RPS-BLAST 2.2.22 [Sep-27-2009]

Database: pdb70 
           24,244 sequences; 5,693,230 total letters

Searching..................................................done

Query= gi|254780140|ref|YP_003064553.1| putative ABC transporter,
substrate-binding protein [Candidatus Liberibacter asiaticus str.
psy62]
         (452 letters)



>2pff_B Fatty acid synthase subunit beta; fatty acid synthase,
           acyl-carrier-protein, beta-ketoacyl reductase,
           beta-ketoacyl synthase, dehydratase; 4.00A
           {Saccharomyces cerevisiae}
          Length = 2006

 Score = 51.5 bits (123), Expect = 4e-07
 Identities = 72/512 (14%), Positives = 127/512 (24%), Gaps = 241/512 (47%)

Query: 4   KNYYTSVGL-------FVVSILF-------FSFFSIYWLSRSNQ-------------YD- 35
           KNY T+  +          S LF           +I+      Q             Y  
Sbjct: 124 KNYITARIMAKRPFDKKSNSALFRAVGEGNAQLVAIF----GGQGNTDDYFEELRDLYQT 179

Query: 36  -GPMAEVIIRIPGSV-DGLSTDSSVRFNGIPVGRIVGLFLD----QEYPNHSLAKALIRP 89
              +   +I+        L   +          ++    L+     E P++        P
Sbjct: 180 YHVLVGDLIKFSAETLSELIRTTLDAE------KVFTQGLNILEWLENPSN-------TP 226

Query: 90  DT----------PL--------Y----------PS------TTATIRTQGL---AGI--- 109
           D           PL        Y          P         AT  +QGL     I   
Sbjct: 227 DKDYLLSIPISCPLIGVIQLAHYVVTAKLLGFTPGELRSYLKGATGHSQGLVTAVAIAET 286

Query: 110 ----TYIELSTLRKEKKTIFQIATERNQRAMITA-TPSGINYFISNAENT-----SKKIS 159
               ++      RK    +F I     +    T+  PS +   + N E       S  IS
Sbjct: 287 DSWESFFVSV--RKAITVLFFIGVRCYEAYPNTSLPPSILEDSLENNEGVPSPMLS--IS 342

Query: 160 DSSR-HIQKIIENIEK--PLTTTIANIETISTVLANNISHIDKMMHTTQVT-PHSSDSKN 215
           + ++  +Q  +       P    +     IS  L N   ++        V+ P  S    
Sbjct: 343 NLTQEQVQDYVNKTNSHLPAGKQVE----IS--LVNGAKNL-------VVSGPPQS---- 385

Query: 216 TFNTITDLITSLDKMIKAIDLQKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQ 275
                               L  +N  L   +  S       DQ                
Sbjct: 386 --------------------LYGLNLTLRKAKAPSGL-----DQ---------------- 404

Query: 276 EVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNMRSSISA------IREITDQRQKII 329
               +I        S+ K K ++ FL             +++      +   +D      
Sbjct: 405 ---SRIPF------SERKLKFSNRFL------------PVASPFHSHLLVPASDL----- 438

Query: 330 STINTIENITSNLNDSSQKFAELMSKINNISALKENNSLFKDAQRAMHTFRDTSEKINRY 389
                   I  +L  ++  F     +I           ++        TF          
Sbjct: 439 --------INKDLVKNNVSFNAKDIQI----------PVY-------DTF--D------- 464

Query: 390 IPSIGNNLQNFSQSGLNDIQNLVRKL-QETVN 420
               G++L+  S    +  + +V  + +  V 
Sbjct: 465 ----GSDLRVLSG---SISERIVDCIIRLPVK 489



 Score = 49.2 bits (117), Expect = 2e-06
 Identities = 42/303 (13%), Positives = 85/303 (28%), Gaps = 119/303 (39%)

Query: 174 KPLTTTIANIET---ISTVLANNISHIDKMMHTTQVTPHSSDSKNTFN----TITDLITS 226
           +PLT +  ++E    + T               +Q+       +  FN      T+   +
Sbjct: 7   RPLTLSHGSLEHVLLVPTAS-----FF----IASQL-------QEQFNKILPEPTEGFAA 50

