  G+  D + V   G+ VG +  + L  + 
Sbjct: 27  IAAFAMTGWLG-VRALTQQGETVTVTF-DNAYGMKPDDTIVTLRGVKVGAVSEITLAPDG 84

Query: 78  PNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKEKKTIFQIATERNQRAMI 137
             H  A+  I      Y  +             +                        ++
Sbjct: 85  -QHVQAELKIDRAEKKYLRSE----------TRFFLRGAHVDLNDPASLKGVLSGPEIVM 133

Query: 138 TATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTIANIETISTVLANNISHI 197
              P          +            +  ++                +       ++ +
Sbjct: 134 EPGPGEPASRFDGVDRRPALAPGHGPVVTYLVRFDGAVGDLKSGADVQLRGFDVGTVTSV 193

Query: 198 DKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVNQILENIQVSSNNFVKSS 257
                       +            ++ +               +   +       +   
Sbjct: 194 RLNYDARTGALSTPVEIALNPAQLGIVGAPPPANGDWRPLVDAMLGRLVATGLRARLSQD 253

Query: 258 DQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNMRSSISA 317
             V+       +  Q         +  L        +         +A +   ++     
Sbjct: 254 PPVVGADKINLDFVQGAPVATLASEGGLPVIPGVAAA----NLDTTMAKANEVIQKIDDL 309

Query: 318 IREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNISALKENNSLFKDAQRAMH 377
               T ++ + I+      + +  + DS       +++I++         +       + 
Sbjct: 310 PIRQTGEQVRSIAAHINALSSSPQIKDSLTHIDHSVAQIDHTL-----QQVSPQIGPLVA 364

Query: 378 TFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFERNPQDIV 437
             RDT+   +R + +    L   + S  ND+   +++L +T        +  +R+P+ ++
Sbjct: 365 QLRDTASAADRTVAAANRTLGGDASS-QNDLPAAMQELTDTARSIRALADYLDRHPEALI 423

Query: 438 WGREKGS 444
            GR++ +
Sbjct: 424 HGRQQET 430


>gi|120555618|ref|YP_959969.1| hypothetical protein Maqu_2707 [Marinobacter aquaeolei VT8]
 gi|120325467|gb|ABM19782.1| Mammalian cell entry related domain protein [Marinobacter aquaeolei
           VT8]
          Length = 149

 Score = 93.1 bits (228), Expect = 9e-17,   Method: Composition-based stats.
 Identities = 28/118 (23%), Positives = 47/118 (39%), Gaps = 2/118 (1%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M  ++    VGLF+++ L    F    +S  +         +        GL+    V  
Sbjct: 1   MAQRSTEIIVGLFMIAGLAALMFLALQVSGLSPKSAEQTYTLYANFNDTGGLTPRGKVSM 60

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTP-LYPSTTATIRTQGLAGITYIELSTL 117
            G+ VG I  + LD++    +     I  +   +   + A IRT GL G  YI++S  
Sbjct: 61  AGVTVGTIESITLDRDTF-QARVTMSIHAEVDNIPADSAAVIRTSGLLGEQYIDISIG 117


>gi|186897001|ref|YP_001874113.1| hypothetical protein YPTS_3703 [Yersinia pseudotuberculosis PB1/+]
 gi|186700027|gb|ACC90656.1| Mammalian cell entry related domain protein [Yersinia
           pseudotuberculosis PB1/+]
          Length = 185

 Score = 93.1 bits (228), Expect = 9e-17,   Method: Composition-based stats.
 Identities = 25/136 (18%), Positives = 53/136 (38%), Gaps = 2/136 (1%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M++K     VG+F++  +    F    ++            I     ++ GL   S V+ 
Sbjct: 1   MQTKKSEVWVGMFILIAILAVVFLCLKVADIKSVGNQPTYRIYANFDNIGGLKNHSPVKI 60

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDT-PLYPSTTATIRTQGLAGITYIELSTLRK 119
            G+ VGR+  + LD +          I+     +  +++  +RT GL G  ++ L+   +
Sbjct: 61  GGVVVGRVAEITLDTKNYMP-RVAIDIQQRYNHIPDTSSLAVRTSGLLGEQFLALNVGFE 119

