BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780141|ref|YP_003064554.1| putative ABC transporter
protein [Candidatus Liberibacter asiaticus str. psy62]
         (208 letters)

Database: nr 
           13,984,884 sequences; 4,792,584,752 total letters

Searching..................................................done


Results from round 1


>gi|254780141|ref|YP_003064554.1| putative ABC transporter protein [Candidatus Liberibacter asiaticus
           str. psy62]
 gi|254039818|gb|ACT56614.1| putative ABC transporter protein [Candidatus Liberibacter asiaticus
           str. psy62]
          Length = 208

 Score =  419 bits (1078), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 208/208 (100%), Positives = 208/208 (100%)

Query: 1   MDKKLNKIIKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIIT 60
           MDKKLNKIIKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIIT
Sbjct: 1   MDKKLNKIIKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIIT 60

Query: 61  EPITEKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQ 120
           EPITEKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQ
Sbjct: 61  EPITEKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQ 120

Query: 121 GIYADYQIISAIRSFEINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHF 180
           GIYADYQIISAIRSFEINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHF
Sbjct: 121 GIYADYQIISAIRSFEINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHF 180

Query: 181 IQSLNRAFSRISSEIIDWTLSSLPLSDN 208
           IQSLNRAFSRISSEIIDWTLSSLPLSDN
Sbjct: 181 IQSLNRAFSRISSEIIDWTLSSLPLSDN 208


>gi|315122743|ref|YP_004063232.1| putative ABC transporter protein [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313496145|gb|ADR52744.1| putative ABC transporter protein [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 202

 Score =  275 bits (702), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 139/204 (68%), Positives = 169/204 (82%), Gaps = 2/204 (0%)

Query: 1   MDKKLNKIIKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIIT 60
           MDKKL KI K   + C  A+ LC  LSSCF  N P NI+DLTESTK+++S+Q +++L I 
Sbjct: 1   MDKKLKKITKNMRL-CIPAISLCMFLSSCF-GNIPKNIFDLTESTKHNQSIQHNVRLTIN 58

Query: 61  EPITEKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQ 120
           EP+T K L+S DIIVRSSP+EIQYLIGSQWSD+LPRM+QLKLIANFENNGKIST++KPNQ
Sbjct: 59  EPVTSKTLDSPDIIVRSSPVEIQYLIGSQWSDRLPRMVQLKLIANFENNGKISTIIKPNQ 118

Query: 121 GIYADYQIISAIRSFEINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHF 180
           GIY +YQI S IR+FEI+I  H AII +SLKII+ +  +++ QKVFHVEE  E+DNKL F
Sbjct: 119 GIYPNYQISSIIRAFEIDIHHHYAIIEISLKIIDINTGNIIAQKVFHVEEAFEEDNKLCF 178

Query: 181 IQSLNRAFSRISSEIIDWTLSSLP 204
           I+SLNRAFSRISSEII+WT+SSLP
Sbjct: 179 IESLNRAFSRISSEIINWTVSSLP 202


>gi|302353422|gb|ADL27917.1| putative ABC transporter protein [Candidatus Liberibacter
           asiaticus]
          Length = 112

 Score =  228 bits (580), Expect = 5e-58,   Method: Compositional matrix adjust.
 Identities = 112/112 (100%), Positives = 112/112 (100%)

Query: 97  MIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFEINIDRHCAIITMSLKIINAH 156
           MIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFEINIDRHCAIITMSLKIINAH
Sbjct: 1   MIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFEINIDRHCAIITMSLKIINAH 60

Query: 157 DNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEIIDWTLSSLPLSDN 208
           DNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEIIDWTLSSLPLSDN
Sbjct: 61  DNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEIIDWTLSSLPLSDN 112


>gi|190892032|ref|YP_001978574.1| putative ABC transporter protein [Rhizobium etli CIAT 652]
 gi|190697311|gb|ACE91396.1| putative ABC transporter protein [Rhizobium etli CIAT 652]
          Length = 203

 Score =  155 bits (391), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 79/196 (40%), Positives = 119/196 (60%), Gaps = 6/196 (3%)

Query: 9   IKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIITEPITEKIL 68
           I+  +I+  L  L+   LS C       + +DL+ +   D    +  Q+++  P   + L
Sbjct: 13  IRGTVIALPLTALI---LSGCGAAAKN-DTFDLSGAVDGDGPAAKSRQILVAGPTALRAL 68

Query: 69  NSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQI 128
           +SE I++R SP EIQYL  +QW DKLPRM+Q KL+  FEN+GK+  V  P QG+  DYQ+
Sbjct: 69  DSEQIVIRVSPSEIQYLSRAQWGDKLPRMVQSKLVEAFENSGKLGGVGLPGQGLAIDYQV 128

Query: 129 ISAIRSFEINI-DRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRA 187
           ++ IRSFEI+    + A++ +S+KI+N  + S+  QKVF        DN   F++SL+RA
Sbjct: 129 VTDIRSFEIDASSGNQAVVEISVKILNDRNGSVRAQKVFRATAPAGGDNA-GFVKSLDRA 187

Query: 188 FSRISSEIIDWTLSSL 203
           FS + SEI+ WTL S+
Sbjct: 188 FSTVVSEIVSWTLRSI 203


>gi|327190643|gb|EGE57731.1| putative ABC transporter protein [Rhizobium etli CNPAF512]
          Length = 203

 Score =  155 bits (391), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 79/196 (40%), Positives = 119/196 (60%), Gaps = 6/196 (3%)

Query: 9   IKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIITEPITEKIL 68
           I+  +I+  L  L+   LS C       + +DL+ +   D    +  Q+++  P   + L
Sbjct: 13  IRGTVIALPLTALI---LSGCGTAAKN-DTFDLSGAVDGDGPAAKSRQILVAGPTALRAL 68

Query: 69  NSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQI 128
           +SE I++R SP EIQYL  +QW DKLPRM+Q KL+  FEN+GK+  V  P QG+  DYQ+
Sbjct: 69  DSEQIVIRVSPSEIQYLSRAQWGDKLPRMVQSKLVEAFENSGKLGGVGLPGQGLAIDYQV 128

Query: 129 ISAIRSFEINI-DRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRA 187
           ++ IRSFEI+    + A++ +S+KI+N  + S+  QKVF        DN   F++SL+RA
Sbjct: 129 VTDIRSFEIDASSGNQAVVEISVKILNDRNGSVRAQKVFRATAPAGGDNA-GFVKSLDRA 187

Query: 188 FSRISSEIIDWTLSSL 203
           FS + SEI+ WTL S+
Sbjct: 188 FSTVVSEIVSWTLRSI 203


>gi|86357961|ref|YP_469853.1| putative ABC transporter protein [Rhizobium etli CFN 42]
 gi|86282063|gb|ABC91126.1| putative ABC transporter protein [Rhizobium etli CFN 42]
          Length = 203

 Score =  153 bits (387), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 76/196 (38%), Positives = 119/196 (60%), Gaps = 6/196 (3%)

Query: 9   IKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIITEPITEKIL 68
           I+  +I+  L  L+ +   +   ++     YDL+ +   D    +  Q++I  P   + L
Sbjct: 13  IRGTVIALPLTALILSGCGTAAKNDT----YDLSGAVDGDGPAAKSRQILIAGPTALRAL 68

Query: 69  NSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQI 128
           +SE I++R SP EIQYL  +QW DKLPR++Q KL+  FEN+GK+  V  P QG+  DYQI
Sbjct: 69  DSEQIVIRVSPSEIQYLSRAQWGDKLPRIVQSKLVEAFENSGKLGGVGMPGQGLAIDYQI 128

Query: 129 ISAIRSFEINI-DRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRA 187
           ++ IRSFEI+  + + A++ +S KI+N  + S+  QKVF        DN + F++ L+RA
Sbjct: 129 VTDIRSFEIDASNGNQAVVEISAKILNDRNGSVRAQKVFRAMAPAGGDN-VGFVKGLDRA 187

Query: 188 FSRISSEIIDWTLSSL 203
           F+ + SEI+ WTL S+
Sbjct: 188 FAAVVSEIVSWTLRSI 203


>gi|241204912|ref|YP_002976008.1| hypothetical protein Rleg_2192 [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240858802|gb|ACS56469.1| protein of unknown function DUF330 [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 203

 Score =  153 bits (387), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 80/196 (40%), Positives = 117/196 (59%), Gaps = 6/196 (3%)

Query: 9   IKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIITEPITEKIL 68
           I+  +I+  L  L+   LS C       + YDL  +        +  Q++I  P   + L
Sbjct: 13  IRGTVIALPLTALI---LSGCGTAAKN-DTYDLPAAVDGSGPAAKSRQILIASPTALRSL 68

Query: 69  NSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQI 128
           +SE I++R SP EIQYL  +QW DKLPR++Q KL+  FEN+GK+  V  P QG+  DYQI
Sbjct: 69  DSEQIVIRVSPSEIQYLSKAQWGDKLPRIVQSKLVEAFENSGKLGGVGMPGQGLAIDYQI 128

Query: 129 ISAIRSFEINIDR-HCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRA 187
           ++ IRSFEI+  R + A++ +S KI+N  + S+  QKVF        DN   F++ L+RA
Sbjct: 129 VTDIRSFEIDASRGNQAVVEISAKILNDRNGSVRAQKVFRAMAPAGGDND-GFVKGLDRA 187

Query: 188 FSRISSEIIDWTLSSL 203
           FS ++SEI+ WTL S+
Sbjct: 188 FSTVASEIVTWTLRSI 203


>gi|218461268|ref|ZP_03501359.1| putative ABC transporter protein [Rhizobium etli Kim 5]
          Length = 203

 Score =  152 bits (385), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 75/196 (38%), Positives = 119/196 (60%), Gaps = 6/196 (3%)

Query: 9   IKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIITEPITEKIL 68
           I+  +I+  L  L+ +   +   ++     YDL  +   D    +  Q++I  P   K L
Sbjct: 13  IRGTVIALPLTALILSGCGTAAKNDT----YDLAGAVDGDGPAAKTRQILIAGPTALKAL 68

Query: 69  NSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQI 128
           +SE I++R SP EIQYL  +QW D+LPR++Q KL+  FEN+GK+  V  P QG+  DYQI
Sbjct: 69  DSEQIVIRVSPSEIQYLSRAQWGDRLPRIVQSKLVEAFENSGKVGGVGMPGQGLAIDYQI 128

Query: 129 ISAIRSFEINI-DRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRA 187
           ++ IRSFEI+  + + A++ +S KI+N  + ++  QKVF        DN + F++ L+RA
Sbjct: 129 VTDIRSFEIDASNGNQAVVEISAKILNDRNGTVRAQKVFRAMAPAGGDN-VAFVKGLDRA 187

Query: 188 FSRISSEIIDWTLSSL 203
           F+ + SEI++WTL S+
Sbjct: 188 FAAVVSEIVNWTLRSI 203


>gi|209549575|ref|YP_002281492.1| ABC transporter [Rhizobium leguminosarum bv. trifolii WSM2304]
 gi|209535331|gb|ACI55266.1| putative ABC transporter protein [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 203

 Score =  152 bits (384), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 79/196 (40%), Positives = 117/196 (59%), Gaps = 6/196 (3%)

Query: 9   IKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIITEPITEKIL 68
           I+  +I+  L  L+   LS C       + YDL+ +   D    +  Q++I  P     +
Sbjct: 13  IRGTVIALPLTALI---LSGCGTAAKN-DTYDLSAAVDGDGPAAKSRQILIASPTALNAV 68

Query: 69  NSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQI 128
            SE I++R SP EIQYL  +QW DKLPRM+Q KL+  FEN+GK+  V  P QG+  DYQ+
Sbjct: 69  GSEQIVIRVSPSEIQYLSRAQWGDKLPRMVQSKLVEAFENSGKLGGVGIPGQGLAIDYQV 128

Query: 129 ISAIRSFEINI-DRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRA 187
           ++ IRSFEI+  + + A++ +S KI+N  + S+  QKVF        DN   F++ L+RA
Sbjct: 129 VTDIRSFEIDASNGNQAVVEISAKILNDRNGSVRAQKVFRAVAPAGGDNA-GFVKGLDRA 187

Query: 188 FSRISSEIIDWTLSSL 203
           FS + SEI++WTL S+
Sbjct: 188 FSTVVSEIVNWTLRSI 203


>gi|116252404|ref|YP_768242.1| hypothetical protein RL2658 [Rhizobium leguminosarum bv. viciae
           3841]
 gi|115257052|emb|CAK08146.1| conserved hypothetical protein [Rhizobium leguminosarum bv. viciae
           3841]
          Length = 203

 Score =  150 bits (379), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 76/196 (38%), Positives = 116/196 (59%), Gaps = 6/196 (3%)

Query: 9   IKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIITEPITEKIL 68
           I+  +I+  L  L+ +   +   ++     YDL  +        +  Q++I  P   + L
Sbjct: 13  IRGTVIALPLTALILSGCGTAAKNDT----YDLPAAVDGSGPAAKSRQILIASPTALRSL 68

Query: 69  NSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQI 128
           +SE I++R SP EIQYL  +QW DKLPR++Q KL+  FEN+GK+  V  P QG+  DYQI
Sbjct: 69  DSEQIVIRVSPSEIQYLSKAQWGDKLPRIVQSKLVEAFENSGKLGGVGMPGQGLAIDYQI 128

Query: 129 ISAIRSFEINIDR-HCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRA 187
           ++ IRSFEI+    + A++ +S KI+N  + S+  QKVF        DN   F++ L+RA
Sbjct: 129 VTDIRSFEIDASHGNQAVVEISAKILNDRNGSVRAQKVFRAMAPAGGDND-GFVKGLDRA 187

Query: 188 FSRISSEIIDWTLSSL 203
           FS ++SEI+ WTL S+
Sbjct: 188 FSTVASEIVSWTLRSI 203


>gi|15888954|ref|NP_354635.1| hypothetical protein Atu1644 [Agrobacterium tumefaciens str. C58]
 gi|15156733|gb|AAK87420.1| conserved hypothetical protein [Agrobacterium tumefaciens str. C58]
          Length = 201

 Score =  150 bits (379), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 73/188 (38%), Positives = 117/188 (62%), Gaps = 3/188 (1%)

Query: 18  LAVLLCTSLSSCFFHNNPVNIYDLTESTKY--DESVQRHIQLIITEPITEKILNSEDIIV 75
           LA L    ++ C    N  + +DL+ S+         +  QL+I +P   K L+SE+I+V
Sbjct: 15  LAPLFAALMAGCAGAPNN-DTFDLSVSSAAVTQGPSLKSRQLLIADPTALKALDSENIVV 73

Query: 76  RSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSF 135
           R S  E+QYL  SQWSD+LPRM+Q KL+  FE+ GK+  V +P QG+  DYQ++S IR+F
Sbjct: 74  RLSGSEVQYLGNSQWSDRLPRMVQSKLVEAFEDTGKLGGVGRPGQGLAIDYQVVSDIRAF 133

Query: 136 EINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEI 195
           EI+  R+ A I +S+K++N  + ++  Q+VF    ++      +F+++L++AF+  + EI
Sbjct: 134 EIDTARNVANIEISVKLLNDRNGTVKAQEVFRASARVSGSGNANFVKALDQAFAAATREI 193

Query: 196 IDWTLSSL 203
           + WTL SL
Sbjct: 194 VAWTLKSL 201


>gi|222148410|ref|YP_002549367.1| hypothetical protein Avi_1896 [Agrobacterium vitis S4]
 gi|221735398|gb|ACM36361.1| conserved hypothetical protein [Agrobacterium vitis S4]
          Length = 204

 Score =  147 bits (372), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 72/192 (37%), Positives = 121/192 (63%), Gaps = 7/192 (3%)

Query: 15  SCSLAVLLCTSLSSCFFHNNPVNIYDLT--ESTKYDESVQRHIQLIITEPITEKILNSED 72
           +C+L++L    L+ C    +P + YDL    +    +S Q+  Q+++ +P   K+L+S+ 
Sbjct: 17  ACALSIL-GVMLAGC--GTSPNDTYDLASIRAATTTQSAQKR-QVLVADPTALKVLDSDM 72

Query: 73  IIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAI 132
           I+VR S  E+QYL  SQWSDKLPRM+Q KL+  FEN GK+  V KP QG+  DYQ++S I
Sbjct: 73  IVVRVSGTEMQYLAKSQWSDKLPRMVQSKLVEAFENTGKLGGVGKPGQGLAIDYQLLSDI 132

Query: 133 RSFEINIDR-HCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRI 191
           R+FE+       A + +S+K++N  + S++ QKVF         +    + +L++AF+++
Sbjct: 133 RTFEVEAGGIRRANVEISVKLLNDRNGSVISQKVFSASVPARGGDNQALVNALSQAFAKV 192

Query: 192 SSEIIDWTLSSL 203
           S +I++WTL+++
Sbjct: 193 SGDIVNWTLTTI 204


>gi|325293031|ref|YP_004278895.1| ABC transporter [Agrobacterium sp. H13-3]
 gi|325060884|gb|ADY64575.1| putative ABC transporter protein [Agrobacterium sp. H13-3]
          Length = 201

 Score =  147 bits (371), Expect = 8e-34,   Method: Compositional matrix adjust.
 Identities = 64/148 (43%), Positives = 102/148 (68%)

Query: 56  QLIITEPITEKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTV 115
           QL+I +P   K L+SE+I+VR S  E+QYL  SQWSD+LPRM+Q KL+  FE+ GK+  V
Sbjct: 54  QLLIADPTALKALDSENIVVRLSGSEVQYLGNSQWSDRLPRMVQSKLVQAFEDTGKLGGV 113

Query: 116 VKPNQGIYADYQIISAIRSFEINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKD 175
            +P QG+  DYQ++S IR+FEI+  ++ A I +S+K++N  + ++  Q+VF    ++   
Sbjct: 114 GRPGQGLAIDYQVVSDIRTFEIDTAKNTADIEISVKLLNDRNGTVKAQEVFRASARVSGS 173

Query: 176 NKLHFIQSLNRAFSRISSEIIDWTLSSL 203
              +F+++L++AF+  + EI+ WTL SL
Sbjct: 174 GNANFVKALDQAFAAATREIVAWTLKSL 201


>gi|218670693|ref|ZP_03520364.1| putative ABC transporter protein [Rhizobium etli GR56]
          Length = 203

 Score =  147 bits (371), Expect = 9e-34,   Method: Compositional matrix adjust.
 Identities = 77/196 (39%), Positives = 118/196 (60%), Gaps = 6/196 (3%)

Query: 9   IKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIITEPITEKIL 68
           I+  +I+  L  L+   LS C       + YDL  +   D    +  Q++I  P   + L
Sbjct: 13  IRGTVIALPLTALI---LSGCGTAAKN-DTYDLAGTVDGDGPAAKSRQILIAGPTALRSL 68

Query: 69  NSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQI 128
           +SE I++R SP EIQYL  +QW DKLPR++Q KL+  FEN+GK+  V  P QG+  DYQ+
Sbjct: 69  DSEQIVIRVSPSEIQYLSRAQWGDKLPRIVQSKLVEAFENSGKLGGVGLPGQGLAIDYQV 128

Query: 129 ISAIRSFEINI-DRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRA 187
           ++ IRSFEI+    + A++ +S+K++N  + S+  QKVF        DN + F+++L+ A
Sbjct: 129 VTDIRSFEIDASSGNQAVVEISVKLLNDRNGSVRAQKVFRAMAPAGGDN-VGFVKALDHA 187

Query: 188 FSRISSEIIDWTLSSL 203
           FS + SEI+ WTL S+
Sbjct: 188 FSIVVSEIVSWTLRSI 203


>gi|222086197|ref|YP_002544729.1| ABC transporter protein [Agrobacterium radiobacter K84]
 gi|221723645|gb|ACM26801.1| ABC transporter protein [Agrobacterium radiobacter K84]
          Length = 218

 Score =  143 bits (360), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 76/186 (40%), Positives = 111/186 (59%), Gaps = 5/186 (2%)