Query: 227 LDKMIKAIDLQKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQT-FQEVGQKIDHLL 285
            D+     +L  V + L         +V            V  +    F +V   ++  L
Sbjct: 51  DDEPTTPAEL--VGKFLG--------YV---------SSLVEPSKVGQFDQV---LNLCL 88

Query: 286 SDFSSKMKSKETSAFLENIADSTSNMRSSISAIREITD----QRQKIIST-INTIENITS 340
           ++F         + +LE      +++ +  + + +  D    + +++I   I        
Sbjct: 89  TEF--------ENCYLEG-----NDIHALAAKLLQENDTTLVKTKELIKNYITAR----I 131

Query: 341 NLNDSSQKFAELMSKINNISALKENNSLFKDAQRAMHTFRDTSEKINRYIPSI----GNN 396
                  K +         SAL      F+                     +I    GN 
Sbjct: 132 MAKRPFDKKSN--------SAL------FRAVG---------EGNAQLV--AIFGGQGNT 166

Query: 397 LQNFSQSGLNDIQN----LVRKLQETVNHFDDCLNNFERNPQ----------DIV-W--G 439
              F +  L D+      LV  L +      + L+   R             +I+ W   
Sbjct: 167 DDYFEE--LRDLYQTYHVLVGDLIKFS---AETLSELIRTTLDAEKVFTQGLNILEWLEN 221

Query: 440 REK 442
              
Sbjct: 222 PSN 224


>1fft_C Ubiquinol oxidase; electron transport, cytochrome oxidase,
          membrane protein, oxidoreductase; HET: HEM HEO; 3.50A
          {Escherichia coli} SCOP: f.25.1.1
          Length = 204

 Score = 33.4 bits (76), Expect = 0.11
 Identities = 10/37 (27%), Positives = 19/37 (51%), Gaps = 2/37 (5%)

Query: 12 LFVVS--ILFFSFFSIYWLSRSNQYDGPMAEVIIRIP 46
          ++++S  ILF   F+ Y +  +    GP  + I  +P
Sbjct: 31 IYLMSDCILFSILFATYAVLVNGTAGGPTGKDIFELP 67


>2d4x_A Flagellar HOOK-associated protein 3; multi-domain protein,
           alpha-helical bundle, complex all- beta folds,
           structural protein; 1.90A {Salmonella typhimurium}
          Length = 248

 Score = 32.4 bits (72), Expect = 0.18
 Identities = 19/226 (8%), Positives = 53/226 (23%)

Query: 131 RNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTIANIETISTVL 190
              +A  +       +           +S  +  IQ   E I      T+++ +  S   
Sbjct: 15  SQAQAQNSQYALARTFATQKVSLEESVLSQVTTAIQTAQEKIVYAGNGTLSDDDRASLAT 74

Query: 191 ANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVNQILENIQVSS 250
                    M        +       + T               +     Q+     +  
Sbjct: 75  DLQGIRDQLMNLANSTDGNGRYIFAGYKTEAAPFDQATGGYHGGEKSVTQQVDSARTMVI 134

Query: 251 NNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSN 310
            +        I +           ++    +                    +  A     
Sbjct: 135 GHTGAQIFNSITSNAVPEPDGSDSEKNLFVMLDTAIAALKTPVEGNNVEKEKAAAAIDKT 194

Query: 311 MRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKI 356
            R   +++  +   R ++ + ++ +  + S  +D +      MS +
Sbjct: 195 NRGLKNSLNNVLTVRAELGTQLSELSTLDSLGSDRALGQKLQMSNL 240


>3bh2_A ADC, AAD, acetoacetate decarboxylase; lyase, plasmid, schiff base;
           2.40A {Clostridium acetobutylicum atcc 824}
          Length = 244

 Score = 32.2 bits (73), Expect = 0.28
 Identities = 11/54 (20%), Positives = 15/54 (27%), Gaps = 11/54 (20%)