Query: 120 EKKTIFQIATERNQRA 135
           + +    I  +     
Sbjct: 120 DPEMGTSILKDGGTIQ 135


>gi|327396239|dbj|BAK13661.1| luene tolerance protein YrbD [Pantoea ananatis AJ13355]
          Length = 184

 Score = 93.1 bits (228), Expect = 9e-17,   Method: Composition-based stats.
 Identities = 23/146 (15%), Positives = 54/146 (36%), Gaps = 1/146 (0%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M+SK     VG+F++  +    F    ++            +     ++ GL   S V+ 
Sbjct: 1   MQSKKSEIWVGVFMIMAMIAVLFLCLRVADLKSLGTEPTWKLYATFDNIGGLKASSPVKI 60

Query: 61  NGIPVGRIVGLFLDQEY-PNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRK 119
            G+ +GR+  + L+ +            +    +  +++  IRTQGL G  ++ L+    
Sbjct: 61  GGVVIGRVTDISLEPKTLLPRVTMDISDKYANQIPDTSSLAIRTQGLLGEQFLSLNIGFD 120

Query: 120 EKKTIFQIATERNQRAMITATPSGIN 145
           + +    +  +        +     +
Sbjct: 121 DPELGSSMLNDGGTIRDTKSAMVLED 146


>gi|83941935|ref|ZP_00954397.1| paraquat-inducible protein, putative [Sulfitobacter sp. EE-36]
 gi|83847755|gb|EAP85630.1| paraquat-inducible protein, putative [Sulfitobacter sp. EE-36]
          Length = 700

 Score = 93.1 bits (228), Expect = 9e-17,   Method: Composition-based stats.
 Identities = 42/413 (10%), Positives = 126/413 (30%), Gaps = 27/413 (6%)

Query: 41  VIIRIPGSVDGLSTDSSVRFNGIPVGRIVGLF--LDQEYPNHSLAKALIRPDTPLYPSTT 98
           + +    +V GL+  + V  +G+ +G +  L   +D +    S  +  +           
Sbjct: 302 INVIFDENVSGLAVGAPVELSGLNIGEVDSLAGIVDYDQFGDSRVRLNVTLAIQPARLGL 361

Query: 99  ATIRTQGLAGITYIELSTLRKEKKTIFQIATERNQRAMITATPSGINYFISNAENTSKKI 158
               +   A     +        +           +  +       +  +  A      +
Sbjct: 362 PGDVSAESALAFLQDRVVNGLRARLASASLLTGGLKVELVVVEDAPSGRLVAAGENFPVM 421

Query: 159 SDSSRHIQKIIENIEKPLTTTIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFN 218
             +          +E   +               N   I++++++     +S  +    +
Sbjct: 422 PTTKNETSDAAATVEGVFSRI-------------NNLPIEELLNSAIGLMNSLQAFVGSD 468

Query: 219 TITDLITSLDKMIKAIDLQKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVG 278
            +      +  +I  +     +  ++NI VS N  +   + ++ T+ +  +  +   +  
Sbjct: 469 ELQQTPRDVRTLINEVTGLVSSDSVQNIPVSLNATLLRVETLVATLEE-EQMAKRLLDAV 527

Query: 279 QKIDHLLSDFSSKMKSKETSAFLENIADSTSNMRSSISAIREITDQRQKIISTINTIENI 338
             +    + FS+  +             + ++       + E+T   +     I T + +
Sbjct: 528 DSVSEAATSFSTSTEGVPELVEEMQAVAAKASELELQQLVDELTALTRSADQVIGTPDAV 587

Query: 339 T--SNLNDSSQKFAELMSKINNISALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNN 396
               +L ++  +    + ++    A++  N     A+ A      +++ + + +  +   
Sbjct: 588 ALPGSLKNALDELNYTLQELREGGAVENVNRTLASARNAADNIAVSAQDLPQIVNRLSTL 647