Query: 21  LLCTSLSSCFFHNNPVN-IYDLTESTKYDESVQRHIQLIITEPITEKILNSEDIIVRSSP 79
           LL   LS C   + P N  YDL+ S K    + +  Q++I  P   + L+S  I++R SP
Sbjct: 35  LLAALLSGC--GSKPSNDTYDLSASVKASGPLMKGKQILIPPPTALQALDSNLIVIRVSP 92

Query: 80  IEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFEINI 139
            EIQYL  +QWSDKL RM+Q KL+  FEN GK+  V  P QG+  DYQI++ IRSFEI+ 
Sbjct: 93  SEIQYLGKAQWSDKLSRMVQSKLVEAFENTGKLGGVGVPGQGLAIDYQIVTDIRSFEIDA 152

Query: 140 --DRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEIID 197
              +  A + +S+KI+N    ++  Q VF     +   +   FI+ L+ AF+ +++EI+D
Sbjct: 153 AGGQKSAAVEISVKILNDRTGTIKSQSVFRKVVPVTGGSNPDFIRGLDTAFAGVTAEIVD 212

Query: 198 WTLSSL 203
           W+L SL
Sbjct: 213 WSLRSL 218


>gi|90417912|ref|ZP_01225824.1| conserved hypothetical protein [Aurantimonas manganoxydans
           SI85-9A1]
 gi|90337584|gb|EAS51235.1| conserved hypothetical protein [Aurantimonas manganoxydans
           SI85-9A1]
          Length = 194

 Score =  139 bits (351), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 66/193 (34%), Positives = 116/193 (60%), Gaps = 6/193 (3%)

Query: 11  KKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYD--ESVQRHIQLIITEPITEKIL 68
           +  +  S   LL   LS+C   + P + Y+++     D  E   R  QL+I EP   + +
Sbjct: 2   RAALKSSFVALLALGLSAC--ASTPPDTYEISPPPFSDVREGKSRR-QLLIPEPTALETI 58

Query: 69  NSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQI 128
           +S+ II++ SP  IQ+L  SQWSD+LPR++QL+L+  FEN G I  +  P QG+  DYQ+
Sbjct: 59  DSKRIIIKPSPNSIQFLGDSQWSDRLPRLVQLRLLQAFENTGSIGAIGVPGQGLAIDYQL 118

Query: 129 ISAIRSFEINI-DRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRA 187
           +  IR FE+N+     A + +S+K++N  + +++  ++F+ +  +       F+ +L++A
Sbjct: 119 VMEIRRFEVNVTGAATAEVQISVKVLNDRNGTVLRTRIFNAQAPVNGAGNPAFVAALDKA 178

Query: 188 FSRISSEIIDWTL 200
           F ++S+EI+DWT+
Sbjct: 179 FEQVSAEIVDWTI 191


>gi|114707112|ref|ZP_01440010.1| hypothetical protein FP2506_04376 [Fulvimarina pelagi HTCC2506]
 gi|114537308|gb|EAU40434.1| hypothetical protein FP2506_04376 [Fulvimarina pelagi HTCC2506]
          Length = 193

 Score =  131 bits (330), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 58/147 (39%), Positives = 96/147 (65%), Gaps = 1/147 (0%)

Query: 56  QLIITEPITEKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTV 115
           QL+I EP   K ++SE I+V+ +P  ++YL  SQWSD+LPRM+QL+L+  FEN G++  V
Sbjct: 45  QLLIPEPTAIKTIDSERIVVKPTPYSVEYLADSQWSDRLPRMVQLRLLQAFENTGQVGAV 104

Query: 116 VKPNQGIYADYQIISAIRSFEIN-IDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEK 174
             P QG+  DYQII  IR FE++ ++   A+I +S+K ++  + ++   ++F     +  
Sbjct: 105 GVPGQGLAIDYQIILEIRRFEVDVVNERQAVIEISVKALDDRNGTVRRTQIFTGRAPVAG 164

Query: 175 DNKLHFIQSLNRAFSRISSEIIDWTLS 201
                F+ +++RAF ++SSEI+ WTL+
Sbjct: 165 SGNSAFVAAIDRAFDQVSSEIVAWTLA 191


>gi|15965583|ref|NP_385936.1| hypothetical protein SMc00177 [Sinorhizobium meliloti 1021]
 gi|307302703|ref|ZP_07582459.1| protein of unknown function DUF330 [Sinorhizobium meliloti BL225C]
 gi|307318551|ref|ZP_07597985.1| protein of unknown function DUF330 [Sinorhizobium meliloti AK83]
 gi|15074764|emb|CAC46409.1| Hypothetical protein SMc00177 [Sinorhizobium meliloti 1021]
 gi|306895891|gb|EFN26643.1| protein of unknown function DUF330 [Sinorhizobium meliloti AK83]
 gi|306903067|gb|EFN33658.1| protein of unknown function DUF330 [Sinorhizobium meliloti BL225C]
          Length = 204

 Score =  130 bits (326), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 62/183 (33%), Positives = 104/183 (56%), Gaps = 2/183 (1%)

Query: 22  LCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIITEPITEKILNSEDIIVRSSPIE 81
           L   L+ C       + + L      +     + QL++ EP   K L S+ I+VR S  E
Sbjct: 23  LAAILAGCGSRQAANDTFSLASVPAVERPGATNRQLLVPEPTALKTLGSDQIVVRLSRSE 82

Query: 82  IQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFEINIDR 141
           +QYL  +QW D LPRM+Q +L+  F+N G+I  V KP QG+  DYQ+I+ +R+FEI+ D 
Sbjct: 83  LQYLARAQWGDSLPRMVQDRLVQTFDNTGRIR-VGKPGQGLAIDYQLITELRAFEISTDG 141

Query: 142 HC-AIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEIIDWTL 200
              A++ +  KI++  + ++  Q+ F     +       F+ +L+ AF+R++++I+ WTL
Sbjct: 142 AATAVVEIFAKILDDRNGTVRKQQAFRAVVPVRGAGNPAFVAALDAAFARVAADIVGWTL 201

Query: 201 SSL 203
           SS+
Sbjct: 202 SSI 204


>gi|150396761|ref|YP_001327228.1| hypothetical protein Smed_1551 [Sinorhizobium medicae WSM419]
 gi|150028276|gb|ABR60393.1| protein of unknown function DUF330 [Sinorhizobium medicae WSM419]
          Length = 204

 Score =  127 bits (319), Expect = 9e-28,   Method: Compositional matrix adjust.
 Identities = 61/195 (31%), Positives = 109/195 (55%), Gaps = 2/195 (1%)

Query: 10  KKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIITEPITEKILN 69
           +   +  ++ + L   L+ C       + + L      D +   + QL++ EP   K L 
Sbjct: 11  RAGAVRSAVVLTLGMVLAGCGSGKAVNDTFSLASVPTVDRASATNRQLLVPEPTALKTLG 70

Query: 70  SEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQII 129
           S+ I+VR S  E+QYL  +QW D LPRM+Q +L+  F+N G+I  V KP QG+  DYQ+I
Sbjct: 71  SDQILVRLSSSELQYLAKAQWGDSLPRMVQDRLVQTFDNTGRIR-VGKPGQGLAIDYQLI 129

Query: 130 SAIRSFEINIDRHC-AIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAF 188
           + +R+FEI+ D    A++ +  KI++  + ++  Q+ F     +       F+ +L+ AF
Sbjct: 130 AELRAFEISTDGPARAVVEIFAKILDDRNGTVRKQQAFRAVVPVRGAGNPAFVAALDAAF 189

Query: 189 SRISSEIIDWTLSSL 203
           ++++++I+ WTL S+
Sbjct: 190 AQVAADIVGWTLRSI 204


>gi|227822228|ref|YP_002826199.1| putative ABC transporter protein [Sinorhizobium fredii NGR234]
 gi|227341228|gb|ACP25446.1| putative ABC transporter protein [Sinorhizobium fredii NGR234]
          Length = 205

 Score =  127 bits (319), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 55/183 (30%), Positives = 105/183 (57%), Gaps = 1/183 (0%)

Query: 22  LCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIITEPITEKILNSEDIIVRSSPIE 81
           L   L+ C       + + L  +   +     + Q+++ EP   K L S+ I+VR S  E
Sbjct: 23  LTALLAGCGTRQAANDTFSLASTPVVERPAATNRQILVPEPTALKTLGSDQIVVRLSKSE 82

Query: 82  IQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFEINIDR 141
           +Q+L  +QW D LPR++Q +L+  F+N G++  V KP QG+  DYQ+++ +R+FEI+ D 
Sbjct: 83  LQFLAQAQWGDSLPRLVQDRLVQTFDNTGRVRGVGKPGQGLAIDYQLVTELRAFEISTDG 142

Query: 142 -HCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEIIDWTL 200
              A++ +  KI++  + ++  Q+ F     ++      F+ +L+ AF++++++I+ WTL
Sbjct: 143 PDTAVVEIFAKILDDRNGTVRRQQAFRAVAPVQGAGNPAFVAALDAAFAQVAADIVSWTL 202

Query: 201 SSL 203
            S+
Sbjct: 203 RSI 205


>gi|163759627|ref|ZP_02166712.1| putative ABC transporter protein [Hoeflea phototrophica DFL-43]
 gi|162283224|gb|EDQ33510.1| putative ABC transporter protein [Hoeflea phototrophica DFL-43]
          Length = 199

 Score =  126 bits (316), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 62/172 (36%), Positives = 107/172 (62%), Gaps = 1/172 (0%)

Query: 33  NNPVNIYDLTESTKYDESVQRHIQLIITEPITEKILNSEDIIVRSSPIEIQYLIGSQWSD 92
           + P + Y L+ +        R+ Q++I+EP   K L+SE I++R SP  IQYL  SQWSD
Sbjct: 28  STPPDTYGLSPAPAVTGDSARNRQILISEPTALKALDSEQIVIRPSPSAIQYLADSQWSD 87

Query: 93  KLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFEINIDR-HCAIITMSLK 151
           +LP+++Q KL+  FEN+G++  V +P +G+  D++II+AIRSFEI  D    A++ +S K
Sbjct: 88  RLPKIVQDKLVQAFENSGRVGGVGRPGEGLAIDFKIITAIRSFEIRADAGEQAVVEISAK 147

Query: 152 IINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEIIDWTLSSL 203
           ++N  +  +   +VF     +       ++++L+RAF  + ++++ WTLS +
Sbjct: 148 VLNDRNGVVAATRVFRGNSSVTGTGNAAYVRALDRAFETVVADLVTWTLSRI 199


>gi|110633896|ref|YP_674104.1| ABC-type uncharacterized transport system auxiliary component-like
           [Mesorhizobium sp. BNC1]
 gi|110284880|gb|ABG62939.1| ABC-type uncharacterized transport system auxiliary component-like
           protein [Chelativorans sp. BNC1]
          Length = 228

 Score =  125 bits (313), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 57/187 (30%), Positives = 105/187 (56%), Gaps = 5/187 (2%)

Query: 20  VLLCTSLSSC----FFHNNPVNIYDLTEST-KYDESVQRHIQLIITEPITEKILNSEDII 74
           V+L   L  C     F   PV++YDLT    +   + +   Q+++ EP   KIL+ EDI 
Sbjct: 40  VILSLMLGGCAAIPGFGPAPVDVYDLTAPALQLAAARRARTQVLVPEPEALKILDGEDIA 99

Query: 75  VRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRS 134
           +R+S   +Q L G++WSD+LPR++Q  L+  ++ +G  + V +P +G+  DYQ+I  IR+
Sbjct: 100 IRTSTGALQLLGGARWSDRLPRLVQSGLVEAYQKSGSFAGVGRPGEGLAIDYQVIVDIRT 159

Query: 135 FEINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSE 194
           FE+ +    A + + +++++     +   + F     +     + F+ +LN+AF+  + E
Sbjct: 160 FEVQVGNGLAQVQLFVRVLDDRTGQVRASRDFTTSAPVVGSGDVAFVAALNQAFNAATRE 219

Query: 195 IIDWTLS 201
           I+DW+ S
Sbjct: 220 IVDWSRS 226


>gi|153009440|ref|YP_001370655.1| lipoprotein [Ochrobactrum anthropi ATCC 49188]
 gi|151561328|gb|ABS14826.1| lipoprotein, hypothetical [Ochrobactrum anthropi ATCC 49188]
          Length = 209

 Score =  117 bits (293), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 57/192 (29%), Positives = 108/192 (56%), Gaps = 4/192 (2%)

Query: 15  SCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQR-HIQLIITEPITEKILNSEDI 73
           + S+ VLL   L+ C     P++ ++L+       S  R + QL++  P   K L+SE+I
Sbjct: 19  TTSICVLLSILLAGCG-TTTPLDTFNLSAPQPGVSSPSRKNTQLLVPTPTALKALDSENI 77

Query: 74  IVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIR 133
           +V S+P  I+YL G+QW D+L  ++Q +L+  +EN G    + +P  G+  +YQI++ +R
Sbjct: 78  VVSSAPGSIEYLKGAQWGDRLTNIVQSRLVQAYENTGVFGGIGRPGDGLAINYQILTDLR 137

Query: 134 SFEIN--IDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRI 191
            F I        A++ +++K++N  +  +   +VF     +       ++++L+ AF R 
Sbjct: 138 MFGIQAYASPKLAVVELAVKLMNDKNGEVRATRVFRTAIPVSGATNAAYVKALDAAFERT 197

Query: 192 SSEIIDWTLSSL 203
           +SEI+ WT+++L
Sbjct: 198 ASEIVSWTVTAL 209


>gi|254719098|ref|ZP_05180909.1| hypothetical protein Bru83_06095 [Brucella sp. 83/13]
 gi|265984089|ref|ZP_06096824.1| lipoprotein [Brucella sp. 83/13]
 gi|264662681|gb|EEZ32942.1| lipoprotein [Brucella sp. 83/13]
          Length = 200

 Score =  116 bits (290), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 55/190 (28%), Positives = 109/190 (57%), Gaps = 4/190 (2%)

Query: 17  SLAVLLCTSLSSCFFHNNPVNIYDL-TESTKYDESVQRHIQLIITEPITEKILNSEDIIV 75
           S+AVLL   L+ C     P++ ++L T         ++++QL+I  P   K L+SE+I+V
Sbjct: 12  SVAVLLTAFLAGCG-TTTPLDTFNLSTPQPMVTVPKRKNLQLLIPGPAALKALDSENIVV 70

Query: 76  RSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSF 135
            S+P  I+YL G+QW D+L  ++Q +L+  +EN G    + +P  G+  +YQ+++ +R F
Sbjct: 71  SSAPGSIEYLKGAQWGDRLTNIVQSRLVQAYENTGAFGGIGRPGDGLAINYQVLTDLRMF 130

Query: 136 EIN--IDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISS 193
            I        A++ M++++++     +   +VF     +   +   ++++L++AF +  +
Sbjct: 131 GIQAYTSPQTAVVEMAVRLLSDKTGEVRATRVFRTAIPVTGTSNAAYVKALDKAFDQTVN 190

Query: 194 EIIDWTLSSL 203
           EI+ WT+S+L
Sbjct: 191 EIVSWTISTL 200


>gi|306838382|ref|ZP_07471227.1| lipoprotein [Brucella sp. NF 2653]
 gi|306406522|gb|EFM62756.1| lipoprotein [Brucella sp. NF 2653]
          Length = 209

 Score =  115 bits (289), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 55/190 (28%), Positives = 109/190 (57%), Gaps = 4/190 (2%)

Query: 17  SLAVLLCTSLSSCFFHNNPVNIYDL-TESTKYDESVQRHIQLIITEPITEKILNSEDIIV 75
           S+AVLL   L+ C     P++ ++L T         ++++QL+I  P   K L+SE+I+V
Sbjct: 21  SVAVLLTAFLAGCG-TTTPLDTFNLSTPQPMVTVPKRKNLQLLIPGPAALKALDSENIVV 79

Query: 76  RSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSF 135
            S+P  I+YL G+QW D+L  ++Q +L+  +EN G    + +P  G+  +YQ+++ +R F
Sbjct: 80  SSAPGSIEYLKGAQWGDRLTNIVQSRLVQAYENTGAFGGIGRPGDGLAINYQVLTDLRMF 139

Query: 136 EIN--IDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISS 193
            I        A++ M++++++     +   +VF     +   +   ++++L++AF +  +
Sbjct: 140 GIQAYTSPQTAVVEMAVRLLSDKTGEVRATRVFRTAIPVTGTSNAAYVKALDKAFDQTVN 199

Query: 194 EIIDWTLSSL 203
           EI+ WT+S+L
Sbjct: 200 EIVSWTISTL 209


>gi|306843896|ref|ZP_07476491.1| lipoprotein [Brucella sp. BO1]
 gi|306275651|gb|EFM57375.1| lipoprotein [Brucella sp. BO1]
          Length = 209

 Score =  115 bits (287), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 54/190 (28%), Positives = 109/190 (57%), Gaps = 4/190 (2%)

Query: 17  SLAVLLCTSLSSCFFHNNPVNIYDL-TESTKYDESVQRHIQLIITEPITEKILNSEDIIV 75
           S+A+LL   L+ C     P++ ++L T         ++++QL+I  P   K L+SE+I+V
Sbjct: 21  SVAILLTAFLAGCG-TTTPLDTFNLSTPQPMVTVPKRKNLQLLIPGPAALKALDSENIVV 79

Query: 76  RSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSF 135
            S+P  I+YL G+QW D+L  ++Q +L+  +EN G    + +P  G+  +YQ+++ +R F
Sbjct: 80  SSAPGSIEYLKGAQWGDRLTNIVQSRLVQAYENTGAFGGIGRPGDGLAINYQVLTDLRMF 139

Query: 136 EIN--IDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISS 193
            I        A++ M++++++     +   +VF     +   +   ++++L++AF +  +
Sbjct: 140 GIQAYTSPQTAVVEMAVRLLSDKTGEVRATRVFRTAIPVTGTSNAAYVKALDKAFDQTVN 199

Query: 194 EIIDWTLSSL 203
           EI+ WT+S+L
Sbjct: 200 EIVSWTISTL 209


>gi|239831968|ref|ZP_04680297.1| lipoprotein [Ochrobactrum intermedium LMG 3301]
 gi|239824235|gb|EEQ95803.1| lipoprotein [Ochrobactrum intermedium LMG 3301]
          Length = 209

 Score =  114 bits (284), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 54/204 (26%), Positives = 113/204 (55%), Gaps = 6/204 (2%)

Query: 5   LNKIIKKKII--SCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQR-HIQLIITE 61
            N +  ++++  + S+  +    L+ C     P++ ++L+       S  R ++QL++  
Sbjct: 7   FNDMKSRRVVLRTASVPFIFGLLLAGCG-TTTPLDTFNLSAPQPGVTSPSRKNVQLLVPT 65

Query: 62  PITEKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQG 121
           P   K L+SE+I+V S+P  I+YL G+QW D+L  ++Q +L+  +EN G    + +P  G
Sbjct: 66  PTALKALDSENIVVSSAPGSIEYLKGAQWGDRLTNIVQSRLVQAYENTGIFGGIGRPGDG 125

Query: 122 IYADYQIISAIRSFEIN--IDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLH 179
           +  +YQI++ +R F I        A++ ++++++N  +  +   +VF     +       
Sbjct: 126 LAINYQILTDLRMFGIQAYASPKLAVVELAVRLMNDKNGEVRATRVFRTAIPVGGATNAA 185

Query: 180 FIQSLNRAFSRISSEIIDWTLSSL 203
           ++++L+ AF R +SEI+ WT+++L
Sbjct: 186 YVKALDAAFERTASEIVSWTVTTL 209


>gi|304391805|ref|ZP_07373747.1| lipoprotein [Ahrensia sp. R2A130]
 gi|303296034|gb|EFL90392.1| lipoprotein [Ahrensia sp. R2A130]
          Length = 195

 Score =  113 bits (283), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 58/195 (29%), Positives = 102/195 (52%), Gaps = 5/195 (2%)

Query: 8   IIKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQR--HIQLIITEPITE 65
           +I K I +  LA  + +          P   Y+ + +  +D  V    + QL++  P + 
Sbjct: 1   MIFKAITTTLLAAFVLSGCQLLKAPEKPRETYEFS-APSFDGGVAGGTNAQLLVKLPTSL 59