Query: 25  IYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRFNGIPVGRIVGLFLDQEYP 78
                      G   E    IP           V FNG+    +  ++LD E  
Sbjct: 61  EIMAMHDTSGLGCYTESGQAIP-----------VSFNGVKGDYLHMMYLDNEPA 103


>2ch7_A Methyl-accepting chemotaxis protein; receptor, four-helix bundle,
           signal transduction, methyl-accepting receptor; 2.5A
           {Thermotoga maritima} SCOP: h.4.5.1 PDB: 2ch7_B
          Length = 309

 Score = 31.3 bits (69), Expect = 0.40
 Identities = 36/281 (12%), Positives = 83/281 (29%), Gaps = 16/281 (5%)

Query: 149 SNAENTSKKISDSSRHIQKIIENIEKPLTTTIANIETISTVLANNISHIDKMMHTTQVTP 208
              +N S +I   S  +Q+     E+ +++   NI   +   A+      ++        
Sbjct: 37  KEMDNISTRIESISASVQETTAGSEE-ISSATKNIADSAQQAASFADQSTQLAKEAGDAL 95

Query: 209 HSSDSKNTFNTITDLITSLDKMIKAIDLQKVNQILENIQVSSNNFVKSSDQVINTVHDVR 268
                     + +               +++   +E I   +      +           
Sbjct: 96  KKVIEVTRMISNSAKDVERVVESFQKGAEEITSFVETINAIAEQTNLLALNAAIEAARAG 155

Query: 269 ETTQTFQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNMRSSISAIREITDQRQKI 328
           E  + F  V  +I          +  +   A              +  A +  ++   ++
Sbjct: 156 EAGRGFAVVADEIRK--------LAEESQQASENVRRVVNEIRSIAEDAGKVSSEITARV 207

Query: 329 ISTINTIENITSNLNDSSQKFAELMSKINNI-SALKENNSLFKDAQRAMHTFRDTSEKIN 387
                  +     LN        +   + NI +A++E  +   +   AM      +E+I 
Sbjct: 208 EEGTKLADEADEKLNSIVGAVERINEMLQNIAAAIEEQTAAVDEITTAMTENAKNAEEIT 267

Query: 388 RYIPSIGNNLQNFSQS------GLNDIQNLVRKLQETVNHF 422
             +  +   LQ  S S       +  I+  V+ L+E V  +
Sbjct: 268 NSVKEVNARLQEISASTEEVTSRVQTIRENVQMLKEIVARY 308


>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomography,
           contractIle protein/transport protein complex; 24.00A
           {Gallus gallus}
          Length = 1080

 Score = 31.0 bits (69), Expect = 0.55
 Identities = 41/293 (13%), Positives = 89/293 (30%), Gaps = 31/293 (10%)

Query: 162 SRHIQKIIENIEKPLTTTIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTIT 221
            R +    E   KP++   A     +       +  + ++       HS+  +++F  + 
Sbjct: 377 HRKLATATETYIKPISKLHAINARDALAKHIYANLFNWIVDHVNKALHSTVKQHSFIGVL 436

Query: 222 DLITSLDKMIKAIDLQKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTF------Q 275
           D+       I + +   +N   E +Q   N  V   +Q       +  T   F       
Sbjct: 437 DIYGFETFEINSFEQFCINYANEKLQQQFNMHVFKLEQEEYMKEQIPWTLIDFYDNQPCI 496

Query: 276 EVGQKIDHLLS--DFSSKMKSKETSAFLENIADSTSNMRSSISAIREITDQRQKIIS--- 330
            + +    +L   D   KM       + + + ++  N  +     R     +  II    
Sbjct: 497 NLIEAKMGVLDLLDEECKMPKGSDDTWAQKLYNTHLNKCALFEKPR--LSNKAFIIKHFA 554