Query: 397 LQNF---------SQSGLNDIQNLVRKLQETVNHFDDCLNNFERNPQDIVWGR 440
                                Q  +R +Q+  +         ERNP  ++ GR
Sbjct: 648 FTQAERTIEGYNKGDQISRTAQETMRDIQKAADALASLARTIERNPNSLLLGR 700



 Score = 44.5 bits (102), Expect = 0.033,   Method: Composition-based stats.
 Identities = 45/463 (9%), Positives = 117/463 (25%), Gaps = 49/463 (10%)

Query: 9   SVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTD-SSVRFNGIPVGR 67
            V +  +  L  +    +              VI        G+    + +R+  + VGR
Sbjct: 29  IVWIIPILALVAALGVAF------NSYNSRGPVIFVEFDKGAGIKAGETELRYRDVTVGR 82

Query: 68  IVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKEKKTIFQI 127
           +  +          +A   +  +   +   +A+                         + 
Sbjct: 83  VEEVGFT-TGLGKVVASIRVDKNVAPFIDASASFWIVQPEVSAQGISGLGTVLSGVYIEG 141

Query: 128 ATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTIANIETIS 187
           +                +  +  A  +  +I+  +     + ++               +
Sbjct: 142 SWNDEVGDFAERFVGSDSPPLIRAGQSGLQIAFRTVGNGTLTDDAPILYRGIEVGRLGKA 201

Query: 188 TVLANNISHIDKMMHTTQVTPHSSDSKN------TFNTITDLITSLDKMIKAIDLQKVNQ 241
            +       I + +   +     + S           ++      +D    A  +     
Sbjct: 202 EIAPRGNFAIVEALIYEEHRNLINSSTRFWDSSGFSLSLGPGGAEIDFQSIATLIGGGVT 261

Query: 242 ILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAFL 301
               +         +   +  +  D R       EV   + +++ D +    +      L
Sbjct: 262 FDTFVSGGDRVQDGTVFDIFPSKEDARSAVFNASEVEPLLINVIFDENVSGLAVGAPVEL 321

Query: 302 ENIADSTSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQK----------FAE 351
             +     +  + I    +  D R ++  T+           D S +             
Sbjct: 322 SGLNIGEVDSLAGIVDYDQFGDSRVRLNVTLAIQPARLGLPGDVSAESALAFLQDRVVNG 381

Query: 352 LMSKINN----------------------ISALKENNSLFKDAQRAMHTFRDTSEKINRY 389
           L +++ +                      + A  EN  +    +        T E +   
Sbjct: 382 LRARLASASLLTGGLKVELVVVEDAPSGRLVAAGENFPVMPTTKNETSDAAATVEGVFSR 441

Query: 390 IPSI-GNNLQNFSQSGLNDIQNLV--RKLQETVNHFDDCLNNF 429
           I ++    L N +   +N +Q  V   +LQ+T       +N  
Sbjct: 442 INNLPIEELLNSAIGLMNSLQAFVGSDELQQTPRDVRTLINEV 484



 Score = 43.8 bits (100), Expect = 0.053,   Method: Composition-based stats.
 Identities = 43/447 (9%), Positives = 124/447 (27%), Gaps = 42/447 (9%)

Query: 41  VIIRIPGSVDG-LSTDSSVRFNGIPVGRIVGLFLDQEYPNHSLAKA-------LIRPDTP 92
           + I      +G L+ D+ + + GI VGR+    +        +          LI   T 
Sbjct: 170 LQIAFRTVGNGTLTDDAPILYRGIEVGRLGKAEIAPRGNFAIVEALIYEEHRNLINSSTR 229

Query: 93  LYPS-----------------TTATIRTQGLAGITYIELSTLRKEKKTIFQIATERNQRA 135
            + S                 + AT+   G+   T++      ++        ++ + R+
Sbjct: 230 FWDSSGFSLSLGPGGAEIDFQSIATLIGGGVTFDTFVSGGDRVQDGTVFDIFPSKEDARS 289

Query: 136 MITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTIANIETISTVLANNIS 195
            +          I+   + +         ++    NI +  +                ++
Sbjct: 290 AVFNASEVEPLLINVIFDENVSGLAVGAPVELSGLNIGEVDSLAGIVDYDQFGDSRVRLN 349