Query: 66  KILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYAD 125
           K ++SE +I+R +P  I Y+ G+QWSD +PR++Q KL+  FEN G      KP  G+  D
Sbjct: 60  KAIDSERMILRPTPKIITYVAGAQWSDSVPRLVQAKLVEAFENTGSAGATAKPGDGLVID 119

Query: 126 YQIISAIRSFEINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLN 185
           +Q+I  IR FEI      A+I +S+K+++     +V  ++F        +   +++ + +
Sbjct: 120 FQLIPDIRRFEIIGGE--AVIEVSIKLLSDKSGRVVASRIFTTSAATGGNQPENYVAAFD 177

Query: 186 RAFSRISSEIIDWTL 200
           RAFS  + ++I WT 
Sbjct: 178 RAFSSFAEDVIAWTF 192


>gi|148558849|ref|YP_001258963.1| putative lipoprotein [Brucella ovis ATCC 25840]
 gi|148370106|gb|ABQ60085.1| putative lipoprotein [Brucella ovis ATCC 25840]
          Length = 200

 Score =  112 bits (279), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 53/190 (27%), Positives = 108/190 (56%), Gaps = 4/190 (2%)

Query: 17  SLAVLLCTSLSSCFFHNNPVNIYDL-TESTKYDESVQRHIQLIITEPITEKILNSEDIIV 75
           S+A+LL   L+ C     P++ ++L T         ++++QL+I  P   K L+SE+I+V
Sbjct: 12  SVAILLTAFLAGCG-TTTPLDTFNLSTPQPMVTVPKRKNLQLLIPGPAALKALDSENIVV 70

Query: 76  RSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSF 135
            S+P  I+YL G+QW D+L  ++Q +L+  +EN      + +P  G+  +YQ+++ +R F
Sbjct: 71  SSAPGSIEYLKGAQWGDRLTNIVQSRLVQAYENTSAFGGIGRPGDGLAINYQVLTDLRMF 130

Query: 136 EIN--IDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISS 193
            I        A++ M++++++     +   +VF     +   +   ++++L++AF +  +
Sbjct: 131 GIQAYTSPQTAVVEMAVRLLSNKTGEVRATRVFRTAIPVTGTSNAAYVKALDKAFDQTVN 190

Query: 194 EIIDWTLSSL 203
           EI+ WT+S+L
Sbjct: 191 EIVSWTISTL 200


>gi|23501902|ref|NP_698029.1| putative lipoprotein [Brucella suis 1330]
 gi|62289945|ref|YP_221738.1| lipoprotein [Brucella abortus bv. 1 str. 9-941]
 gi|82699873|ref|YP_414447.1| hypothetical protein BAB1_1041 [Brucella melitensis biovar Abortus
           2308]
 gi|161618974|ref|YP_001592861.1| hypothetical protein BCAN_A1037 [Brucella canis ATCC 23365]
 gi|225627500|ref|ZP_03785537.1| lipoprotein [Brucella ceti str. Cudo]
 gi|225852527|ref|YP_002732760.1| hypothetical protein BMEA_A1063 [Brucella melitensis ATCC 23457]
 gi|254689252|ref|ZP_05152506.1| hypothetical protein Babob68_03556 [Brucella abortus bv. 6 str.
           870]
 gi|254693736|ref|ZP_05155564.1| hypothetical protein Babob3T_03559 [Brucella abortus bv. 3 str.
           Tulya]
 gi|254697387|ref|ZP_05159215.1| hypothetical protein Babob28_06690 [Brucella abortus bv. 2 str.
           86/8/59]
 gi|254701773|ref|ZP_05163601.1| hypothetical protein Bsuib55_13076 [Brucella suis bv. 5 str. 513]
 gi|254704315|ref|ZP_05166143.1| hypothetical protein Bsuib36_10369 [Brucella suis bv. 3 str. 686]
 gi|254706783|ref|ZP_05168611.1| hypothetical protein BpinM_07295 [Brucella pinnipedialis
           M163/99/10]
 gi|254710107|ref|ZP_05171918.1| hypothetical protein BpinB_07496 [Brucella pinnipedialis B2/94]
 gi|254714108|ref|ZP_05175919.1| hypothetical protein BcetM6_12275 [Brucella ceti M644/93/1]
 gi|254716835|ref|ZP_05178646.1| hypothetical protein BcetM_10519 [Brucella ceti M13/05/1]
 gi|254730285|ref|ZP_05188863.1| hypothetical protein Babob42_03599 [Brucella abortus bv. 4 str.
           292]
 gi|256031603|ref|ZP_05445217.1| hypothetical protein BpinM2_13278 [Brucella pinnipedialis
           M292/94/1]
 gi|256044681|ref|ZP_05447585.1| hypothetical protein Bmelb1R_09313 [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|256061114|ref|ZP_05451268.1| hypothetical protein Bneo5_12212 [Brucella neotomae 5K33]
 gi|256113575|ref|ZP_05454395.1| hypothetical protein Bmelb3E_12492 [Brucella melitensis bv. 3 str.
           Ether]
 gi|256159741|ref|ZP_05457488.1| hypothetical protein BcetM4_12248 [Brucella ceti M490/95/1]
 gi|256255003|ref|ZP_05460539.1| hypothetical protein BcetB_12050 [Brucella ceti B1/94]
 gi|256257502|ref|ZP_05463038.1| hypothetical protein Babob9C_09143 [Brucella abortus bv. 9 str.
           C68]
 gi|256369446|ref|YP_003106954.1| lipoprotein, putative [Brucella microti CCM 4915]
 gi|260168732|ref|ZP_05755543.1| hypothetical protein BruF5_10258 [Brucella sp. F5/99]
 gi|261222191|ref|ZP_05936472.1| lipoprotein [Brucella ceti B1/94]
 gi|261317656|ref|ZP_05956853.1| lipoprotein [Brucella pinnipedialis B2/94]
 gi|261752326|ref|ZP_05996035.1| lipoprotein [Brucella suis bv. 5 str. 513]
 gi|261754984|ref|ZP_05998693.1| lipoprotein [Brucella suis bv. 3 str. 686]
 gi|265988691|ref|ZP_06101248.1| lipoprotein [Brucella pinnipedialis M292/94/1]
 gi|23347843|gb|AAN29944.1| lipoprotein, putative [Brucella suis 1330]
 gi|62196077|gb|AAX74377.1| lipoprotein, hypothetical [Brucella abortus bv. 1 str. 9-941]
 gi|82615974|emb|CAJ10997.1| Protein of unknown function DUF330 [Brucella melitensis biovar
           Abortus 2308]
 gi|161335785|gb|ABX62090.1| Hypothetical protein BCAN_A1037 [Brucella canis ATCC 23365]
 gi|225617505|gb|EEH14550.1| lipoprotein [Brucella ceti str. Cudo]
 gi|225640892|gb|ACO00806.1| Hypothetical protein, conserved [Brucella melitensis ATCC 23457]
 gi|255999606|gb|ACU48005.1| lipoprotein, putative [Brucella microti CCM 4915]
 gi|260920775|gb|EEX87428.1| lipoprotein [Brucella ceti B1/94]
 gi|261296879|gb|EEY00376.1| lipoprotein [Brucella pinnipedialis B2/94]
 gi|261742079|gb|EEY30005.1| lipoprotein [Brucella suis bv. 5 str. 513]
 gi|261744737|gb|EEY32663.1| lipoprotein [Brucella suis bv. 3 str. 686]
 gi|264660888|gb|EEZ31149.1| lipoprotein [Brucella pinnipedialis M292/94/1]
          Length = 200

 Score =  112 bits (279), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 53/190 (27%), Positives = 108/190 (56%), Gaps = 4/190 (2%)

Query: 17  SLAVLLCTSLSSCFFHNNPVNIYDL-TESTKYDESVQRHIQLIITEPITEKILNSEDIIV 75
           S+A+LL   L+ C     P++ ++L T         ++++QL+I  P   K L+SE+I+V
Sbjct: 12  SVAILLTAFLAGCG-TTTPLDTFNLSTPQPMVTVPKRKNLQLLIPGPAALKALDSENIVV 70

Query: 76  RSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSF 135
            S+P  I+YL G+QW D+L  ++Q +L+  +EN      + +P  G+  +YQ+++ +R F
Sbjct: 71  SSAPGSIEYLKGAQWGDRLTNIVQSRLVQAYENTSAFGGIGRPGDGLAINYQVLTDLRMF 130

Query: 136 EIN--IDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISS 193
            I        A++ M++++++     +   +VF     +   +   ++++L++AF +  +
Sbjct: 131 GIQAYTSPQTAVVEMAVRLLSDKTGEVRATRVFRTAIPVTGTSNAAYVKALDKAFDQTVN 190

Query: 194 EIIDWTLSSL 203
           EI+ WT+S+L
Sbjct: 191 EIVSWTISTL 200


>gi|189024188|ref|YP_001934956.1| Protein of unknown function DUF330 [Brucella abortus S19]
 gi|237815446|ref|ZP_04594444.1| Protein of unknown function DUF330 [Brucella abortus str. 2308 A]
 gi|260545306|ref|ZP_05821047.1| lipoprotein [Brucella abortus NCTC 8038]
 gi|260564027|ref|ZP_05834513.1| lipoprotein [Brucella melitensis bv. 1 str. 16M]
 gi|260566438|ref|ZP_05836908.1| lipoprotein [Brucella suis bv. 4 str. 40]
 gi|260754758|ref|ZP_05867106.1| lipoprotein [Brucella abortus bv. 6 str. 870]
 gi|260757981|ref|ZP_05870329.1| lipoprotein [Brucella abortus bv. 4 str. 292]
 gi|260761804|ref|ZP_05874147.1| lipoprotein [Brucella abortus bv. 2 str. 86/8/59]
 gi|260883778|ref|ZP_05895392.1| lipoprotein [Brucella abortus bv. 9 str. C68]
 gi|261214010|ref|ZP_05928291.1| lipoprotein [Brucella abortus bv. 3 str. Tulya]
 gi|261218637|ref|ZP_05932918.1| lipoprotein [Brucella ceti M13/05/1]
 gi|261314251|ref|ZP_05953448.1| lipoprotein [Brucella pinnipedialis M163/99/10]
 gi|261321865|ref|ZP_05961062.1| lipoprotein [Brucella ceti M644/93/1]
 gi|261325115|ref|ZP_05964312.1| lipoprotein [Brucella neotomae 5K33]
 gi|261758210|ref|ZP_06001919.1| lipoprotein [Brucella sp. F5/99]
 gi|265991105|ref|ZP_06103662.1| lipoprotein [Brucella melitensis bv. 1 str. Rev.1]
 gi|265994942|ref|ZP_06107499.1| lipoprotein [Brucella melitensis bv. 3 str. Ether]
 gi|265998155|ref|ZP_06110712.1| lipoprotein [Brucella ceti M490/95/1]
 gi|265999468|ref|ZP_05466515.2| lipoprotein [Brucella melitensis bv. 2 str. 63/9]
 gi|297248346|ref|ZP_06932064.1| conserved hypothetical protein [Brucella abortus bv. 5 str. B3196]
 gi|189019760|gb|ACD72482.1| Protein of unknown function DUF330 [Brucella abortus S19]
 gi|237790283|gb|EEP64493.1| Protein of unknown function DUF330 [Brucella abortus str. 2308 A]
 gi|260096713|gb|EEW80588.1| lipoprotein [Brucella abortus NCTC 8038]
 gi|260154043|gb|EEW89135.1| lipoprotein [Brucella melitensis bv. 1 str. 16M]
 gi|260155956|gb|EEW91036.1| lipoprotein [Brucella suis bv. 4 str. 40]
 gi|260668299|gb|EEX55239.1| lipoprotein [Brucella abortus bv. 4 str. 292]
 gi|260672236|gb|EEX59057.1| lipoprotein [Brucella abortus bv. 2 str. 86/8/59]
 gi|260674866|gb|EEX61687.1| lipoprotein [Brucella abortus bv. 6 str. 870]
 gi|260873306|gb|EEX80375.1| lipoprotein [Brucella abortus bv. 9 str. C68]
 gi|260915617|gb|EEX82478.1| lipoprotein [Brucella abortus bv. 3 str. Tulya]
 gi|260923726|gb|EEX90294.1| lipoprotein [Brucella ceti M13/05/1]
 gi|261294555|gb|EEX98051.1| lipoprotein [Brucella ceti M644/93/1]
 gi|261301095|gb|EEY04592.1| lipoprotein [Brucella neotomae 5K33]
 gi|261303277|gb|EEY06774.1| lipoprotein [Brucella pinnipedialis M163/99/10]
 gi|261738194|gb|EEY26190.1| lipoprotein [Brucella sp. F5/99]
 gi|262552623|gb|EEZ08613.1| lipoprotein [Brucella ceti M490/95/1]
 gi|262766055|gb|EEZ11844.1| lipoprotein [Brucella melitensis bv. 3 str. Ether]
 gi|263001889|gb|EEZ14464.1| lipoprotein [Brucella melitensis bv. 1 str. Rev.1]
 gi|263094127|gb|EEZ18049.1| lipoprotein [Brucella melitensis bv. 2 str. 63/9]
 gi|297175515|gb|EFH34862.1| conserved hypothetical protein [Brucella abortus bv. 5 str. B3196]
 gi|326409043|gb|ADZ66108.1| conserved hypothetical protein [Brucella melitensis M28]
 gi|326538752|gb|ADZ86967.1| conserved hypothetical protein [Brucella melitensis M5-90]
          Length = 209

 Score =  112 bits (279), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 53/190 (27%), Positives = 108/190 (56%), Gaps = 4/190 (2%)

Query: 17  SLAVLLCTSLSSCFFHNNPVNIYDL-TESTKYDESVQRHIQLIITEPITEKILNSEDIIV 75
           S+A+LL   L+ C     P++ ++L T         ++++QL+I  P   K L+SE+I+V
Sbjct: 21  SVAILLTAFLAGCG-TTTPLDTFNLSTPQPMVTVPKRKNLQLLIPGPAALKALDSENIVV 79

Query: 76  RSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSF 135
            S+P  I+YL G+QW D+L  ++Q +L+  +EN      + +P  G+  +YQ+++ +R F
Sbjct: 80  SSAPGSIEYLKGAQWGDRLTNIVQSRLVQAYENTSAFGGIGRPGDGLAINYQVLTDLRMF 139

Query: 136 EIN--IDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISS 193
            I        A++ M++++++     +   +VF     +   +   ++++L++AF +  +
Sbjct: 140 GIQAYTSPQTAVVEMAVRLLSDKTGEVRATRVFRTAIPVTGTSNAAYVKALDKAFDQTVN 199

Query: 194 EIIDWTLSSL 203
           EI+ WT+S+L
Sbjct: 200 EIVSWTISTL 209


>gi|294852387|ref|ZP_06793060.1| hypothetical protein BAZG_01314 [Brucella sp. NVSL 07-0026]
 gi|294820976|gb|EFG37975.1| hypothetical protein BAZG_01314 [Brucella sp. NVSL 07-0026]
          Length = 209

 Score =  111 bits (278), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 53/190 (27%), Positives = 108/190 (56%), Gaps = 4/190 (2%)

Query: 17  SLAVLLCTSLSSCFFHNNPVNIYDL-TESTKYDESVQRHIQLIITEPITEKILNSEDIIV 75
           S+A+LL   L+ C     P++ ++L T         ++++QL+I  P   K L+SE+I+V
Sbjct: 21  SVAILLTAFLAGCG-TTTPLDTFNLSTPQPMVTVPKRKNLQLLIPGPAALKALDSENIVV 79

Query: 76  RSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSF 135
            S+P  I+YL G+QW D+L  ++Q +L+  +EN      + +P  G+  +YQ+++ +R F
Sbjct: 80  SSAPGSIKYLKGAQWGDRLTNIVQSRLVQAYENTSAFGGIGRPGDGLAINYQVLTDLRMF 139

Query: 136 EIN--IDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISS 193
            I        A++ M++++++     +   +VF     +   +   ++++L++AF +  +
Sbjct: 140 GIQAYTSPQTAVVEMAVRLLSDKTGEVRATRVFRTAIPVTGTSNAAYVKALDKAFDQTVN 199

Query: 194 EIIDWTLSSL 203
           EI+ WT+S+L
Sbjct: 200 EIVSWTISTL 209


>gi|163843290|ref|YP_001627694.1| hypothetical protein BSUIS_A1065 [Brucella suis ATCC 23445]
 gi|163674013|gb|ABY38124.1| Hypothetical protein BSUIS_A1065 [Brucella suis ATCC 23445]
          Length = 200

 Score =  109 bits (273), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 53/190 (27%), Positives = 108/190 (56%), Gaps = 4/190 (2%)

Query: 17  SLAVLLCTSLSSCFFHNNPVNIYDL-TESTKYDESVQRHIQLIITEPITEKILNSEDIIV 75
           S+A+LL   L+ C     P++ ++L T         ++++QL+I  P   K L+SE+I+V
Sbjct: 12  SVAILLTAFLAGCG-TTTPLDTFNLSTPHPMVTVPKRKNLQLLIPGPAALKALDSENIVV 70

Query: 76  RSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSF 135
            S+P  I+YL G+QW D+L  ++Q +L+  +EN      + +P  G+  +YQ+++ +R F
Sbjct: 71  SSAPGSIEYLKGAQWGDRLTNIVQSRLVQAYENTSAFGGIGRPGDGLAINYQVLTDLRMF 130

Query: 136 EIN--IDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISS 193
            I        A++ M++++++     +   +VF     +   +   ++++L++AF +  +
Sbjct: 131 GIQAYTSPQTAVVEMAVRLLSDKTGEVRVTRVFRTAIPVTGTSNAAYVKALDKAFDQTVN 190

Query: 194 EIIDWTLSSL 203
           EI+ WT+S+L
Sbjct: 191 EIVSWTISTL 200


>gi|319783792|ref|YP_004143268.1| hypothetical protein Mesci_4105 [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317169680|gb|ADV13218.1| protein of unknown function DUF330 [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 235

 Score =  109 bits (272), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 51/168 (30%), Positives = 96/168 (57%), Gaps = 2/168 (1%)

Query: 35  PVNIYDLTESTKYDESVQRHIQLIITEPITEKILNSEDIIVRSSPIEIQYLIGSQWSDKL 94
           P++ ++L+  +  D       Q++I +P   K L+S++I+++ S   IQYL G+QW+D+L
Sbjct: 67  PLDTFELSAPS-VDAHGHSRRQILIAQPSALKALDSQNIVIKPSDRSIQYLKGAQWADRL 125

Query: 95  PRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFEINID-RHCAIITMSLKII 153
           P ++Q +L   F+ +G  + V KP +G+  DYQ+I  IRSFE+ +D    A + + ++I+
Sbjct: 126 PLIVQARLAETFQRSGSFAGVGKPGEGLAIDYQVIVEIRSFEVRVDGGEHAEVDLFVRIL 185

Query: 154 NAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEIIDWTLS 201
           N  +  +   K F     +       ++ +L++AF   + +I+ WT S
Sbjct: 186 NDRNGEVRASKSFTAAAPVSGSGNPAYVSALDKAFGDAAGQIVRWTDS 233


>gi|13470956|ref|NP_102525.1| hypothetical protein mll0797 [Mesorhizobium loti MAFF303099]
 gi|14021699|dbj|BAB48311.1| mll0797 [Mesorhizobium loti MAFF303099]
          Length = 197

 Score =  108 bits (270), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 50/166 (30%), Positives = 96/166 (57%), Gaps = 2/166 (1%)

Query: 35  PVNIYDLTESTKYDESVQRHIQLIITEPITEKILNSEDIIVRSSPIEIQYLIGSQWSDKL 94
           P++ ++L+ +   D       Q++I +P   K L+S++I+++ S   IQYL G+QW+D+L
Sbjct: 29  PLDTFELS-APSVDAHGHSRKQILIAQPSALKALDSQNIVIKPSDRSIQYLKGAQWADRL 87

