HHsearch alignment for GI: 254780141 and conserved domain: COG3056

>COG3056 Uncharacterized lipoprotein [Cell envelope biogenesis, outer membrane].
Probab=97.65  E-value=0.0032  Score=37.14  Aligned_cols=156  Identities=10%  Similarity=0.097  Sum_probs=85.2

Q ss_pred             HHHHHHHCCCCCCCCCEEEECCCCCCCCCCCCC--CCC--EEEECCCCCCCCCCCEEEEEECCCEEEEECCCCCCCCHHH
Q ss_conf             999986304889998607970788876666666--620--8981530120006863789946976998146601256899
Q gi|254780141|r   21 LLCTSLSSCFFHNNPVNIYDLTESTKYDESVQR--HIQ--LIITEPITEKILNSEDIIVRSSPIEIQYLIGSQWSDKLPR   96 (208)
Q Consensus        21 ~~~~~l~~c~~~~~p~~~Y~L~~~~~~~~~~~~--~~~--i~v~~~~~~~~l~~~~Iv~~~~~~~~~~~~~~rW~~~p~~   96 (208)
T Consensus        23 aa~~lLagC~a~~---~tl~~tpp~~~~sqn~v~~~~~vsit~kD~R~~q~-----vA~v~~~~~lv~L~as~---~vr~   91 (204)
T COG3056          23 AAIFLLAGCAAPP---TTLIVTPPAPLPSQNPVLMGVTVSITGKDQRSDQA-----VAKVTRDNQLVKLTASR---DVRF   91 (204)
T ss_pred             HHHHHHHHCCCCC---CEEECCCCCCCCCCCCHHCCEEEEEECCCCHHHHH-----HHHHHCCCCEEEECCCC---CHHH
T ss_conf             9999997537997---50313699766443723314189997055016678-----87620479789834781---3999


Q ss_pred             HHHHHHHHHHHHHCCCEEEECCCCCCCCCEEEEEEEEEEEEECCCC--------EEEEEEEEEEEECCCCCEEEEEEEEE
Q ss_conf             9999999999731694065037677788359999999999635874--------79999999999457882778999999
Q gi|254780141|r   97 MIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFEINIDRH--------CAIITMSLKIINAHDNSLVGQKVFHV  168 (208)
Q Consensus        97 ~l~~~L~~~L~~~~~~~~v~~~~~~~~~~~~L~~~I~~f~~~~~~~--------~a~i~~~~~l~~~~~~~~~~~~~f~~  168 (208)
T Consensus        92 llq~vl~~q~~srG-fri-g-----~n~~~n~~i~V~qlya~V~qgnlryni~tkv~i~I~A---~~~~Gk~~Kny~at~  161 (204)
T COG3056          92 LLQEVLEKQMTSRG-FRV-G-----PNGEVNLQITVDQLYADVEQGNLRYNIDTKVDITITA---TAANGKMVKNYRATY  161 (204)
T ss_pred             HHHHHHHHHHHHCC-EEE-C-----CCCCCEEEEEHHHHHHHHHHCCEEECCCCEEEEEEEE---ECCCCCEEEEEEEEE
T ss_conf             99999999865343-675-3-----6898318998499663556331233025458899999---737871553245566


Q ss_pred             EEE-CCCCCHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             995-27799889999999999999999999
Q gi|254780141|r  169 EEK-LEKDNKLHFIQSLNRAFSRISSEIID  197 (208)
Q Consensus       169 ~~~-~~~~~~~~~v~Al~~Al~~l~~~ia~  197 (208)
T Consensus       162 ~~~GafsAsN~eI~~vln~v~ndvi~~i~q  191 (204)
T COG3056         162 NVEGAFSASNDEIADVLNSVLNDVIADIAQ  191 (204)
T ss_pred             EEEEEEECCCHHHHHHHHHHHHHHHHHHHC
T ss_conf             666554058867999999999999999853