Query: 331 ---TINTIENITSNLNDSSQKFAELMSKINNISALKENNSLFKDAQRAMHTFRDTSEKIN 387
                     +  N +   ++  +++        L E   LF+D ++A+     T     
Sbjct: 555 DKVEYQCEGFLEKNKDTVYEEQIKVLKSSKKFKLLPE---LFQDEEKAISPTSATPSGRV 611

Query: 388 ------------RYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNN 428
                       R   +   + +       N +  L+  L  T  H+  C+  
Sbjct: 612 PLSRTPVKPAKARPGQTSKEHKKTVGHQFRNSLHLLMETLNATTPHYVRCIKP 664


>3l39_A Putative PHOU-like phosphate regulatory protein; BT4638, structural
           genomics, joint center for structural genomics, JCSG;
           1.93A {Bacteroides thetaiotaomicron}
          Length = 227

 Score = 31.1 bits (70), Expect = 0.58
 Identities = 26/177 (14%), Positives = 59/177 (33%), Gaps = 9/177 (5%)

Query: 145 NYFISNAENTSKKISDSSRHIQKIIENIEKPLTT---TIANIETISTVLANNISHIDKMM 201
           +   +   +  K+I D  R   ++   I   L+T   T  + E I  +     S +D ++
Sbjct: 52  HDLPTERADYYKQIKDMEREGDRLTHLIFDELSTTFITPFDREDIHDL----ASCMDDVI 107

Query: 202 HTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVNQILENIQVSSNNFVKSSDQVI 261
                +       N    I++    L ++I       + + ++ ++    N     D   
Sbjct: 108 DGINSSAKRIVIYN-PRPISESGKELSRLIHEEA-INIGKAMDELETFRKNPKPLRDYCT 165

Query: 262 NTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNMRSSISAI 318
                  +    ++    K+     D    +K KE    LE   D+  ++   +  +
Sbjct: 166 QLHDIENQADDVYELFITKLFEEEKDCIELIKIKEIMHELEKTTDAAEHVGKILKNL 222


>2ipc_A Preprotein translocase SECA subunit; nucleotide binding fold,
           ATPase, parallel dimer, structural genomics; 2.80A
           {Thermus thermophilus HB8}
          Length = 997

 Score = 30.5 bits (68), Expect = 0.71
 Identities = 12/46 (26%), Positives = 22/46 (47%)

Query: 319 REITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNISALKE 364
           REI    ++++  +N +E     L D +  + EL  K    ++L E
Sbjct: 14  REIARYYKQVVEPVNRLEAEVEKLPDLAAAYRELKEKHEKGASLDE 59


>2x2e_A Dynamin-1; nitration, hydrolase, membrane fission,
           nucleotide-binding, endocytosis, motor protein; HET:
           GDP; 2.00A {Homo sapiens} PDB: 2x2f_A*
          Length = 341

 Score = 30.6 bits (68), Expect = 0.74
 Identities = 23/214 (10%), Positives = 68/214 (31%), Gaps = 3/214 (1%)

Query: 147 FISNAENTSKKISDSSRHIQKIIENIEKPLTTTIANIETISTVLANNISHIDKMMHTTQV 206
            +     T   + D    I+  I ++     T    +    +   +++++ D +    +V
Sbjct: 129 LVDLPGMTKVPVGDQPPDIEFQIRDMLMQFVTKENCLILAVSPANSDLANSDALKVAKEV 188

Query: 207 TPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVNQILENIQVSSNNFVKSSDQVINTVHD 266
            P    +     T  DL+         ++ + +      I V + +      +   T   
Sbjct: 189 DPQGQRT-IGVITKLDLMDEGTDARDVLENKLLPLRRGYIGVVNRSQKDIDGKKDITAAL 247

Query: 267 VRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNMRSSISA-IREITDQR 325
             E  + F              +  ++         +I D+   +R+ + + +  I  + 
Sbjct: 248 AAER-KFFLSHPSYRHLADRMGTPYLQKVLNQQLTNHIRDTLPGLRNKLQSQLLSIEKEV 306

Query: 326 QKIISTINTIENITSNLNDSSQKFAELMSKINNI 359