Query: 95  PRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFEINID-RHCAIITMSLKII 153
           P ++Q +L   F+ +G  + V KP +G+  DYQ+I  IRSFE+++D    A + + ++++
Sbjct: 88  PLIVQARLAETFQRSGSFAGVGKPGEGLAIDYQVIVEIRSFEVSVDGGEHAEVDLFVRLL 147

Query: 154 NAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEIIDWT 199
           N  +  +   K F     +       +I++L+ AF   + +I+ WT
Sbjct: 148 NDRNGEVRASKSFTASAPVSGSGNPAYIKALDSAFGDAAKQIVRWT 193


>gi|218678849|ref|ZP_03526746.1| putative ABC transporter protein [Rhizobium etli CIAT 894]
          Length = 173

 Score =  108 bits (269), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 54/130 (41%), Positives = 78/130 (60%), Gaps = 4/130 (3%)

Query: 9   IKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIITEPITEKIL 68
           IK  +++  L  L+   LS C       + YDL+ +   D    +  Q++I  P   + L
Sbjct: 13  IKGTVVALPLIALI---LSGCGTSAK-NDTYDLSAAVDGDGPAAKSRQILIAGPTALRAL 68

Query: 69  NSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQI 128
           +SE I++R S  EIQYL  +QW DKLPRM+Q KL+  FEN+GK+  V  P QG+  DYQ+
Sbjct: 69  DSEQIVIRVSSSEIQYLSRAQWGDKLPRMVQSKLVEAFENSGKLGGVGMPGQGLAIDYQV 128

Query: 129 ISAIRSFEIN 138
           ++ IRSFEI+
Sbjct: 129 VTDIRSFEID 138


>gi|298292074|ref|YP_003694013.1| hypothetical protein Snov_2098 [Starkeya novella DSM 506]
 gi|296928585|gb|ADH89394.1| protein of unknown function DUF330 [Starkeya novella DSM 506]
          Length = 223

 Score =  107 bits (267), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 52/192 (27%), Positives = 96/192 (50%), Gaps = 6/192 (3%)

Query: 16  CSLAVLLCTSLSSCF----FHNNPVNIYDLTESTKYDESVQRHIQLIITEPITEKILNSE 71
           C+  + +  +L  C       +  V  +DLT  + ++   +    L++  P    +L++E
Sbjct: 30  CAGTLAVALTLGGCGAILAGGDKSVPTFDLTAPSDFNAPRRGTGLLVVGPPTALAVLDTE 89

Query: 72  DIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISA 131
            I+V  +P +I YL G+QWSD+LP + Q +LI +FEN  +  +V +   G+ ADY +++ 
Sbjct: 90  RIVVEPAPGQITYLSGAQWSDRLPALFQARLIESFENGNRARSVGRAGDGLTADYTLLTD 149

Query: 132 IRSFEINI--DRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFS 189
           +RSF +        A++ +S KI+ A    +   +VF         +     Q+L+ A  
Sbjct: 150 LRSFGLQTSDGGPVAVVEVSAKIVGATSGRIAAAQVFKASAPAASTSGPQATQALDAASD 209

Query: 190 RISSEIIDWTLS 201
           ++  EI+ W  S
Sbjct: 210 QVFIEIVRWASS 221


>gi|17987245|ref|NP_539879.1| membrane lipoprotein lipid attachment site containing protein
           [Brucella melitensis bv. 1 str. 16M]
 gi|17982919|gb|AAL52143.1| membrane lipoprotein lipid attachment site containing protein
           [Brucella melitensis bv. 1 str. 16M]
          Length = 185

 Score =  107 bits (266), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 50/186 (26%), Positives = 104/186 (55%), Gaps = 4/186 (2%)

Query: 21  LLCTSLSSCFFHNNPVNIYDL-TESTKYDESVQRHIQLIITEPITEKILNSEDIIVRSSP 79
           +L   L+ C     P++ ++L T         ++++QL+I  P   K L+SE+I+V S+P
Sbjct: 1   MLTAFLAGCG-TTTPLDTFNLSTPQPMVTVPKRKNLQLLIPGPAALKALDSENIVVSSAP 59

Query: 80  IEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFEIN- 138
             I+YL G+QW D+L  ++Q +L+  +EN      + +P  G+  +YQ+++ +R F I  
Sbjct: 60  GSIEYLKGAQWGDRLTNIVQSRLVQAYENTSAFGGIGRPGDGLAINYQVLTDLRMFGIQA 119

Query: 139 -IDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEIID 197
                 A++ M++++++     +   +VF     +   +   ++++L++AF +  +EI+ 
Sbjct: 120 YTSPQTAVVEMAVRLLSDKTGEVRATRVFRTAIPVTGTSNAAYVKALDKAFDQTVNEIVS 179

Query: 198 WTLSSL 203
           WT+S+L
Sbjct: 180 WTISTL 185


>gi|260463971|ref|ZP_05812167.1| protein of unknown function DUF330 [Mesorhizobium opportunistum
           WSM2075]
 gi|259030346|gb|EEW31626.1| protein of unknown function DUF330 [Mesorhizobium opportunistum
           WSM2075]
          Length = 235

 Score =  106 bits (265), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 51/180 (28%), Positives = 99/180 (55%), Gaps = 5/180 (2%)

Query: 23  CTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIITEPITEKILNSEDIIVRSSPIEI 82
           C +L        P++ ++L+  +  D       Q++I +P   K L+S++I+++ S   I
Sbjct: 58  CAALGG---KPAPLDTFELSAPS-VDAHGHSSKQILIAQPSALKALDSQNIVIKPSDRSI 113

Query: 83  QYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFEINID-R 141
           QYL G+QW+D+LP ++Q +L   F+ +G  + V KP +G+  DYQ+I  +RSFE+ +D  
Sbjct: 114 QYLKGAQWADRLPLIVQARLAETFQRSGSFAGVGKPGEGLAIDYQVIVEVRSFEVRVDGG 173

Query: 142 HCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEIIDWTLS 201
             A + + ++++N  +  +   K F+    +       ++ +L+ AF   + +I+ WT S
Sbjct: 174 EHAEVDLFVRLLNDRNGEVRASKSFNASAPVSGKGNSAYVGALDNAFGDAARQIVRWTDS 233


>gi|158423840|ref|YP_001525132.1| ABC-type uncharacterized transport system protein [Azorhizobium
           caulinodans ORS 571]
 gi|158330729|dbj|BAF88214.1| ABC-type uncharacterized transport system protein [Azorhizobium
           caulinodans ORS 571]
          Length = 208

 Score =  105 bits (263), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 51/183 (27%), Positives = 96/183 (52%), Gaps = 4/183 (2%)

Query: 18  LAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIITEPITEKILNSEDIIVRS 77
           L V L  +L+ C   + P+  YDL+  T +      + QL++  P    +L+SE I+V  
Sbjct: 22  LGVFLTLALAGC--ASAPIPTYDLSAPTGFAARGGGNGQLVVVTPTALAVLDSEKIVVEP 79

Query: 78  SPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFEI 137
           +P ++ YL  +QWSD+L  ++Q + I  FEN+ +   V +P  G+  DYQ+   +RSF I
Sbjct: 80  TPGQVTYLPEAQWSDRLTSLLQARTIQAFENSSRQRRVARPGDGVTGDYQLNMDVRSFGI 139

Query: 138 NI--DRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEI 195
            +  +   A++ +S K+I      +V  ++F     +   +      +L++A +++  E+
Sbjct: 140 KVLPEGTFAVVEISAKLIATQTGRIVSARIFSARVPVASVSGTSATTALDQASNQVLMEL 199

Query: 196 IDW 198
           + W
Sbjct: 200 VRW 202


>gi|170748373|ref|YP_001754633.1| hypothetical protein Mrad2831_1955 [Methylobacterium radiotolerans
           JCM 2831]
 gi|170654895|gb|ACB23950.1| protein of unknown function DUF330 [Methylobacterium radiotolerans
           JCM 2831]
          Length = 192

 Score =  105 bits (261), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 43/160 (26%), Positives = 92/160 (57%)

Query: 39  YDLTESTKYDESVQRHIQLIITEPITEKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMI 98
           +DL         +     ++++EP++ +   ++ IIVR +   + +L G QW+D+LPR+I
Sbjct: 28  FDLAALPAAGRPIAAGRSIVVSEPVSIQPFEADRIIVRENGGALSFLGGGQWADRLPRLI 87

Query: 99  QLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFEINIDRHCAIITMSLKIINAHDN 158
           Q +LI + EN+G++ +V +P   + ADYQ+IS IR+F++      A++ +SLK++     
Sbjct: 88  QTRLIQSLENSGRLRSVSRPGDKVVADYQLISEIRAFDVQSGTGEAVVDLSLKLVADGTG 147

Query: 159 SLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEIIDW 198
            +   ++F     + K +     ++L++A + + ++++ W
Sbjct: 148 KVAAARIFTARVPVSKIDAGSGARALDQALTVVLADVVRW 187


>gi|182680398|ref|YP_001834544.1| hypothetical protein Bind_3498 [Beijerinckia indica subsp. indica
           ATCC 9039]
 gi|182636281|gb|ACB97055.1| Mammalian cell entry related domain protein [Beijerinckia indica
           subsp. indica ATCC 9039]
          Length = 378

 Score =  103 bits (256), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 52/178 (29%), Positives = 101/178 (56%), Gaps = 5/178 (2%)

Query: 26  LSSCFFHNNPVNIYDLT--ESTKYDESVQRHI-QLIITEPITEKILNSEDIIVRSSPIEI 82
           L+       P  +YDLT  ++T       + + Q++I EP T  + +++ ++ RS   E 
Sbjct: 196 LAGGGPEAKPKPVYDLTVTQATPAPAPKGKKLGQIVIAEPTTTVVFDTQRLLARSKDGEF 255

Query: 83  QYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFEINID-R 141
                 QW+D +P+++Q K++ +FEN G I +V  P +G+   YQ+++ IR+F +  D R
Sbjct: 256 TPQGEMQWADSIPKLVQEKMVQSFENEGLIGSVTAPVEGVTRQYQLLTDIRNFAVTSDSR 315

Query: 142 HCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEIIDWT 199
             A + +S+K++N   + + G K+FHV   +E ++    + + ++AF++  +E+I WT
Sbjct: 316 PSADVELSVKLMNEEGHVIAG-KIFHVTVPVESEDTSKVVAAFSQAFNQAMTELISWT 372


>gi|154248037|ref|YP_001418995.1| hypothetical protein Xaut_4116 [Xanthobacter autotrophicus Py2]
 gi|154162122|gb|ABS69338.1| protein of unknown function DUF330 [Xanthobacter autotrophicus Py2]
          Length = 213

 Score =  101 bits (252), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 46/182 (25%), Positives = 90/182 (49%), Gaps = 4/182 (2%)

Query: 19  AVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIITEPITEKILNSEDIIVRSS 78
             +L  +L+ C   + P   Y+L+  + +      + Q+++  P    +LN++ ++V   
Sbjct: 29  GAVLTLALAGC--GSTPTPTYNLSAPSGFTAGGSGNGQMVVVAPTALAVLNTDKVMVEPG 86

Query: 79  PIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFEIN 138
           P ++ YL  +QWSD LP ++Q + I  FEN  K+  V +P  G+ ADYQ++  IR+F + 
Sbjct: 87  PGQVAYLSDAQWSDTLPALLQARTIQAFENASKLRRVARPGDGVNADYQLVIDIRTFALR 146

Query: 139 IDRH--CAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEII 196
           I      A++ +S K+I      ++  +VF                +L+ A  ++  +++
Sbjct: 147 ITDQGPVAVVELSAKLIGTQSGRILAAQVFKAAVPAASTAGPVATAALDSAQEQVLVQMV 206

Query: 197 DW 198
            W
Sbjct: 207 RW 208


>gi|182680566|ref|YP_001834712.1| hypothetical protein Bind_3671 [Beijerinckia indica subsp. indica
           ATCC 9039]
 gi|182636449|gb|ACB97223.1| protein of unknown function DUF330 [Beijerinckia indica subsp.
           indica ATCC 9039]
          Length = 198

 Score = 99.4 bits (246), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 52/179 (29%), Positives = 100/179 (55%), Gaps = 7/179 (3%)

Query: 22  LCTSLSSCFFHNNPVNIYDLTEST-KYDESVQRHIQLIITEPITEKILNSEDIIVRSSPI 80
           L  +L+ C   + P   +DL+ S   +    QR  QL I EP+ +  ++S+ I+VR    
Sbjct: 22  LSVTLAGC--ASGPPPTFDLSPSAGPFSVRAQRG-QLAIAEPVADVPIDSQRIVVRVQDD 78

Query: 81  EIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFEINID 140
            + +L G+QW+D+LP ++Q +LI  FEN   +  V +P  G+ A+Y + + IR FE+ + 
Sbjct: 79  SVAFLRGAQWADRLPSLVQTRLIETFENAHLLREVGRP--GMAANYTLSTEIRRFELAVG 136

Query: 141 RHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEIIDWT 199
           ++ A++ ++ +++NA    +V  +VF  +     D+      +L++A S++  +I+ W 
Sbjct: 137 QNQAVVVIAAQLVNA-TGKIVHGRVFSAKAPAVHDDGASATAALDQALSQVMQQIVVWA 194


>gi|316935756|ref|YP_004110738.1| mammalian cell entry related domain-containing protein
           [Rhodopseudomonas palustris DX-1]
 gi|315603470|gb|ADU46005.1| Mammalian cell entry related domain protein [Rhodopseudomonas
           palustris DX-1]
          Length = 399

 Score = 98.6 bits (244), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 55/169 (32%), Positives = 92/169 (54%), Gaps = 5/169 (2%)

Query: 38  IYDLTESTKYDE-SVQRHIQLIITEPITEKILNSEDIIVRSSPIEIQYLIGSQWSDKLPR 96
           +YDL  +  +   S     QL I E  T  + +S+ +++    +EIQ   G+QWSD +P+
Sbjct: 203 VYDLAAAAGFPPPSPPLKGQLTIPESNTVILFDSQKMLLAPG-LEIQAFAGAQWSDSIPK 261

Query: 97  MIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFEINIDRH--CAIITMSLKIIN 154
           M+Q KLI +FEN       ++PN  +  DYQ+++ IRSF++  +R    A I  S KII+
Sbjct: 262 MLQEKLIQSFENYDIAHAPMRPNDAVQPDYQLLTDIRSFQVVGERDNLKAEIAFSGKIID 321

Query: 155 AHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEIIDWTLSSL 203
             D  LV  +VF     L K   +  + + +++F  I+ +++ WT  +L
Sbjct: 322 -KDGKLVAARVFQQATTLAKPEPMAAVAAFDKSFDAIAKDLVPWTAQAL 369


>gi|192293076|ref|YP_001993681.1| mammalian cell entry related domain protein [Rhodopseudomonas
           palustris TIE-1]
 gi|192286825|gb|ACF03206.1| Mammalian cell entry related domain protein [Rhodopseudomonas
           palustris TIE-1]
          Length = 398

 Score = 98.2 bits (243), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 57/177 (32%), Positives = 94/177 (53%), Gaps = 8/177 (4%)

Query: 33  NNPVN---IYDLTESTKYDESVQR-HIQLIITEPITEKILNSEDIIVRSSPIEIQYLIGS 88
           N PV    +YDL+ +T +  S      QL I E  T  + +S+ +++    +E+    G+
Sbjct: 195 NEPVVKKVVYDLSAATGFPPSSPPLKGQLTIPESNTVVLFDSQKMLLAPG-LEVPAFAGA 253

Query: 89  QWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFEI--NIDRHCAII 146
           QWSD LP+M+Q KLI +FEN       ++PN  +  DYQ+++ IRSF++    D   A I
Sbjct: 254 QWSDSLPKMLQEKLIQSFENYDIAHAPMRPNDAVQPDYQLLTDIRSFQVIGEGDALRAEI 313

Query: 147 TMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEIIDWTLSSL 203
             S KII+  D  LV  ++F     L+K      + + +++F  I+ E++ W   +L
Sbjct: 314 AFSAKIID-KDGKLVAARLFQQASPLDKPEPAAAVSAFDKSFDTIAKELVPWAAQAL 369


>gi|39937296|ref|NP_949572.1| hypothetical protein RPA4236 [Rhodopseudomonas palustris CGA009]
 gi|39651154|emb|CAE29677.1| Mce4/Rv3499c/MTV023.06c protein [Rhodopseudomonas palustris CGA009]
          Length = 398

 Score = 98.2 bits (243), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 57/177 (32%), Positives = 94/177 (53%), Gaps = 8/177 (4%)

Query: 33  NNPVN---IYDLTESTKYDE-SVQRHIQLIITEPITEKILNSEDIIVRSSPIEIQYLIGS 88
           N PV    +YDL+ +T +   S     QL I E  T  + +S+ +++    +E+    G+
Sbjct: 195 NEPVVKKVVYDLSAATGFPPPSPPLKGQLTIPESNTVVLFDSQKMLLAPG-LEVPAFAGA 253

Query: 89  QWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFEI--NIDRHCAII 146
           QWSD LP+M+Q KLI +FEN       ++PN  +  DYQ+++ IRSF++    D   A I
Sbjct: 254 QWSDSLPKMLQEKLIQSFENYDIAHAPMRPNDAVQPDYQLLTDIRSFQVIGEGDALRAEI 313

Query: 147 TMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEIIDWTLSSL 203
             S KII+  D  LV  ++F     L+K      + + +++F  I+ E++ W   +L
Sbjct: 314 AFSAKIID-KDGKLVAARLFQQASPLDKPEPAAAVSAFDKSFDTIAKELVPWAAQAL 369


>gi|254470354|ref|ZP_05083758.1| membrane lipoprotein lipid attachment site containing protein
           [Pseudovibrio sp. JE062]
 gi|211960665|gb|EEA95861.1| membrane lipoprotein lipid attachment site containing protein
           [Pseudovibrio sp. JE062]
          Length = 261

 Score = 97.1 bits (240), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 58/203 (28%), Positives = 101/203 (49%), Gaps = 10/203 (4%)

Query: 5   LNKIIKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRH-IQLIITEPI 63
               +KK ++    AVLL   L+ C   + P  +Y LT        V+    Q+++  P+
Sbjct: 26  FGSTLKKLVVG---AVLLG-GLAGCG-ASGPEALYGLTAPRDVPVKVRASDYQVLVATPV 80

Query: 64  TEKILNSEDIIV--RSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQG 121
             + L++ +I V     PI   Y     W+D LPR+ Q KL+   EN GK+  V +P QG
Sbjct: 81  ALQALDTSNIAVTQGGGPI-YSYFPKVAWTDTLPRVFQAKLVETLENTGKLRGVSQPGQG 139

Query: 122 IYADYQIISAIRSFEINIDRH-CAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHF 180
           +  DYQ+ + +R+FE+ +D    A + ++ +I++  D   +G +VF        D     
Sbjct: 140 LLIDYQLQTTLRAFELQVDGGDKAYVEVAARIVDDRDGRSIGMRVFAASVPTTGDTVTDA 199

Query: 181 IQSLNRAFSRISSEIIDWTLSSL 203
           I +LN A   + S+I  W+++++
Sbjct: 200 IPALNAASDNVLSQIASWSVNTV 222


>gi|86748500|ref|YP_484996.1| hypothetical protein RPB_1375 [Rhodopseudomonas palustris HaA2]
 gi|86571528|gb|ABD06085.1| Mammalian cell entry related [Rhodopseudomonas palustris HaA2]
          Length = 390

 Score = 95.9 bits (237), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 51/168 (30%), Positives = 91/168 (54%), Gaps = 4/168 (2%)

Query: 38  IYDLTESTKYDESVQR-HIQLIITEPITEKILNSEDIIVRSSPIEIQYLIGSQWSDKLPR 96
           +YDL  ++ +   V+    QL I EP T  + +S+ ++V    +++    G+QWSD +P+
Sbjct: 203 VYDLQPASGFSPPVRSMKGQLTIPEPTTVVLYDSQKMLVAPG-LDLPAFAGAQWSDSIPK 261