Query: 196 HIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVNQILENIQVSSNNFVK 255
               +       P    +++    + D + +  +   A        +   + V  +    
Sbjct: 350 VTLAIQPARLGLPGDVSAESALAFLQDRVVNGLRARLASASLLTGGLKVELVVVEDAPSG 409

Query: 256 SSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNMRSSI 315
                      +  T     +    ++ + S  ++    +  ++ +  +    + + S  
Sbjct: 410 RLVAAGENFPVMPTTKNETSDAAATVEGVFSRINNLPIEELLNSAIGLMNSLQAFVGSDE 469

Query: 316 SAIREITDQRQKIISTINTIENITSNL----NDSSQKFAELMSKINNISALKENNSLFKD 371
                   +      T     +   N+    N +  +   L++ +      K        
Sbjct: 470 LQQTPRDVRTLINEVTGLVSSDSVQNIPVSLNATLLRVETLVATLEEEQMAKRLLDAVDS 529

Query: 372 AQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVN----------- 420
              A  +F  ++E +   +  +       S+  L  + + +  L  + +           
Sbjct: 530 VSEAATSFSTSTEGVPELVEEMQAVAAKASELELQQLVDELTALTRSADQVIGTPDAVAL 589

Query: 421 --HFDDCLNNFERNPQDIVWGREKGSV 445
                + L+      Q++  G    +V
Sbjct: 590 PGSLKNALDELNYTLQELREGGAVENV 616


>gi|227538360|ref|ZP_03968409.1| ABC superfamily ATP binding cassette transporter, permease protein
           [Sphingobacterium spiritivorum ATCC 33300]
 gi|227241875|gb|EEI91890.1| ABC superfamily ATP binding cassette transporter, permease protein
           [Sphingobacterium spiritivorum ATCC 33300]
          Length = 337

 Score = 93.1 bits (228), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 40/319 (12%), Positives = 95/319 (29%), Gaps = 2/319 (0%)

Query: 8   TSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRFNGIPVGR 67
             VGLFV+  L      I  L    +       V       V GL   ++V F+G+ VG 
Sbjct: 10  LVVGLFVLIGLIILVAGILTLGGQQKKFTKTLTVTTEF-EDVKGLKVGNNVWFSGVKVGI 68

Query: 68  IVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKEKKTIFQI 127
           +  +  +       +     +    +     A + + GL G + I L    +  + I   
Sbjct: 69  VKDISFESIKYVKVVMSIEAKSSEFIRKDAVAKLGSDGLIGNSIITLVGGSQTAQPIEDG 128

Query: 128 ATERNQRAMITA-TPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTIANIETI 186
               + +        + ++    N    ++  +  S+++      +   LT +   +   
Sbjct: 129 DILHSAKGTDMEAMMATLSVNNDNLVEITRNFAVLSQNLVDGKGMVGAMLTDSSMVVSLS 188

Query: 187 STVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVNQILENI 246
            ++   N    +    +  +   ++   N    I  L T         +     Q +   
Sbjct: 189 KSLDNLNKLMTNANQASNNLVAVTNKLNNNQGLIHQLSTDTAVFASLRESAAQLQGVTQT 248

Query: 247 QVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAFLENIAD 306
             +  + + ++   +N  ++V        E   +I  +L + +      + +        
Sbjct: 249 ASALMSNLNATSARLNDKNNVVGALTNDPEGAAEIKQILRNLNLSTAKLDQNMEAMQSNF 308

Query: 307 STSNMRSSISAIREITDQR 325
                       +E     
Sbjct: 309 LLRGFFKKQQKEQEKAKAD 327


>gi|145222690|ref|YP_001133368.1| virulence factor Mce family protein [Mycobacterium gilvum PYR-GCK]
 gi|145215176|gb|ABP44580.1| virulence factor Mce family protein [Mycobacterium gilvum PYR-GCK]
          Length = 343

 Score = 93.1 bits (228), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 23/130 (17%), Positives = 45/130 (34%), Gaps = 4/130 (3%)