Query: 97  MIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFEINIDRH-CAIITMSLKIINA 155
           M+Q KLI +FEN       ++PN  +  DYQ++  IRSF++  +    A ++   KII+ 
Sbjct: 262 MLQEKLIQSFENYDIARPPLRPNDAVTPDYQLLIDIRSFQVAGEGAPSADVSFGAKIID- 320

Query: 156 HDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEIIDWTLSSL 203
            +  LV  ++F    +L++      + +   AF   + E+I WT+ SL
Sbjct: 321 KNGRLVSARLFRQSARLDRPEPAAAVTAFETAFGAAAKELIPWTVDSL 368


>gi|328543115|ref|YP_004303224.1| Putative ABC transporter protein [Polymorphum gilvum SL003B-26A1]
 gi|326412861|gb|ADZ69924.1| Putative ABC transporter protein [Polymorphum gilvum SL003B-26A1]
          Length = 200

 Score = 93.6 bits (231), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 48/167 (28%), Positives = 83/167 (49%), Gaps = 1/167 (0%)

Query: 35  PVNIYDLTESTKYDESVQRHIQLIITEPITEKILNSEDIIVRSSPIEIQYLIGSQWSDKL 94
           P  +Y LT      +   R +Q+++  P   K L++ +I V        Y   + W+D L
Sbjct: 31  PSALYGLTAPDDIADGRSRPVQVLVPAPRALKALDTGNIAVVDKGPAYSYFPQAAWADTL 90

Query: 95  PRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFEINIDR-HCAIITMSLKII 153
           P ++Q KL+   EN G++  V  P +G+  D+Q+ + +RSFE+NID    A++ ++ K+I
Sbjct: 91  PNVVQAKLVQTLENTGRLRGVGLPGEGLLIDFQLQTDLRSFELNIDGPDRAVVEIAAKLI 150

Query: 154 NAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEIIDWTL 200
           N  +   V  +VF              + ++NRA  ++  EI  W L
Sbjct: 151 NDRNGRTVASRVFTAVVPAGGTTVDRAVAAMNRAADQVFREIAVWVL 197


>gi|159044591|ref|YP_001533385.1| hypothetical protein Dshi_2047 [Dinoroseobacter shibae DFL 12]
 gi|157912351|gb|ABV93784.1| conserved hypothetical protein [Dinoroseobacter shibae DFL 12]
          Length = 208

 Score = 90.5 bits (223), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 50/197 (25%), Positives = 98/197 (49%), Gaps = 10/197 (5%)

Query: 15  SCSLAVLLCTSLSSCFF------HNNPVNIYDLTESTKYDESVQRHIQLIITEPITEKIL 68
           +CS+A+L  +SLS C         +  +++Y+L       E   R   ++I  P T   L
Sbjct: 9   ACSVALLTLSSLSGCAAVSALGSASEVLDVYELQAPRTLPEGPVRARDVVIELPTTTGAL 68

Query: 69  NSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQI 128
            ++ I++R  P++ QYL G +W D  P M+Q  ++   E +G++  V +   GI  DY +
Sbjct: 69  QTDRIMIRPDPLQAQYLPGVRWGDATPVMVQTLMLRTLEASGRLGYVGRRPLGINGDYAV 128

Query: 129 ISAIRSFEINI--DRHCAIITMSL--KIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSL 184
           ++ I  F+     +   A++ +SL  +++   D  ++G + F V+  +   ++   I   
Sbjct: 129 LTEIVDFQAEAVPEGPGAVVVLSLIGRVVRESDLRIMGTRRFAVQVPVASVSEAEVIAGF 188

Query: 185 NRAFSRISSEIIDWTLS 201
           ++A  ++ +E   W LS
Sbjct: 189 DQAAQQLFAEHGAWVLS 205


>gi|254513148|ref|ZP_05125214.1| conserved hypothetical protein [Rhodobacteraceae bacterium KLH11]
 gi|221533147|gb|EEE36142.1| conserved hypothetical protein [Rhodobacteraceae bacterium KLH11]
          Length = 212

 Score = 90.5 bits (223), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 44/190 (23%), Positives = 99/190 (52%), Gaps = 8/190 (4%)

Query: 19  AVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQR-HIQLIITEPITEKILNSEDIIVRS 77
           A+  CT L +    + P ++Y LT  + +  ++ R   Q+++ EP     +N++ I V+ 
Sbjct: 7   ALAGCTGLGTLRQASKPNDLYLLTPKSTFSSALPRIQKQIVVEEPTATAAVNTDQIAVQP 66

Query: 78  SPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFEI 137
           +P+++QYL  ++W D+ P ++Q  ++ ++EN+GK++ V +   G+ ADY I   +R F+ 
Sbjct: 67  TPLQVQYLPQARWVDRAPLIVQALMVESYENSGKVAAVGRSTVGLRADYVIAPDLREFQG 126

Query: 138 NIDRHCAIIT-------MSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSR 190
            +       T       +++KII+ +D+ ++    F        D     +++ + A  +
Sbjct: 127 VVISQTEDATTVRVEVRINIKIIDEYDDKIIASSSFQETVLATSDQTSDLVEAFDIALGK 186

Query: 191 ISSEIIDWTL 200
              + ++W++
Sbjct: 187 AMRDCVEWSI 196


>gi|90425516|ref|YP_533886.1| hypothetical protein RPC_4041 [Rhodopseudomonas palustris BisB18]
 gi|90107530|gb|ABD89567.1| Mammalian cell entry related [Rhodopseudomonas palustris BisB18]
          Length = 367

 Score = 90.1 bits (222), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 49/167 (29%), Positives = 85/167 (50%), Gaps = 3/167 (1%)

Query: 38  IYDLTESTKYDESVQRHIQLIITEPITEKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRM 97
           +YDL  +T          QL I EP    + +++ +++    ++     G QWSD +P++
Sbjct: 203 VYDLRAATDLPPGKPIKGQLAIAEPTYVVMFDTQRLLLAPG-LDYPAFAGFQWSDSIPKL 261

Query: 98  IQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFEINIDRHCAI-ITMSLKIINAH 156
           +Q KLI +FEN       ++ +  + AD+Q++  IRSF++      A  +  S KI++  
Sbjct: 262 VQAKLIQSFENYDIAHAPLRASDALQADHQLLIDIRSFQVGGSPDLAAEVAFSAKIVS-K 320

Query: 157 DNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEIIDWTLSSL 203
           D   V  K+F     L+K   L  + + N AF  ++ E+I WT S+L
Sbjct: 321 DGKQVAAKLFRASAPLDKPEPLAALAAFNEAFGSVAKELIQWTASAL 367


>gi|220924822|ref|YP_002500124.1| hypothetical protein Mnod_4964 [Methylobacterium nodulans ORS 2060]
 gi|219949429|gb|ACL59821.1| protein of unknown function DUF330 [Methylobacterium nodulans ORS
           2060]
          Length = 200

 Score = 89.7 bits (221), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 44/160 (27%), Positives = 85/160 (53%)

Query: 39  YDLTESTKYDESVQRHIQLIITEPITEKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMI 98
           +DLT       +      L++ EP+  +   ++ IIVR     + +L G QW+D+LPR++
Sbjct: 36  FDLTAVPGAARAGAARRSLVVAEPVGLQPFEADRIIVREPGGSLSFLGGGQWADRLPRLV 95

Query: 99  QLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFEINIDRHCAIITMSLKIINAHDN 158
           Q +LI + EN  ++ +V +P   I AD  +++ IR+F+I      A++ +S K+I+    
Sbjct: 96  QARLIQSLENANRLRSVSRPGDKIAADTLLVTEIRAFDIAAGTREAVVDLSAKLISDATG 155

Query: 159 SLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEIIDW 198
           ++V  +VF     ++          L+RA S + ++++ W
Sbjct: 156 AVVAARVFEARVPVQDVTPASAANGLDRALSIVLADVVRW 195


>gi|91975835|ref|YP_568494.1| hypothetical protein RPD_1355 [Rhodopseudomonas palustris BisB5]
 gi|91682291|gb|ABE38593.1| Mammalian cell entry related [Rhodopseudomonas palustris BisB5]
          Length = 390

 Score = 89.0 bits (219), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 54/178 (30%), Positives = 89/178 (50%), Gaps = 10/178 (5%)

Query: 33  NNPVN---IYDLTESTKYDESVQR-HIQLIITEPITEKILNSEDIIVRSSPIEIQYLIGS 88
           N PV    +YDL  +  +    +    QL I EP T  + +S+ +++    +E+    G+
Sbjct: 195 NEPVVKKVVYDLQPAKGFPPPTKSIRGQLTIPEPTTVVLYDSQKMLLAPG-LELPAFAGA 253

Query: 89  QWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFEINIDRHC---AI 145
           QWSD +P+M+Q KLI +FEN       ++PN  +  DYQ++  +RSF+I   R     A 
Sbjct: 254 QWSDSIPKMLQEKLIQSFENYDIAHPPLRPNDAVQPDYQLLIDLRSFQI-AGREAELVAE 312

Query: 146 ITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEIIDWTLSSL 203
           +    KII+     LV  ++F    KL+  +    + +   AF   +  +I WT+ SL
Sbjct: 313 VAFGAKIID-KGGKLVAARLFQQSAKLDNPHPAAAVTAFETAFDATAKALIPWTVDSL 369


>gi|217978937|ref|YP_002363084.1| protein of unknown function DUF330 [Methylocella silvestris BL2]
 gi|217504313|gb|ACK51722.1| protein of unknown function DUF330 [Methylocella silvestris BL2]
          Length = 207

 Score = 88.6 bits (218), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 54/175 (30%), Positives = 88/175 (50%), Gaps = 6/175 (3%)

Query: 26  LSSCFFHNNPVNIYDL-TESTKYDESVQRHIQLIITEPITEKILNSEDIIVRSSPIEIQY 84
           L++C   + P   +DL    T +     R  Q+ I  P     ++S  I+VR    +I  
Sbjct: 34  LAAC--ASAPPATFDLDAAPTGFSAKQARRAQIAIAAPSALPPVDSNRIVVRVGEDQIAL 91

Query: 85  LIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFEINIDRHCA 144
           L G+ WS++LP ++Q KLIA+F+N   I  VV P  G+ ADY++ S IRSFE    R   
Sbjct: 92  LAGAAWSNQLPALLQAKLIASFQNASLIRAVVSP--GMPADYELRSQIRSFEYVAGRGAV 149

Query: 145 IITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEIIDWT 199
            + +S +I+      +V  K+F        ++    + +LN A + +  +I+ WT
Sbjct: 150 FVEISAQIVGGAGR-IVAGKIFSATAPAPANDGATVVAALNAATADVMRQIVRWT 203


>gi|114764124|ref|ZP_01443363.1| hypothetical protein 1100011001333_R2601_15737 [Pelagibaca
           bermudensis HTCC2601]
 gi|114543482|gb|EAU46497.1| hypothetical protein R2601_15737 [Roseovarius sp. HTCC2601]
          Length = 201

 Score = 88.2 bits (217), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 44/189 (23%), Positives = 90/189 (47%), Gaps = 4/189 (2%)

Query: 17  SLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIITEPITEKILNSEDIIVR 76
           + A+  C +L++    + P+ +Y+L          +R +++I+ EP+    L +E I++R
Sbjct: 10  AAALTGCGALTALEEASTPLEVYELRTPEVAQSGARRGVEVIVEEPLASGSLATERIMIR 69

Query: 77  SSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFE 136
            SP++ QYL G +W+D  P M+Q  L+ +    G + +V +   G  ADY ++  +  F+
Sbjct: 70  PSPLQAQYLPGVRWADPAPAMLQTMLVRSLSETGGLGSVSRRPVGPRADYAVLGELTDFQ 129

Query: 137 I----NIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRIS 192
                  +     +   L+++   D  +V  + F   E     +    + + + A SR+ 
Sbjct: 130 GEAIEGAESGLVRVRFVLRVVREGDARVVATRSFEATELAAATDPDSIVAAFDSATSRLL 189

Query: 193 SEIIDWTLS 201
            E + W +S
Sbjct: 190 PEAVAWIVS 198


>gi|307945710|ref|ZP_07661046.1| lipoprotein [Roseibium sp. TrichSKD4]
 gi|307771583|gb|EFO30808.1| lipoprotein [Roseibium sp. TrichSKD4]
          Length = 194

 Score = 87.8 bits (216), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 54/191 (28%), Positives = 94/191 (49%), Gaps = 14/191 (7%)

Query: 14  ISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIITEPITEKILNSEDI 73
           +  SL V  C +       + P  +Y L  +T   E  ++  Q+++  P   K L++E I
Sbjct: 11  LGASLLVAGCAA-------SGPAALYGLNAATSQVEGRRKSRQVLVPRPRALKALDTEYI 63

Query: 74  -IVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAI 132
            +V   P+   Y     W+D LP ++Q K++   +N   +  V  P  G+  DYQ+   I
Sbjct: 64  AVVNQGPV-YSYYPKVSWADALPSLVQTKVVETLQNTNLLRGVGLPGDGLLIDYQLQLEI 122

Query: 133 RSFEI---NIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFS 189
           RSFEI   N D+  A++ ++ K++N  +   V  +VF  E      +    +++LNRA  
Sbjct: 123 RSFEIQLANADK--AVVAIAAKLVNDRNGRTVSNRVFRAEIPASATSADKAVEALNRAAD 180

Query: 190 RISSEIIDWTL 200
           ++ S+I  WT+
Sbjct: 181 QVFSDIALWTV 191


>gi|170743044|ref|YP_001771699.1| hypothetical protein M446_4936 [Methylobacterium sp. 4-46]
 gi|168197318|gb|ACA19265.1| protein of unknown function DUF330 [Methylobacterium sp. 4-46]
          Length = 198

 Score = 87.4 bits (215), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 46/160 (28%), Positives = 82/160 (51%)

Query: 39  YDLTESTKYDESVQRHIQLIITEPITEKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMI 98
           +DLT       +      LI+ EP+  +   ++ IIVR     + +L G QW D+LPR+I
Sbjct: 34  FDLTALPGAARAGSARRSLIVAEPVGLQPFEADRIIVREPGGSLSFLGGGQWVDRLPRLI 93

Query: 99  QLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFEINIDRHCAIITMSLKIINAHDN 158
           Q +LI + EN   +  V +P   I AD  +++ IR+F+I      A++ +S K+++    
Sbjct: 94  QARLIQSLENARSLRAVSRPGDKIAADTLLVTEIRAFDIAAGSREAVVDLSAKLVSEATG 153

Query: 159 SLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEIIDW 198
           S+V  +VF     +   +       L+RA S + ++++ W
Sbjct: 154 SVVAARVFAARVPVADLSPGASANGLDRALSLVLADVVRW 193


>gi|296445999|ref|ZP_06887949.1| protein of unknown function DUF330 [Methylosinus trichosporium
           OB3b]
 gi|296256517|gb|EFH03594.1| protein of unknown function DUF330 [Methylosinus trichosporium
           OB3b]
          Length = 191

 Score = 86.3 bits (212), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 42/148 (28%), Positives = 82/148 (55%), Gaps = 4/148 (2%)

Query: 57  LIITEPITEKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVV 116
           L + EP   + ++S+ I++R+ P  + +L  +QW D+LPR++Q +LIA F+   K   VV
Sbjct: 47  LAVAEPHAIQPVDSDRIVIRTGPNGLAHLAEAQWVDRLPRLVQARLIAAFDRGRKTGFVV 106

Query: 117 KPNQGIYADYQIISA-IRSFEINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKD 175
           +P Q   A  +I+S  IR FEI++    A++ ++ +I++    +    ++F  E   E  
Sbjct: 107 RPGQ---AAERILSTDIRRFEIDVSSGEAVVEIAAEILDLRGAATGPGRIFSAEAPAEHS 163

Query: 176 NKLHFIQSLNRAFSRISSEIIDWTLSSL 203
                + +L+ A + +  +I+ WT + +
Sbjct: 164 TGPAAVHALDEALTSVLRQIVRWTAAQV 191


>gi|194364299|ref|YP_002026909.1| hypothetical protein Smal_0521 [Stenotrophomonas maltophilia
           R551-3]
 gi|194347103|gb|ACF50226.1| protein of unknown function DUF330 [Stenotrophomonas maltophilia
           R551-3]
          Length = 213

 Score = 85.9 bits (211), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 48/200 (24%), Positives = 99/200 (49%), Gaps = 8/200 (4%)

Query: 9   IKKKIISCSLAVLL--CTSLSSCFFHNNPVNIYDLTESTKYDES-VQRHIQLIITEPITE 65
           + + +++ S+  LL  C+ L S       V +Y  +   K D +  Q   QL++ +P   
Sbjct: 6   LPRLLLATSMLALLGGCSILGSS--EKTAVTLYSPSVQVKADPAWPQASWQLVLAKPSAA 63

Query: 66  KILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYAD 125
           ++++S  I VR +P +++   G+ W+     MI+  L+  FE++G+I  V +   GI AD
Sbjct: 64  RMVDSPRINVRPTPSQLEIYKGASWAQPATDMIEDTLLRGFEDSGRIRGVARSTAGIRAD 123

Query: 126 YQIISAIRSFEINIDRHCA---IITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQ 182
           Y++ + +R FE +         +I ++ K+I+  D  +V  + F   + +   +      
Sbjct: 124 YKLSTDVRRFESDYQGQATPTVVIEVNAKLIHVADQRVVADRTFRQSQPVGSTDVPAVTA 183

Query: 183 SLNRAFSRISSEIIDWTLSS 202
           +  R   +++ +++ WTL S
Sbjct: 184 AFERGLQQLAQDVVGWTLQS 203


>gi|188580088|ref|YP_001923533.1| hypothetical protein Mpop_0820 [Methylobacterium populi BJ001]
 gi|179343586|gb|ACB78998.1| protein of unknown function DUF330 [Methylobacterium populi BJ001]
          Length = 207

 Score = 85.9 bits (211), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 42/142 (29%), Positives = 84/142 (59%)

Query: 57  LIITEPITEKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVV 116
           ++++EP+  + + ++ IIVR     + +L G QW+D+LPR+IQ ++I + EN G++ +V 
Sbjct: 61  IVVSEPVGLQPMEADRIIVREPGGSLSFLGGGQWADRLPRLIQTRVIQSLENTGRLRSVS 120

Query: 117 KPNQGIYADYQIISAIRSFEINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDN 176
           +P   + +DYQ++S IR F+IN     A++ +S K+I      +V  +VF     ++K +
Sbjct: 121 RPTDKVPSDYQLVSEIREFDINSGTGEAVVDLSAKLIAEGSGRVVNARVFTARVPVQKVD 180

Query: 177 KLHFIQSLNRAFSRISSEIIDW 198
                  L+ A  ++ ++++ W
Sbjct: 181 PQSAAAGLDAALGQVLADLVRW 202


>gi|190572711|ref|YP_001970556.1| hypothetical protein Smlt0659 [Stenotrophomonas maltophilia K279a]
 gi|190010633|emb|CAQ44242.1| conserved hypothetical protein [Stenotrophomonas maltophilia K279a]
          Length = 213

 Score = 85.9 bits (211), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 49/200 (24%), Positives = 98/200 (49%), Gaps = 8/200 (4%)

Query: 9   IKKKIISCSLAVLL--CTSLSSCFFHNNPVNIYDLTESTKYDES-VQRHIQLIITEPITE 65
           + + +++ SL  LL  C+ L S       V +Y      K D +  Q   QL++ +P   
Sbjct: 6   LPRLLLAASLVTLLGGCSILGSS--EKTAVTLYSPAVQVKADPAWPQASWQLVLAKPSAA 63

Query: 66  KILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYAD 125
           ++++S  I VR +P +++   G+ W+     MI+  L+  FE++G+I  V +   GI AD
Sbjct: 64  RMVDSPRINVRPTPSQLEIYKGASWAQPATDMIEDTLLRGFEDSGRIHGVARSTAGIRAD 123

Query: 126 YQIISAIRSFEINIDRHCA---IITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQ 182
           Y++ + +R FE +         +I ++ K+I+  D  +V  + F   + +   +      
Sbjct: 124 YKLSTDVRRFESDYQGQATPTVVIEVNAKLIHVADQRVVADRTFRQAQPVGSTDVPAVTA 183

Query: 183 SLNRAFSRISSEIIDWTLSS 202
           +  R   +++ +++ WTL S
Sbjct: 184 AFERGLQQLAQDVVGWTLVS 203


>gi|254559578|ref|YP_003066673.1| ABC transporter auxiliary protein [Methylobacterium extorquens DM4]
 gi|254266856|emb|CAX22655.1| putative uncharacterized ABC-transporter auxiliary component
           [Methylobacterium extorquens DM4]
          Length = 207

 Score = 85.9 bits (211), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 41/142 (28%), Positives = 85/142 (59%)

Query: 57  LIITEPITEKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVV 116
           ++++EP+  + + ++ IIVR     + +L G QW+D+LPR+IQ ++I + EN G++ +V 
Sbjct: 61  IVVSEPVGLQPMEADRIIVREPGGSLSFLGGGQWADRLPRLIQTRVIQSLENTGRLRSVS 120

Query: 117 KPNQGIYADYQIISAIRSFEINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDN 176
           +P+  + +DYQ++S IR F++N     A++ +S K+I      +V  +VF     ++K +
Sbjct: 121 RPSDKVPSDYQLVSEIREFDVNSGTGEAVVDLSAKLIGEGTGRVVNARVFTARVPVKKVD 180

Query: 177 KLHFIQSLNRAFSRISSEIIDW 198
                  L+ A  ++ ++++ W
Sbjct: 181 PQSAAAGLDAALGQVLADLVRW 202


>gi|325919795|ref|ZP_08181788.1| ABC-type uncharacterized transport system, auxiliary component
           [Xanthomonas gardneri ATCC 19865]
 gi|325920776|ref|ZP_08182681.1| ABC-type uncharacterized transport system, auxiliary component
           [Xanthomonas gardneri ATCC 19865]
 gi|325921243|ref|ZP_08183103.1| ABC-type uncharacterized transport system, auxiliary component
           [Xanthomonas gardneri ATCC 19865]
 gi|325921531|ref|ZP_08183383.1| ABC-type uncharacterized transport system, auxiliary component
           [Xanthomonas gardneri ATCC 19865]
 gi|325921654|ref|ZP_08183489.1| ABC-type uncharacterized transport system, auxiliary component
           [Xanthomonas gardneri ATCC 19865]
 gi|325922542|ref|ZP_08184302.1| ABC-type uncharacterized transport system, auxiliary component
           [Xanthomonas gardneri ATCC 19865]
 gi|325923181|ref|ZP_08184866.1| ABC-type uncharacterized transport system, auxiliary component
           [Xanthomonas gardneri ATCC 19865]
 gi|325923305|ref|ZP_08184978.1| ABC-type uncharacterized transport system, auxiliary component
           [Xanthomonas gardneri ATCC 19865]
 gi|325924093|ref|ZP_08185660.1| ABC-type uncharacterized transport system, auxiliary component
           [Xanthomonas gardneri ATCC 19865]
 gi|325545425|gb|EGD16712.1| ABC-type uncharacterized transport system, auxiliary component
           [Xanthomonas gardneri ATCC 19865]
 gi|325546232|gb|EGD17413.1| ABC-type uncharacterized transport system, auxiliary component
           [Xanthomonas gardneri ATCC 19865]
 gi|325546326|gb|EGD17495.1| ABC-type uncharacterized transport system, auxiliary component
           [Xanthomonas gardneri ATCC 19865]
 gi|325546981|gb|EGD18075.1| ABC-type uncharacterized transport system, auxiliary component
           [Xanthomonas gardneri ATCC 19865]
 gi|325547843|gb|EGD18862.1| ABC-type uncharacterized transport system, auxiliary component
           [Xanthomonas gardneri ATCC 19865]
 gi|325547979|gb|EGD18981.1| ABC-type uncharacterized transport system, auxiliary component
           [Xanthomonas gardneri ATCC 19865]
 gi|325548210|gb|EGD19204.1| ABC-type uncharacterized transport system, auxiliary component
           [Xanthomonas gardneri ATCC 19865]
 gi|325548750|gb|EGD19699.1| ABC-type uncharacterized transport system, auxiliary component
           [Xanthomonas gardneri ATCC 19865]
 gi|325549709|gb|EGD20570.1| ABC-type uncharacterized transport system, auxiliary component
           [Xanthomonas gardneri ATCC 19865]
          Length = 214

 Score = 85.9 bits (211), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 52/194 (26%), Positives = 94/194 (48%), Gaps = 11/194 (5%)

Query: 18  LAVLLCTSL---SSCFF----HNNPVNIYDLTESTKYDES-VQRHIQLIITEPITEKILN 69
           L  LLC SL     C         P  IY  T     + S  Q   QL + +P   ++++
Sbjct: 7   LRPLLCVSLLTLGGCSLLTGGDQKPATIYAPTVRITPNPSWPQVSWQLSVAKPSAARVID 66

Query: 70  SEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQII 129
           S  I VR +P E+Q   G+ W+     M++  ++  FE++GKI+ V +   GI +DY+++
Sbjct: 67  SPRINVRPTPGELQVYHGAGWAQPATDMLEDSVVRAFEDSGKIAAVARIGTGIRSDYKLV 126

Query: 130 SAIRSFEINIDRH---CAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNR 186
             +R FE +        A I ++ K+++A D  +V  + F V       +      +  +
Sbjct: 127 IDLRRFESDYAGQSLPSATIELNAKLLHAADQRVVASRTFLVARPSTGTDTATVAAAFEQ 186

Query: 187 AFSRISSEIIDWTL 200
           A +++++E++ WTL
Sbjct: 187 AMTQVTTELVGWTL 200


>gi|254522526|ref|ZP_05134581.1| lipoprotein [Stenotrophomonas sp. SKA14]
 gi|219720117|gb|EED38642.1| lipoprotein [Stenotrophomonas sp. SKA14]
          Length = 213

 Score = 85.9 bits (211), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 48/200 (24%), Positives = 99/200 (49%), Gaps = 8/200 (4%)

Query: 9   IKKKIISCSLAVLL--CTSLSSCFFHNNPVNIYDLTESTKYDES-VQRHIQLIITEPITE 65
           + + +++ S+  LL  C+ L S       V +Y      K D +  Q   QL++ +P   
Sbjct: 6   LPRLLLAASMVTLLGGCSILGSS--EKTAVTLYSPAVQVKADPAWPQASWQLVLAKPSAA 63

Query: 66  KILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYAD 125
           ++++S  I VR +P +++   G+ W+     MI+  L+  FE++G+I  V + + GI AD
Sbjct: 64  RMVDSPRINVRPTPSQMEIYKGASWAQPATDMIEDTLLRGFEDSGRIRGVARSSAGIRAD 123

Query: 126 YQIISAIRSFEINIDRHCA---IITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQ 182
           Y++ + +R FE +         +I ++ K+I+  D  +V  + F   + +   +      
Sbjct: 124 YKLSTDVRRFESDYQGQATPTVVIEVNAKLIHVADQRVVADRTFRQAQPVGSTDVPAVTA 183

Query: 183 SLNRAFSRISSEIIDWTLSS 202
           +  R   +++ +++ WTL S
Sbjct: 184 AFERGLQQLAQDVVGWTLVS 203


>gi|118588761|ref|ZP_01546169.1| putative ABC transporter protein [Stappia aggregata IAM 12614]
 gi|118438747|gb|EAV45380.1| putative ABC transporter protein [Stappia aggregata IAM 12614]
          Length = 201

 Score = 85.5 bits (210), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 49/206 (23%), Positives = 99/206 (48%), Gaps = 14/206 (6%)

Query: 1   MDKKLNKIIKKKIISC-SLAVLL---CTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQ 56
           M K    + ++ +++   L VL+    +S  S ++     ++  L       +     +Q
Sbjct: 1   MTKATTDMTRRGVLTALGLGVLVSGCASSTPSAYYSIGAADVGGL-------QGRSSRVQ 53

Query: 57  LIITEPITEKILNSEDI-IVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTV 115
           +++  P   K L++  I +V   P+   Y   S W+D LP ++Q KL+   +N  ++  V
Sbjct: 54  VLVAAPRALKALDTSYIAVVDKGPV-YSYFPDSAWADSLPNVVQSKLVETLQNTNRLRGV 112

Query: 116 VKPNQGIYADYQIISAIRSFEINI-DRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEK 174
             P  G+  DYQ+ + IR+FE+ +   +  ++ +S +I+N  +   V  KVF  E     
Sbjct: 113 GLPGDGLLIDYQLQTEIRAFELQLAGANRGVVEISARIVNDRNGQTVANKVFRAETSAGS 172

Query: 175 DNKLHFIQSLNRAFSRISSEIIDWTL 200
            +    ++++N +  R+ +E+  WTL
Sbjct: 173 TSVNKAVEAMNASADRVFAEMAAWTL 198


>gi|260430757|ref|ZP_05784729.1| conserved hypothetical protein [Silicibacter lacuscaerulensis
           ITI-1157]
 gi|260418198|gb|EEX11456.1| conserved hypothetical protein [Silicibacter lacuscaerulensis
           ITI-1157]
          Length = 214

 Score = 85.5 bits (210), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 43/191 (22%), Positives = 97/191 (50%), Gaps = 18/191 (9%)

Query: 23  CTSLSSCFFHNNPVNIYDLTESTKYDESVQR-HIQLIITEPITEKILNSEDIIVRSSPIE 81
           CT L +    + P ++Y LT  + +  S+ R   Q+++ EP     ++++ I V+ +P++
Sbjct: 13  CTGLGTLKQASQPNDLYLLTPKSTFSSSLPRVSKQIVVQEPTATAAVDTDQIAVQPTPLQ 72

Query: 82  IQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFE----- 136
           +QYL  ++W D+ P ++Q  L+ +FEN+ +++ V +   G+ ADY I+  +R F+     
Sbjct: 73  VQYLPRARWVDRAPLIVQALLVESFENSNRVAAVGRSTVGLRADYVIVPDLREFQGIVVG 132

Query: 137 -------INIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFS 189
                  + ID     + +++KII+  ++ ++    F  +     D     + + ++A  
Sbjct: 133 ETQDSKTVKID-----VRINIKIIDEFEDKIIASNSFQRDVIAASDQTPDLVAAFDQALG 187

Query: 190 RISSEIIDWTL 200
                 ++W++
Sbjct: 188 STMRNAVEWSI 198


>gi|21230107|ref|NP_636024.1| hypothetical protein XCC0632 [Xanthomonas campestris pv. campestris
           str. ATCC 33913]
 gi|66769902|ref|YP_244664.1| hypothetical protein XC_3602 [Xanthomonas campestris pv. campestris
           str. 8004]
 gi|21111635|gb|AAM39948.1| conserved hypothetical protein [Xanthomonas campestris pv.
           campestris str. ATCC 33913]
 gi|66575234|gb|AAY50644.1| conserved hypothetical protein [Xanthomonas campestris pv.
           campestris str. 8004]
          Length = 214

 Score = 85.5 bits (210), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 52/194 (26%), Positives = 93/194 (47%), Gaps = 11/194 (5%)

Query: 18  LAVLLCTSL---SSCFF----HNNPVNIYDLT-ESTKYDESVQRHIQLIITEPITEKILN 69
           L  LLC SL     C         P  IY  T   T      Q   QL++ +P   +I++
Sbjct: 7   LRPLLCVSLLALGGCSVLTGGDQKPATIYAPTVRVTPNPAWPQVSWQLLVAKPSAARIID 66

Query: 70  SEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQII 129
           S  I VR +P E+Q   G+ W+     M++  ++  FE++GKI+ V +   GI +DY++ 
Sbjct: 67  SPRINVRPTPGELQVYHGAGWAQPATDMLEDSVVRAFEDSGKIAAVARIGAGIRSDYKLA 126

Query: 130 SAIRSFEINIDRH---CAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNR 186
             +R FE +        A I ++ K++++ D  +V  + F V       +      +  +
Sbjct: 127 IDVRRFESDYAGQSLPAATIELNAKLLHSSDQRVVASRTFTVARPSSSTDTAAVAAAFEQ 186

Query: 187 AFSRISSEIIDWTL 200
           A +++++E++ WTL
Sbjct: 187 ALTQVTTELVGWTL 200


>gi|218516886|ref|ZP_03513726.1| putative ABC transporter protein [Rhizobium etli 8C-3]
          Length = 96

 Score = 84.7 bits (208), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 42/97 (43%), Positives = 63/97 (64%), Gaps = 2/97 (2%)

Query: 108 NNGKISTVVKPNQGIYADYQIISAIRSFEINI-DRHCAIITMSLKIINAHDNSLVGQKVF 166
           N+GK+  V  P QG+  DYQ+++ IRSFEI+    + A++ +S+KI+N  + S+  QKVF
Sbjct: 1   NSGKLGGVGLPGQGLAIDYQVVTDIRSFEIDASSGNQAVVEISVKILNDRNGSVRAQKVF 60

Query: 167 HVEEKLEKDNKLHFIQSLNRAFSRISSEIIDWTLSSL 203
                   DN   F++SL+RAFS + SEI+ WTL S+
Sbjct: 61  RATAPAGGDNA-GFVKSLDRAFSTVVSEIVSWTLRSI 96


>gi|163850327|ref|YP_001638370.1| hypothetical protein Mext_0894 [Methylobacterium extorquens PA1]
 gi|163661932|gb|ABY29299.1| protein of unknown function DUF330 [Methylobacterium extorquens
           PA1]
          Length = 207

 Score = 84.7 bits (208), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 41/142 (28%), Positives = 85/142 (59%)

Query: 57  LIITEPITEKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVV 116
           ++++EP+  + + ++ IIVR     + +L G QW+D+LPR+IQ ++I + EN G++ +V 
Sbjct: 61  IVVSEPVGLQPMEADRIIVREPGGSLSFLGGGQWADRLPRLIQTRVIQSLENTGRLRSVS 120

Query: 117 KPNQGIYADYQIISAIRSFEINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDN 176
           +P+  + +DYQ++S IR F++N     A++ +S K+I      +V  +VF     ++K +
Sbjct: 121 RPSDKVPSDYQLVSEIREFDVNSGTGEAVVDLSAKLIAEGTGRVVNARVFTARVPVKKVD 180

Query: 177 KLHFIQSLNRAFSRISSEIIDW 198
                  L+ A  ++ ++++ W
Sbjct: 181 PQSAAAGLDAALGQVLADLVRW 202


>gi|218528884|ref|YP_002419700.1| hypothetical protein Mchl_0854 [Methylobacterium chloromethanicum
           CM4]
 gi|240137398|ref|YP_002961869.1| putative uncharacterized ABC-transporter auxiliary component
           [Methylobacterium extorquens AM1]
 gi|218521187|gb|ACK81772.1| protein of unknown function DUF330 [Methylobacterium
           chloromethanicum CM4]
 gi|240007366|gb|ACS38592.1| putative uncharacterized ABC-transporter auxiliary component
           [Methylobacterium extorquens AM1]
          Length = 207

 Score = 84.7 bits (208), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 41/142 (28%), Positives = 85/142 (59%)

Query: 57  LIITEPITEKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVV 116
           ++++EP+  + + ++ IIVR     + +L G QW+D+LPR+IQ ++I + EN G++ +V 
Sbjct: 61  IVVSEPVGLQPMEADRIIVREPGGSLSFLGGGQWADRLPRLIQTRVIQSLENTGRLRSVS 120

Query: 117 KPNQGIYADYQIISAIRSFEINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDN 176
           +P+  + +DYQ++S IR F++N     A++ +S K+I      +V  +VF     ++K +
Sbjct: 121 RPSDKVPSDYQLVSEIREFDVNSGTGEAVVDLSAKLIAEGTGRVVNARVFTARVPVKKVD 180

Query: 177 KLHFIQSLNRAFSRISSEIIDW 198
                  L+ A  ++ ++++ W
Sbjct: 181 PQSAAAGLDAALGQVLADLVRW 202


>gi|285019446|ref|YP_003377157.1| secreted protein [Xanthomonas albilineans GPE PC73]
 gi|283474664|emb|CBA17163.1| putative secreted protein [Xanthomonas albilineans]
          Length = 215

 Score = 84.7 bits (208), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 42/148 (28%), Positives = 77/148 (52%), Gaps = 3/148 (2%)

Query: 56  QLIITEPITEKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTV 115
           QL +T+P   ++++S  I VR +P E+Q   G  W+     M +  L+  FE++G+I  V
Sbjct: 51  QLALTKPSATRMIDSPRIAVRPTPDELQVYSGVSWAQPATDMFEDTLLRAFEDSGRIPGV 110

Query: 116 VKPNQGIYADYQIISAIRSFEINIDRH---CAIITMSLKIINAHDNSLVGQKVFHVEEKL 172
            +   GI ADY+++  +R FE +   H    A I ++ K+++  D  +V    F V +  
Sbjct: 111 ARLGTGIGADYKLLLDLRRFESDYAGHDVPAATIELNAKLLHTVDQRVVSSHTFLVTQTA 170

Query: 173 EKDNKLHFIQSLNRAFSRISSEIIDWTL 200
               +   + +  +A S++S  ++ WTL
Sbjct: 171 GGTTEAQVVDAFGQALSQLSRAVVGWTL 198


>gi|294624130|ref|ZP_06702868.1| conserved hypothetical protein [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 11122]
 gi|292601575|gb|EFF45574.1| conserved hypothetical protein [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 11122]
          Length = 211

 Score = 84.0 bits (206), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 52/196 (26%), Positives = 94/196 (47%), Gaps = 11/196 (5%)

Query: 18  LAVLLCTSL---SSCFF----HNNPVNIYDLT-ESTKYDESVQRHIQLIITEPITEKILN 69
           L  LLC SL     C         P  IY  T   T      Q   QL++ +P   ++++
Sbjct: 4   LRPLLCVSLLALGGCSVLTGGDQKPATIYAPTVRVTPKPAWPQVTWQLVVAKPSAARVID 63

Query: 70  SEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQII 129
           S  I VR SP E+Q   G+ W+     M++  ++  FE++GKI+ V     GI +DY++ 
Sbjct: 64  SPRINVRPSPGELQVYHGAGWAQPATDMLEDSVVRAFEDSGKIAAVAHIGTGIRSDYKLA 123

Query: 130 SAIRSFEINIDRH---CAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNR 186
             +R FE +        A I ++ K++++ D  +V  + F V       +      +  +
Sbjct: 124 IDLRRFESDYAGQSLPSATIELNAKLLHSADQRVVASRTFLVARPSTGTDTAAVAVAFEQ 183

Query: 187 AFSRISSEIIDWTLSS 202
           A +++++E++ WTL++
Sbjct: 184 ALTQLTTELVGWTLTT 199


>gi|312115048|ref|YP_004012644.1| hypothetical protein Rvan_2321 [Rhodomicrobium vannielii ATCC
           17100]
 gi|311220177|gb|ADP71545.1| protein of unknown function DUF330 [Rhodomicrobium vannielii ATCC
           17100]
          Length = 198

 Score = 84.0 bits (206), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 45/199 (22%), Positives = 95/199 (47%), Gaps = 13/199 (6%)

Query: 3   KKLNKIIKKKIIS-CSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIITE 61
           +K+  I+   ++  C++  L+  S  + F         DL E+ + +    R IQ+ +  
Sbjct: 5   RKIAAIVAAGMLGGCAVGGLVGESAPATF---------DL-EAPQVERMRARGIQITVYP 54

Query: 62  PITEKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQG 121
           P+  K +++ +I+V+     + Y  G+ W D+LP + Q +L+    N+G    V+     
Sbjct: 55  PVAVKTIDTVEILVKGGNGRVAYFSGAAWGDRLPALFQARLVETLANSGAFRAVLTNQDR 114

Query: 122 IYADYQIISAIRSFEINIDRHC--AIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLH 179
           +  D  +   IR F+++       A++ + +K+++   +S++  K FH        +   
Sbjct: 115 VTGDLSLAIEIRDFQVDATSGAPEAVVDVYVKLVDERTSSIITTKRFHARVAAAAPDPNA 174