Query: 2   ESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRFN 61
             +   T +G F+   L   F       +  ++     +       +V GL T+  VR  
Sbjct: 4   SIRRDATRLGAFLAVCLLGVFGLFAVFGQM-RFGEKTQQYRAEFV-NVTGLETNDFVRIA 61

Query: 62  GIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKEK 121
           G+ VG++  + +  +    ++ +        L   + A IR   L G  Y+ L       
Sbjct: 62  GVEVGKVENVEIQPDTT--AVVEFTADDSVVLTQGSRAVIRYDDLIGGRYLALEEGAGGT 119

Query: 122 KTIFQIATER 131
           + +    T  
Sbjct: 120 QKLNPGGTIP 129


>gi|126668783|ref|ZP_01739731.1| ABC-type transport system involved in resistance to organic
           solvents, periplasmic component [Marinobacter sp. ELB17]
 gi|126626766|gb|EAZ97415.1| ABC-type transport system involved in resistance to organic
           solvents, periplasmic component [Marinobacter sp. ELB17]
          Length = 149

 Score = 92.7 bits (227), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 29/118 (24%), Positives = 45/118 (38%), Gaps = 2/118 (1%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M  +     VGLFV++ +    F    +S  +         +        GL     V  
Sbjct: 1   MAQRTIEIIVGLFVLAGMGAMMFLALQVSGLSLAAAGSTYTVYADFTDTGGLGPRGRVSM 60

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDT-PLYPSTTATIRTQGLAGITYIELSTL 117
            G+ VG I  + LD++    +     I  D   +   + A IRT GL G  YI++S  
Sbjct: 61  AGVQVGSIESIELDRDTF-KARVTLSINSDVNNIPADSAAMIRTSGLLGEQYIDISIG 117


>gi|294669771|ref|ZP_06734837.1| hypothetical protein NEIELOOT_01671 [Neisseria elongata subsp.
           glycolytica ATCC 29315]
 gi|291308337|gb|EFE49580.1| hypothetical protein NEIELOOT_01671 [Neisseria elongata subsp.
           glycolytica ATCC 29315]
          Length = 166

 Score = 92.7 bits (227), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 26/120 (21%), Positives = 44/120 (36%), Gaps = 5/120 (4%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDG---PMAEVIIRIPGSVDGLSTDSS 57
           M+       VGLFV+  +    F  + ++    + G       V       + GL   + 
Sbjct: 1   MKRSILEFWVGLFVLIGIAALAFLSFRVAGGGNFGGGSGQTYTVYANFTD-IGGLKVKAP 59

Query: 58  VRFNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTL 117
           ++ +G+ VGR+  + LD      +     +          +A I T GL G  YI L   
Sbjct: 60  IKASGVLVGRVQNIALDPATY-QAKVTLQLDKQYTFSSDVSAQILTSGLLGEQYIGLMQG 118


>gi|254822748|ref|ZP_05227749.1| virulence factor Mce family protein [Mycobacterium intracellulare
           ATCC 13950]
          Length = 351

 Score = 92.7 bits (227), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 38/282 (13%), Positives = 91/282 (32%), Gaps = 6/282 (2%)

Query: 8   TSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRFNGIPVGR 67
             V +F V++L  S   +          GP +         V  L     VR  G+PVG 
Sbjct: 15  IKVSIFAVAMLLVSAGLVVVFGDFR--FGPESTYHATFTD-VSRLKAGQKVRIAGVPVGA 71

Query: 68  IVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKEKKTIFQI 127
           +  + L+++       K  +     LY ST A IR + L G  Y+E+++   E + +   
Sbjct: 72  VSDIKLNRDNT--IDVKFGVDKRYTLYSSTRAVIRYENLVGDRYLEITSGPGELRKLPAG 129

Query: 128 ATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTIANIETIS 187
           AT  +Q          +   +             +     +I+ ++         +   S
Sbjct: 130 ATINSQHTQPALDLDALLGGLRPVLKGL-DADKVNTISSAVIQLLQGQGGALSNVLADTS 188