Query: 180 FIQSLNRAFSRISSEIIDW 198
            I +LN AF ++++EI  W
Sbjct: 175 GIHALNIAFQQVAAEITTW 193


>gi|188993117|ref|YP_001905127.1| Putative secreted protein [Xanthomonas campestris pv. campestris
           str. B100]
 gi|167734877|emb|CAP53089.1| Putative secreted protein [Xanthomonas campestris pv. campestris]
          Length = 214

 Score = 83.6 bits (205), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 52/194 (26%), Positives = 92/194 (47%), Gaps = 11/194 (5%)

Query: 18  LAVLLCTSL---SSCFF----HNNPVNIYDLT-ESTKYDESVQRHIQLIITEPITEKILN 69
           L  LLC SL     C         P  IY  T   T      Q   QL + +P   +I++
Sbjct: 7   LRPLLCVSLLALGGCSVLTGGDQKPATIYAPTVRVTPNPAWPQVSWQLSVAKPSAARIID 66

Query: 70  SEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQII 129
           S  I VR +P E+Q   G+ W+     M++  ++  FE++GKI+ V +   GI +DY++ 
Sbjct: 67  SPRINVRPTPGELQVYHGAGWAQPATDMLEDSVVRAFEDSGKIAAVARIGAGIRSDYKLA 126

Query: 130 SAIRSFEINIDRH---CAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNR 186
             +R FE +        A I ++ K++++ D  +V  + F V       +      +  +
Sbjct: 127 IDVRRFESDYAGQSLPAATIELNAKLLHSSDQRVVASRTFTVARPSSSTDTAAVAAAFEQ 186

Query: 187 AFSRISSEIIDWTL 200
           A +++++E++ WTL
Sbjct: 187 AMTQVTTELVGWTL 200


>gi|294663969|ref|ZP_06729389.1| conserved hypothetical protein [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 10535]
 gi|292606264|gb|EFF49495.1| conserved hypothetical protein [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 10535]
          Length = 211

 Score = 83.6 bits (205), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 52/196 (26%), Positives = 94/196 (47%), Gaps = 11/196 (5%)

Query: 18  LAVLLCTSL---SSCFF----HNNPVNIYDLT-ESTKYDESVQRHIQLIITEPITEKILN 69
           L  LLC SL     C         P  IY  T   T      Q   QL++ +P   ++++
Sbjct: 4   LRPLLCVSLLALGGCSVLTGGDQKPATIYAPTVRVTPNPAWPQVTWQLVVAKPSAARVID 63

Query: 70  SEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQII 129
           S  I VR SP E+Q   G+ W+     M++  ++  FE++GKI+ V     GI +DY++ 
Sbjct: 64  SPRINVRPSPGELQVYHGAGWAQPATDMLEDSVVRAFEDSGKIAAVAHIGTGIRSDYKLA 123

Query: 130 SAIRSFEINIDRH---CAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNR 186
             +R FE +        A I ++ K++++ D  +V  + F V       +      +  +
Sbjct: 124 IDLRRFESDYAGQSLPSATIELNAKLLHSADQRVVASRTFLVARPSTGTDTAAVAVAFEQ 183

Query: 187 AFSRISSEIIDWTLSS 202
           A +++++E++ WTL++
Sbjct: 184 ALTQLTTELVGWTLTT 199


>gi|289662619|ref|ZP_06484200.1| putative secreted protein [Xanthomonas campestris pv. vasculorum
           NCPPB702]
 gi|289668436|ref|ZP_06489511.1| putative secreted protein [Xanthomonas campestris pv. musacearum
           NCPPB4381]
          Length = 214

 Score = 83.2 bits (204), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 49/200 (24%), Positives = 99/200 (49%), Gaps = 6/200 (3%)

Query: 7   KIIKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLT-ESTKYDESVQRHIQLIITEPITE 65
           ++++  +    LA+  C+ L+       P  IY  T   T      Q   QL++ +P   
Sbjct: 5   RLLRPMLCVSLLALGGCSVLTGG--DQKPATIYSPTVRVTPNPAWPQVTWQLVVAKPSAA 62

Query: 66  KILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYAD 125
           +I++S  I VR +P E+Q   G+ W+     M++  ++  FE++GKI+ V     GI +D
Sbjct: 63  RIIDSPRINVRPTPGELQVYQGAGWAQPATDMLEDSVVRAFEDSGKIAAVAHIGTGIRSD 122

Query: 126 YQIISAIRSFEINIDRH---CAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQ 182
           Y++   +R FE +        A I ++ K++++ D  +V  + F V       +      
Sbjct: 123 YKLAIDLRRFESDYAGQSLPSATIELNAKLLHSADQRVVASRTFLVARPSTGTDTAAVAV 182

Query: 183 SLNRAFSRISSEIIDWTLSS 202
           +  +A +++++E++ WTL++
Sbjct: 183 AFEQALNQVTTELVGWTLTT 202


>gi|78049254|ref|YP_365429.1| putative secreted protein [Xanthomonas campestris pv. vesicatoria
           str. 85-10]
 gi|78037684|emb|CAJ25429.1| putative secreted protein [Xanthomonas campestris pv. vesicatoria
           str. 85-10]
          Length = 214

 Score = 83.2 bits (204), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 51/193 (26%), Positives = 93/193 (48%), Gaps = 11/193 (5%)

Query: 21  LLCTSL---SSCFF----HNNPVNIYDLT-ESTKYDESVQRHIQLIITEPITEKILNSED 72
           LLC SL     C         P  IY  T   T      Q   QL++ +P   ++++S  
Sbjct: 10  LLCVSLLALGGCSVLAGGDKKPATIYAPTVRVTPNPTWPQVTWQLVVAKPSAARVIDSPR 69

Query: 73  IIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAI 132
           I VR +P E+Q   G+ W+     M++  ++  FE++GKI+ V     GI +DY++   +
Sbjct: 70  INVRPTPGELQVYHGAGWAQPATDMLEDSVVRAFEDSGKIAAVAHIGTGIRSDYKLAIDL 129

Query: 133 RSFEINIDRH---CAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFS 189
           R FE +        A I ++ K++++ D  +V  + F V       +      +  +A +
Sbjct: 130 RRFESDYAGQSLPSATIELNAKLLHSTDQRVVASRTFLVARPSTGTDTAAVAVAFEQALT 189

Query: 190 RISSEIIDWTLSS 202
           +I++E++ WTL++
Sbjct: 190 QITTELVGWTLTA 202


>gi|325928561|ref|ZP_08189749.1| ABC-type uncharacterized transport system, auxiliary component
           [Xanthomonas perforans 91-118]
 gi|325541100|gb|EGD12654.1| ABC-type uncharacterized transport system, auxiliary component
           [Xanthomonas perforans 91-118]
          Length = 214

 Score = 82.8 bits (203), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 48/200 (24%), Positives = 100/200 (50%), Gaps = 6/200 (3%)

Query: 7   KIIKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLT-ESTKYDESVQRHIQLIITEPITE 65
           ++++  + +  LA+  C+ L+       P  IY  T   T      Q   QL++ +P   
Sbjct: 5   RVLRPLLCASLLALGGCSVLTGG--DQKPATIYAPTVRVTPNPNWPQVTWQLVVAKPSAA 62

Query: 66  KILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYAD 125
           ++++S  I VR +P E+Q   G+ W+     M++  ++  FE++GKI+ V     GI +D
Sbjct: 63  RVIDSPRINVRPTPGELQVYHGAGWAQPATDMLEDSVVRAFEDSGKIAAVAHIGTGIRSD 122

Query: 126 YQIISAIRSFEINIDRH---CAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQ 182
           Y++   +R FE +        A I ++ K++++ D  +V  + F V       +      
Sbjct: 123 YKLAIDLRRFESDYAGQSLPSATIELNAKLLHSTDQRVVASRTFLVARLSTGTDTAAVAV 182

Query: 183 SLNRAFSRISSEIIDWTLSS 202
           +  +A +++++E++ WTL++
Sbjct: 183 AFEQALTQVTTELVGWTLTA 202


>gi|119390266|pdb|2IQI|A Chain A, Crystal Structure Of Protein Xcc0632 From Xanthomonas
           Campestris, Pfam Duf330
 gi|119390267|pdb|2IQI|B Chain B, Crystal Structure Of Protein Xcc0632 From Xanthomonas
           Campestris, Pfam Duf330
 gi|119390268|pdb|2IQI|C Chain C, Crystal Structure Of Protein Xcc0632 From Xanthomonas
           Campestris, Pfam Duf330
 gi|119390269|pdb|2IQI|D Chain D, Crystal Structure Of Protein Xcc0632 From Xanthomonas
           Campestris, Pfam Duf330
 gi|119390270|pdb|2IQI|E Chain E, Crystal Structure Of Protein Xcc0632 From Xanthomonas
           Campestris, Pfam Duf330
 gi|119390271|pdb|2IQI|F Chain F, Crystal Structure Of Protein Xcc0632 From Xanthomonas
           Campestris, Pfam Duf330
 gi|119390272|pdb|2IQI|G Chain G, Crystal Structure Of Protein Xcc0632 From Xanthomonas
           Campestris, Pfam Duf330
 gi|119390273|pdb|2IQI|H Chain H, Crystal Structure Of Protein Xcc0632 From Xanthomonas
           Campestris, Pfam Duf330
          Length = 192

 Score = 82.4 bits (202), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 45/172 (26%), Positives = 86/172 (50%), Gaps = 4/172 (2%)

Query: 33  NNPVNIYDLT-ESTKYDESVQRHIQLIITEPITEKILNSEDIIVRSSPIEIQYLIGSQWS 91
             P  IY  T   T      Q   QL++ +P   +I++S  I VR +P E+Q   G+ W+
Sbjct: 7   QKPATIYAPTVRVTPNPAWPQVSWQLLVAKPSAARIIDSPRINVRPTPGELQVYHGAGWA 66

Query: 92  DKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFEINIDRH---CAIITM 148
                M++  ++  FE++GKI+ V +   GI +DY++   +R FE +        A I +
Sbjct: 67  QPATDMLEDSVVRAFEDSGKIAAVARIGAGIRSDYKLAIDVRRFESDYAGQSLPAATIEL 126

Query: 149 SLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEIIDWTL 200
           + K++++ D  +V  + F V       +      +  +A +++++E++ WTL
Sbjct: 127 NAKLLHSSDQRVVASRTFTVARPSSSTDTAAVAAAFEQALTQVTTELVGWTL 178


>gi|330501343|ref|YP_004378212.1| hypothetical protein MDS_0429 [Pseudomonas mendocina NK-01]
 gi|328915629|gb|AEB56460.1| hypothetical protein MDS_0429 [Pseudomonas mendocina NK-01]
          Length = 199

 Score = 82.0 bits (201), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 39/176 (22%), Positives = 93/176 (52%), Gaps = 2/176 (1%)

Query: 28  SCFFHNNPVNIYDLTESTKYDESVQRHIQLIITEPITEKILNSEDIIVRSSPIEIQYLIG 87
           S    + P++IY L  +T   ++ +    L +  P++ ++L+   I+V   P  +    G
Sbjct: 17  SILPQSEPLDIYLLPATTLPAQTQRVDWSLRVNSPVSNQLLDGTRIVVLPEPGRVNTYQG 76

Query: 88  SQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSF--EINIDRHCAI 145
            +WS++ P++++ +L+  F+++G+I  +   +Q + AD +++S +RSF  E       A+
Sbjct: 77  VRWSERTPQLLRARLLDAFQDDGRIQALSNEDQRLQADLELVSDLRSFHSEYRDGIPSAL 136

Query: 146 ITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEIIDWTLS 201
           I + + +++     ++  + F V +     +    + +  +A  ++S E++DWTL+
Sbjct: 137 IRLEVNLVDTRSQKIIASRRFSVSQAAGDTSITAVVTAFGKAADQLSRELVDWTLA 192


>gi|166713442|ref|ZP_02244649.1| hypothetical protein Xoryp_18885 [Xanthomonas oryzae pv. oryzicola
           BLS256]
          Length = 214

 Score = 81.6 bits (200), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 51/196 (26%), Positives = 93/196 (47%), Gaps = 11/196 (5%)

Query: 18  LAVLLCTSL---SSCFF----HNNPVNIYDLTESTKYDES-VQRHIQLIITEPITEKILN 69
           L  LLC SL     C         P  IY  T     + +  Q   QL++ +P   +I++
Sbjct: 7   LRPLLCVSLLALGGCSVLTGGDQKPATIYSPTVRVSPNPAWPQVAWQLVVAKPSAARIID 66

Query: 70  SEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQII 129
           S  I VR +P E+Q   G  W+     M++  ++  FE++GKI+ V     GI +DY++ 
Sbjct: 67  SPRINVRPTPGELQVYQGVGWAQPATDMLEDSVVRAFEDSGKIAAVAHIGTGIRSDYKLA 126

Query: 130 SAIRSFEINIDRH---CAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNR 186
             +R FE +        A I ++ K++++ D  +V  + F V              +  +
Sbjct: 127 IDLRRFESDYAGQPLPSATIELNAKLLHSSDQRVVASRTFLVARPSTSTETAAVAVAFEQ 186

Query: 187 AFSRISSEIIDWTLSS 202
           A +++++E++ WTL++
Sbjct: 187 ALTQVTTELVGWTLTT 202


>gi|325915747|ref|ZP_08178049.1| ABC-type uncharacterized transport system, auxiliary component
           [Xanthomonas vesicatoria ATCC 35937]
 gi|325538011|gb|EGD09705.1| ABC-type uncharacterized transport system, auxiliary component
           [Xanthomonas vesicatoria ATCC 35937]
          Length = 214

 Score = 81.6 bits (200), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 51/196 (26%), Positives = 93/196 (47%), Gaps = 11/196 (5%)

Query: 18  LAVLLCTSL---SSCFFHNN----PVNIYDLT-ESTKYDESVQRHIQLIITEPITEKILN 69
           L  LLC SL     C         P  IY  T   T      Q   QL + +P   +I++
Sbjct: 7   LRPLLCVSLLALGGCSVLTGGDKKPATIYAPTVRVTPNPTWPQVTWQLAVAKPSAARIID 66

Query: 70  SEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQII 129
           S  I VR +P E+Q   G+ W+     M++  ++  FE++GKI+ V +   GI +DY++ 
Sbjct: 67  SPRINVRPTPGELQVYHGAGWAQPATDMLEDSVVRAFEDSGKIAAVARIGAGIRSDYKLA 126

Query: 130 SAIRSFEINIDRH---CAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNR 186
             +R FE +        A I ++ K++++ D  +   + F V       +      +  +
Sbjct: 127 IDVRRFEADYAGQSVPSATIELNAKLLHSSDQRVAASRTFLVARPSTSTDIAAVAAAFEQ 186

Query: 187 AFSRISSEIIDWTLSS 202
           A +++++E++ WTL++
Sbjct: 187 ALTQVTTELVGWTLTT 202


>gi|21244298|ref|NP_643880.1| hypothetical protein XAC3573 [Xanthomonas axonopodis pv. citri str.
           306]
 gi|21109948|gb|AAM38416.1| conserved hypothetical protein [Xanthomonas axonopodis pv. citri
           str. 306]
          Length = 211

 Score = 81.3 bits (199), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 46/184 (25%), Positives = 91/184 (49%), Gaps = 6/184 (3%)

Query: 23  CTSLSSCFFHNNPVNIYDLT-ESTKYDESVQRHIQLIITEPITEKILNSEDIIVRSSPIE 81
           C+ L+       P  IY  T   T      Q   QL++ +P   ++++S  I VR +P E
Sbjct: 18  CSVLTGG--DQKPATIYAPTVRMTPNPAWPQVTWQLVVAKPSAARVIDSPRINVRPTPGE 75

Query: 82  IQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFEINIDR 141
           +Q   G+ W+     M++  ++  FE++GKI+ V     GI +DY++   +R FE +   
Sbjct: 76  LQVYHGAGWAQPATDMLEDSVVRAFEDSGKIAAVAHIGTGIRSDYKLAIDLRRFESDYAG 135

Query: 142 H---CAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEIIDW 198
                A I ++ K++++ D  +V  + F V       +      +  +A +++++E++ W
Sbjct: 136 QSLPSATIELNAKLLHSADQRVVASRTFLVARPSTGTDTAAVAMAFEQALTQLTTELVGW 195

Query: 199 TLSS 202
           TL++
Sbjct: 196 TLTT 199


>gi|188578637|ref|YP_001915566.1| lipoprotein, putative [Xanthomonas oryzae pv. oryzae PXO99A]
 gi|188523089|gb|ACD61034.1| lipoprotein, putative [Xanthomonas oryzae pv. oryzae PXO99A]
          Length = 211

 Score = 80.9 bits (198), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 51/196 (26%), Positives = 93/196 (47%), Gaps = 11/196 (5%)

Query: 18  LAVLLCTSL---SSCFF----HNNPVNIYDLTESTKYDES-VQRHIQLIITEPITEKILN 69
           L  LLC SL     C         P  IY  T     + +  Q   QL++ +P   +I++
Sbjct: 4   LRPLLCVSLLALGGCSVLTGGDQKPATIYSPTVRVSPNPAWPQVAWQLVVAKPSAARIID 63

Query: 70  SEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQII 129
           S  I VR +P E+Q   G  W+     M++  ++  FE++GKI+ V     GI +DY++ 
Sbjct: 64  SPRINVRPTPGELQVYQGVGWAQPATDMLEDNVVRAFEDSGKIAAVAHIGTGIRSDYKLA 123

Query: 130 SAIRSFEINIDRH---CAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNR 186
             +R FE +        A I  + K++++ D  +V  + F V       +      +  +
Sbjct: 124 IDLRRFESDYASQSLPSATIEFNAKLLHSTDQRVVASRTFLVARPSTSTDTAAVAVAFEQ 183

Query: 187 AFSRISSEIIDWTLSS 202
           A +++++E++ WTL++
Sbjct: 184 ALTQVTTELVGWTLTT 199


>gi|58580426|ref|YP_199442.1| hypothetical protein XOO0803 [Xanthomonas oryzae pv. oryzae
           KACC10331]
 gi|84622388|ref|YP_449760.1| hypothetical protein XOO_0731 [Xanthomonas oryzae pv. oryzae MAFF
           311018]
 gi|58425020|gb|AAW74057.1| conserved hypothetical protein [Xanthomonas oryzae pv. oryzae
           KACC10331]
 gi|84366328|dbj|BAE67486.1| conserved hypothetical protein [Xanthomonas oryzae pv. oryzae MAFF
           311018]
          Length = 214

 Score = 80.9 bits (198), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 51/196 (26%), Positives = 93/196 (47%), Gaps = 11/196 (5%)

Query: 18  LAVLLCTSL---SSCFF----HNNPVNIYDLTESTKYDES-VQRHIQLIITEPITEKILN 69
           L  LLC SL     C         P  IY  T     + +  Q   QL++ +P   +I++
Sbjct: 7   LRPLLCVSLLALGGCSVLTGGDQKPATIYSPTVRVSPNPAWPQVAWQLVVAKPSAARIID 66

Query: 70  SEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQII 129
           S  I VR +P E+Q   G  W+     M++  ++  FE++GKI+ V     GI +DY++ 
Sbjct: 67  SPRINVRPTPGELQVYQGVGWAQPATDMLEDNVVRAFEDSGKIAAVAHIGTGIRSDYKLA 126

Query: 130 SAIRSFEINIDRH---CAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNR 186
             +R FE +        A I  + K++++ D  +V  + F V       +      +  +
Sbjct: 127 IDLRRFESDYASQSLPSATIEFNAKLLHSTDQRVVASRTFLVARPSTSTDTAAVAVAFEQ 186

Query: 187 AFSRISSEIIDWTLSS 202
           A +++++E++ WTL++
Sbjct: 187 ALTQVTTELVGWTLTT 202


>gi|92117462|ref|YP_577191.1| hypothetical protein Nham_1923 [Nitrobacter hamburgensis X14]
 gi|91800356|gb|ABE62731.1| Mammalian cell entry related protein [Nitrobacter hamburgensis X14]
          Length = 369