Query: 188 TVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVNQILENIQ 247
              +        +            + +  +          + +     +  + I   I 
Sbjct: 189 AFSSALGQRDQLIGDVINNLNTVLTTVDQRSAQFSTSVDQLQQLITGLAEHKDDIAGAIP 248

Query: 248 VSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFS 289
             ++     +  + N+   ++   +  + +  ++D+  ++ +
Sbjct: 249 PLASTTTDLTQLLKNSRRPLQGVLENTRPLATELDNRKAEVN 290


>gi|315443154|ref|YP_004076033.1| virulence factor Mce family protein [Mycobacterium sp. Spyr1]
 gi|315261457|gb|ADT98198.1| virulence factor Mce family protein [Mycobacterium sp. Spyr1]
          Length = 343

 Score = 92.7 bits (227), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 23/130 (17%), Positives = 45/130 (34%), Gaps = 4/130 (3%)

Query: 2   ESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRFN 61
             +   T +G F+   L   F       +  ++     +       +V GL T+  VR  
Sbjct: 4   SIRRDATRLGAFLAVCLLGVFGLFAVFGQM-RFGEKTQQYRAEFV-NVTGLETNDFVRIA 61

Query: 62  GIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKEK 121
           G+ VG++  + +  +    ++ +        L   + A IR   L G  Y+ L       
Sbjct: 62  GVEVGKVENVEIQPDTT--AVVEFTADDSVVLTQGSRAVIRYDDLIGGRYLALEEGAGGT 119

Query: 122 KTIFQIATER 131
           + +    T  
Sbjct: 120 QKLNPGGTIP 129


>gi|261379497|ref|ZP_05984070.1| toluene tolerance ABC transporter, periplasmic substrate-binding
           protein [Neisseria subflava NJ9703]
 gi|284797960|gb|EFC53307.1| toluene tolerance ABC transporter, periplasmic substrate-binding
           protein [Neisseria subflava NJ9703]
          Length = 159

 Score = 92.7 bits (227), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 25/112 (22%), Positives = 41/112 (36%), Gaps = 2/112 (1%)

Query: 7   YTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRI-PGSVDGLSTDSSVRFNGIPV 65
              VGLFV+       F  +  +    +        +      + GL T++ V+  G+ V
Sbjct: 2   EFWVGLFVLLGAAAIGFLAFRAAGGQSFGKSSQTYTVYADFSDIGGLKTNAPVKSAGVLV 61

Query: 66  GRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTL 117
           GR+  + LD +    +     +          +A I T GL G  YI L   
Sbjct: 62  GRVASIQLDPKSY-QAKVALNLDSQYQFSSDVSAQILTSGLLGEQYIGLQQG 112


>gi|253991144|ref|YP_003042500.1| hypothetical protein PAU_03670 [Photorhabdus asymbiotica subsp.
           asymbiotica ATCC 43949]
 gi|253782594|emb|CAQ85758.1| conserved hypothetical Protein [Photorhabdus asymbiotica]
          Length = 172

 Score = 92.7 bits (227), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 29/146 (19%), Positives = 63/146 (43%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           M+SK     VG+F++  L    F    ++            +     ++ GL   S V+ 
Sbjct: 1   MQSKKSEIWVGVFILIALTAIVFLCLKVADIKSVGSQPTYRLYATFDNIGGLKERSPVKI 60

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
            G+ +GR+V + LD++     +A  +++    +  +++ +IRT GL G  YI L+   ++
Sbjct: 61  GGVVIGRVVTISLDEKTYTPQVALDIMKQYNRIPDTSSLSIRTSGLLGEQYIALNMGFED 120

Query: 121 KKTIFQIATERNQRAMITATPSGINY 146
                +I  + ++     +     + 
Sbjct: 121 PDMGTRILKDGDRVQDTKSAMVLEDM 146


>gi|317152442|ref|YP_004120490.1| Mammalian cell entry related domain-containing protein
           [Desulfovibrio aespoeensis Aspo-2]
 gi|316942693|gb|ADU61744.1| Mammalian cell entry related domain protein [Desulfovibrio
           aes