 Score = 80.5 bits (197), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 48/168 (28%), Positives = 88/168 (52%), Gaps = 5/168 (2%)

Query: 39  YDLTESTKYDESVQRHIQ--LIITEPITEKILNSEDIIVRSSPIEIQYLIGSQWSDKLPR 96
           YDL  +  +    +R ++  L+I EP     L+++  +  S   E      + W+D +P+
Sbjct: 204 YDLRAAHGFSSPPERTLKSKLVIPEPTAVIKLDTQRFLF-SPAKEYPGFAEAIWADSIPK 262

Query: 97  MIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFEINIDRHCAI-ITMSLKIINA 155
           ++Q KL+ +FEN       ++   G+  DYQ++  IR F+I  D   A+ I +S +I+N 
Sbjct: 263 LLQAKLLESFENYDIAHAPLRSMDGVQGDYQLLIDIRRFQIATDPEPAVDIGLSARILN- 321

Query: 156 HDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEIIDWTLSSL 203
            D  +V  ++F   +KL+K        + N AF RI+ ++I WT+ ++
Sbjct: 322 KDGKVVAARLFQDTQKLDKIEPAAASAAFNDAFGRIAKDMIAWTVKAI 369


>gi|254501713|ref|ZP_05113864.1| hypothetical protein SADFL11_1751 [Labrenzia alexandrii DFL-11]
 gi|222437784|gb|EEE44463.1| hypothetical protein SADFL11_1751 [Labrenzia alexandrii DFL-11]
          Length = 165

 Score = 80.1 bits (196), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 40/152 (26%), Positives = 83/152 (54%), Gaps = 3/152 (1%)

Query: 54  HIQLIITEPITEKILNSEDI-IVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKI 112
            +Q+++  P   K L++  I +V S P+   Y     W+D LP ++Q KL+   +N G++
Sbjct: 15  RVQVLVAPPRALKALDTTYIAVVDSGPV-YSYFPNVAWADTLPNVVQNKLLQTLQNTGRL 73

Query: 113 STVVKPNQGIYADYQIISAIRSFEINIDR-HCAIITMSLKIINAHDNSLVGQKVFHVEEK 171
             V  P  G+  DYQ+ + IR+FE+NI+  +  ++ ++ +++N  +   V   VF  E  
Sbjct: 74  RGVGLPGDGLLIDYQLQTDIRAFELNIEGANRGVVEIAARVVNDRNGRTVANNVFRRETP 133

Query: 172 LEKDNKLHFIQSLNRAFSRISSEIIDWTLSSL 203
               +    ++++N++  ++ ++I  WTL ++
Sbjct: 134 SGSSDVEKAVEAMNQSAEQVFADIAAWTLRNV 165


>gi|146305410|ref|YP_001185875.1| hypothetical protein Pmen_0370 [Pseudomonas mendocina ymp]
 gi|145573611|gb|ABP83143.1| protein of unknown function DUF330 [Pseudomonas mendocina ymp]
          Length = 199

 Score = 79.7 bits (195), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 42/175 (24%), Positives = 92/175 (52%), Gaps = 2/175 (1%)

Query: 28  SCFFHNNPVNIYDLTESTKYDESVQRHIQLIITEPITEKILNSEDIIVRSSPIEIQYLIG 87
           S    + P++IY L  +    +S +    L I  P + ++L+   I+V   P  +    G
Sbjct: 17  SILPQSEPLDIYLLPAAQLPAQSQRVDWALRINSPSSSQLLDGTRIVVLPEPDRVNTYQG 76

Query: 88  SQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSF--EINIDRHCAI 145
            +WS++ P++++ +L+  F+++G+I  +    Q + AD +++S +RSF  E       A+
Sbjct: 77  VRWSERTPQLLRNRLLDAFQDDGRIQALSNEEQRLQADLELVSDLRSFHSEYRDGIPYAL 136

Query: 146 ITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEIIDWTL 200
           I + + +++A D  ++  + F + ++    +    I +  +A  ++S E++DWTL
Sbjct: 137 IRLEVNLVDARDQRILASRRFSISQQASDTSVPAVIAAFGQAGDQLSRELVDWTL 191


>gi|254453840|ref|ZP_05067277.1| conserved hypothetical protein [Octadecabacter antarcticus 238]
 gi|198268246|gb|EDY92516.1| conserved hypothetical protein [Octadecabacter antarcticus 238]
          Length = 215

 Score = 79.7 bits (195), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 42/187 (22%), Positives = 92/187 (49%), Gaps = 6/187 (3%)

Query: 23  CTSLSSCFFHNNPVNIYDLTESTKYD--ESVQRHIQLIITEPITEKILNSEDIIVRSSPI 80
           C++L +      P+++YDL   +     +  Q    +++  P T  +LN++ I++R   +
Sbjct: 22  CSALGALGDVTTPLSVYDLRAPSGAPVIQGGQLAQDVVVEIPTTSGVLNTDRIMIRPDTL 81

Query: 81  EIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSF--EIN 138
           + QYL   +W D++P M+Q  ++ + EN   +  V +       DY I++ +  F  E+ 
Sbjct: 82  QAQYLPDVRWGDEVPVMMQTLMLRSLENTNGLRYVGRRPLAGSGDYAIVTELVDFQAELT 141

Query: 139 IDRHCAIIT--MSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEII 196
            D   A ++  M+ +++   D S+V  + F  ++     +    + + +RA   +  +  
Sbjct: 142 PDGTGATVSIRMTSRLVRERDASIVASRTFRSQQAAASTDTSAIVVAFDRASDALLVDFA 201

Query: 197 DWTLSSL 203
           DWT+++L
Sbjct: 202 DWTITAL 208


>gi|15837901|ref|NP_298589.1| hypothetical protein XF1300 [Xylella fastidiosa 9a5c]
 gi|9106291|gb|AAF84109.1|AE003963_6 conserved hypothetical protein [Xylella fastidiosa 9a5c]
          Length = 213

 Score = 79.3 bits (194), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 51/189 (26%), Positives = 87/189 (46%), Gaps = 5/189 (2%)

Query: 18  LAVLLCTSLSSCFF-HNNPVNIYDLTESTKYDESVQR-HIQLIITEPITEKILNSEDIIV 75
           L+VL   S SS       P  IY        D S  R    L +  P   +++++  I V
Sbjct: 10  LSVLTLASCSSTLLGEKKPTTIYSPQIHVTTDPSWPRVTWHLTVLHPKAPRMIDTPRINV 69

Query: 76  RSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSF 135
           + +P EIQ      W+     M++  LI  FE++GKI+ V +   GI  DY +   +R F
Sbjct: 70  QPTPGEIQVYRNVSWAQPTTDMLEDALIRVFEDSGKIAGVTRAGTGIRTDYSLSLDLRRF 129

Query: 136 E---INIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRIS 192
           E          A I ++ K+I AH+  L+  + F V +     +      +  +A ++++
Sbjct: 130 ESDYAGTPMPTATIEVNAKLIGAHNKRLIASRTFIVTQPATNTDTSTVANAFGQALTQLT 189

Query: 193 SEIIDWTLS 201
           +E++ WTL+
Sbjct: 190 NELVGWTLT 198


>gi|71901852|ref|ZP_00683915.1| conserved hypothetical protein [Xylella fastidiosa Ann-1]
 gi|71728380|gb|EAO30548.1| conserved hypothetical protein [Xylella fastidiosa Ann-1]
          Length = 213

 Score = 79.3 bits (194), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 52/189 (27%), Positives = 88/189 (46%), Gaps = 5/189 (2%)

Query: 18  LAVLLCTSLSSCFF-HNNPVNIYDLTESTKYDESVQR-HIQLIITEPITEKILNSEDIIV 75
           L+VL   S SS       P  IY        D S  R    L I  P   +++++  I V
Sbjct: 10  LSVLTLASCSSTLLGEKKPTTIYSPQIHVTTDPSWPRVTWHLTILHPKAPRMIDTPRINV 69

Query: 76  RSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSF 135
           + +P EIQ      W+     M++  LI  FE++GKI+ V +   GI  DY +   +R F
Sbjct: 70  QPTPGEIQVYHNVSWAQPTTDMLEDALIRVFEDSGKIAGVTRAGTGIRTDYSLSLDLRRF 129

Query: 136 E---INIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRIS 192
           E          A I ++ K+I+AH+  L+  + F V +     +      +  +A ++++
Sbjct: 130 ESDYAGTPMPTATIEVNAKLISAHNKRLIASRTFIVTQPATNTDTSTVANAFGQALTQLT 189

Query: 193 SEIIDWTLS 201
           +E++ WTL+
Sbjct: 190 NELVGWTLT 198


>gi|28198461|ref|NP_778775.1| hypothetical protein PD0551 [Xylella fastidiosa Temecula1]
 gi|182681134|ref|YP_001829294.1| putative secreted protein [Xylella fastidiosa M23]
 gi|28056545|gb|AAO28424.1| conserved hypothetical protein [Xylella fastidiosa Temecula1]
 gi|182631244|gb|ACB92020.1| putative secreted protein [Xylella fastidiosa M23]
 gi|307579582|gb|ADN63551.1| putative secreted protein [Xylella fastidiosa subsp. fastidiosa
           GB514]
          Length = 213

 Score = 79.0 bits (193), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 51/189 (26%), Positives = 87/189 (46%), Gaps = 5/189 (2%)

Query: 18  LAVLLCTSLSSCFF-HNNPVNIYDLTESTKYDESVQR-HIQLIITEPITEKILNSEDIIV 75
           L+VL   S SS       P  IY        D S  R    L +  P   +++++  I V
Sbjct: 10  LSVLTLASCSSTLLGEKKPTTIYSPQIHVTTDPSWPRVTWHLTVLHPKAPRMIDTPRINV 69

Query: 76  RSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSF 135
           + +P EIQ      W+     M++  LI  FE++GKI+ V +   GI  DY +   +R F
Sbjct: 70  QPTPGEIQVYHNVSWAQPTTDMLEDALIRVFEDSGKIAGVTRAGTGIRTDYSLSLDLRRF 129

Query: 136 E---INIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRIS 192
           E          A I ++ K+I AH+  L+  + F V +     +      +  +A ++++
Sbjct: 130 ESDYAGTPMPTATIEVNAKLIGAHNKRLIASRTFIVTQPATNTDTSTVANAFGQALTQLT 189

Query: 193 SEIIDWTLS 201
           +E++ WTL+
Sbjct: 190 NELVGWTLT 198


>gi|71274910|ref|ZP_00651198.1| conserved hypothetical protein [Xylella fastidiosa Dixon]
 gi|71898798|ref|ZP_00680966.1| conserved hypothetical protein [Xylella fastidiosa Ann-1]
 gi|170729826|ref|YP_001775259.1| hypothetical protein Xfasm12_0625 [Xylella fastidiosa M12]
 gi|71164642|gb|EAO14356.1| conserved hypothetical protein [Xylella fastidiosa Dixon]
 gi|71731384|gb|EAO33447.1| conserved hypothetical protein [Xylella fastidiosa Ann-1]
 gi|167964619|gb|ACA11629.1| conserved hypothetical protein [Xylella fastidiosa M12]
          Length = 213

 Score = 79.0 bits (193), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 51/189 (26%), Positives = 87/189 (46%), Gaps = 5/189 (2%)

Query: 18  LAVLLCTSLSSCFF-HNNPVNIYDLTESTKYDESVQR-HIQLIITEPITEKILNSEDIIV 75
           L+VL   S SS       P  IY        D S  R    L +  P   +++++  I V
Sbjct: 10  LSVLTLASCSSTLLGEKKPTTIYSPQIHVTTDPSWPRVTWHLTVLHPKAPRMIDTPRINV 69

Query: 76  RSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSF 135
           + +P EIQ      W+     M++  LI  FE++GKI+ V +   GI  DY +   +R F
Sbjct: 70  QPTPGEIQVYHNVSWAQPTTDMLEDALIRVFEDSGKIAGVTRAGTGIRTDYSLSLDLRRF 129

Query: 136 E---INIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRIS 192
           E          A I ++ K+I AH+  L+  + F V +     +      +  +A ++++
Sbjct: 130 ESDYAGTPMPTATIEVNAKLIGAHNKRLIASRTFIVTQPATNTDTSTVANAFGQALTQLT 189

Query: 193 SEIIDWTLS 201
           +E++ WTL+
Sbjct: 190 NELVGWTLT 198


>gi|254486952|ref|ZP_05100157.1| conserved hypothetical protein [Roseobacter sp. GAI101]
 gi|214043821|gb|EEB84459.1| conserved hypothetical protein [Roseobacter sp. GAI101]
          Length = 205

 Score = 79.0 bits (193), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 39/181 (21%), Positives = 86/181 (47%), Gaps = 3/181 (1%)

Query: 23  CTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIITEPITEKILNSEDIIVRSSPIEI 82
           C+++S+      P++ +DL  +       +    L++  P     + S+ I+V+  P  I
Sbjct: 22  CSAVSALNSAAIPLDTFDLLPAAGTTTGRRTSHSLLVALPQAPAAIASDRIVVKPDPASI 81

Query: 83  QYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFEINI--- 139
            YL G++WSD+ P ++Q  LI +  + G+I  V +   G   D  ++  + +FE+NI   
Sbjct: 82  TYLPGARWSDEAPVLLQSLLIRSIASTGRIGYVGRSEGGPVPDTALLVRMDAFEVNITPD 141

Query: 140 DRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEIIDWT 199
               A++ ++L ++N  + +++  + F      + D     + +   A + +   + DW 
Sbjct: 142 GTMLAVVDIALTVLNDSNQNVIANRSFSQSAAADSDAPGAVVAAFQAALNGLLPAMADWA 201

Query: 200 L 200
           +
Sbjct: 202 M 202


>gi|304319770|ref|YP_003853413.1| lipoprotein, hypothetical [Parvularcula bermudensis HTCC2503]
 gi|303298673|gb|ADM08272.1| lipoprotein, hypothetical [Parvularcula bermudensis HTCC2503]
          Length = 215

 Score = 78.6 bits (192), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 37/147 (25%), Positives = 85/147 (57%), Gaps = 4/147 (2%)

Query: 57  LIITEPITEKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVV 116
           L+I +P  E +LN+ ++ V+++P + +YL GS+W+D++P + +  L   FEN G ++ V 
Sbjct: 55  LVIADPDAEAVLNTFNVAVKTAPYQFEYLDGSEWTDRVPVLFRTYLERRFENVGALTAVG 114

Query: 117 -KPNQGIYADYQIISAIRSFEIN--IDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLE 173
            + +  + AD+++ + +R+F ++  +    A ++   ++++A   +L G ++      +E
Sbjct: 115 DRSDLPVGADFELKTDLRAFYLDRTVSPEAARLSFGARLVDAQGGTL-GTRIIDRTIPIE 173

Query: 174 KDNKLHFIQSLNRAFSRISSEIIDWTL 200
              +   +++LNR     S ++I W+L
Sbjct: 174 GRGREGAVEALNRVAIDASDDVISWSL 200


>gi|163744192|ref|ZP_02151552.1| hypothetical protein OIHEL45_01375 [Oceanibulbus indolifex HEL-45]
 gi|161381010|gb|EDQ05419.1| hypothetical protein OIHEL45_01375 [Oceanibulbus indolifex HEL-45]
          Length = 206

 Score = 78.2 bits (191), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 44/181 (24%), Positives = 83/181 (45%), Gaps = 3/181 (1%)

Query: 23  CTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIITEPITEKILNSEDIIVRSSPIEI 82
           C++LS+      PV+ YDL  +    +  +   +L+I  P     L S+ I+VRS    I
Sbjct: 23  CSALSALNTAAQPVDTYDLRPAPGSQKGPRSAAKLLIARPEASAALASDRIMVRSDGATI 82

Query: 83  QYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFEINIDRH 142
            YL  ++W D+ P ++Q  L+ +   +G+I  V     G   D  ++  + SFE+ I+  
Sbjct: 83  TYLPDARWVDEAPIVLQGLLVRSIAASGRIGYVGPSEGGPVPDKALLVRMDSFEVTIEPG 142

Query: 143 CAIITM---SLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEIIDWT 199
             ++ M   +L ++N  D  ++G + F    +   D+      +   +   +  +  DW 
Sbjct: 143 GTVLVMVDLALTVLNDSDQRVLGIRNFAQSAQAGNDSPSAIAAAFQASLDVLLPDAADWV 202

Query: 200 L 200
           L
Sbjct: 203 L 203


>gi|299132340|ref|ZP_07025535.1| protein of unknown function DUF330 [Afipia sp. 1NLS2]
 gi|298592477|gb|EFI52677.1| protein of unknown function DUF330 [Afipia sp. 1NLS2]
          Length = 370

 Score = 78.2 bits (191), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 40/169 (23%), Positives = 91/169 (53%), Gaps = 3/169 (1%)

Query: 37  NIYDLTESTKYDESVQRHIQLIITEPITEKILNSEDIIVRSSPIEIQ-YLIGSQWSDKLP 95
           +IYDL     Y       +QL I EP     L+++ +++      +   ++ +QW+D +P
Sbjct: 202 HIYDLEAVQTYVARSPLALQLAIPEPTVILALDTQRLVITPESENLDPSIVQAQWADSIP 261

Query: 96  RMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFEINIDRH-CAIITMSLKIIN 154
           +++Q +LI +F N  +    ++P +G+  D  ++S I+ F++++  +  A +++++KI+ 
Sbjct: 262 KLVQARLIESFANYSEERAPIRPTEGVQVDATLLSEIQRFQVDMTSNPTAEVSLAVKIVG 321

Query: 155 AHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEIIDWTLSSL 203
                +V  ++F   + +   +    + +LN AFS ++ +I+ WT  +L
Sbjct: 322 -KSGKIVASRIFRASQPVAHLDAKTVVSALNWAFSDVTKQIVTWTAGNL 369


>gi|85714926|ref|ZP_01045911.1| ABC transporter substrate-binding protein [Nitrobacter sp. Nb-311A]
 gi|85698123|gb|EAQ35995.1| ABC transporter substrate-binding protein [Nitrobacter sp. Nb-311A]
          Length = 236

 Score = 77.4 bits (189), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 49/168 (29%), Positives = 85/168 (50%), Gaps = 5/168 (2%)

Query: 39  YDLTESTKYDESVQRHIQ--LIITEPITEKILNSEDIIVRSSPIEIQYLIGSQWSDKLPR 96
           YDL  ++ +     R ++  L I EP     L+++  +  S   E      + W+D +P 
Sbjct: 71  YDLRAASGFPNPPDRPLKKSLAIPEPTAVIKLDTQRFLF-SPAKEYPDFAEAMWADSIPN 129

Query: 97  MIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFEINIDRH-CAIITMSLKIINA 155
           ++Q KL+ +FEN       ++   G+ ADYQ++  IR F+I  D    A I +S +I+N 
Sbjct: 130 LLQAKLLESFENYDIAHAPLRSMDGVKADYQLLIDIRRFQITTDPEPVADIGLSARILN- 188

Query: 156 HDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEIIDWTLSSL 203
            +  +V  ++F    KL+K        + N AF RI+ ++I WT+ +L
Sbjct: 189 KNGKVVAARLFQDARKLDKIEPGAASAAFNDAFERIAKDMIAWTVKAL 236


>gi|152984731|ref|YP_001347293.1| putative lipoprotein [Pseudomonas aeruginosa PA7]
 gi|150959889|gb|ABR81914.1| lipoprotein, putative [Pseudomonas aeruginosa PA7]
          Length = 214

 Score = 76.6 bits (187), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 41/198 (20%), Positives = 92/198 (46%), Gaps = 4/198 (2%)

Query: 7   KIIKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHI--QLIITEPIT 64
           + +++  ++  L V       S       + +Y L        +V R +   L I  P T
Sbjct: 6   RPLRRLSLAAGLVVFATLGACSILPEAQVLQVYLLPVHNPPASAVARPVDWSLRIARPRT 65

Query: 65  EKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYA 124
             +L S  I VR    EI    G++WSD  P +++ +L+  F+ +G++  +   +  + A
Sbjct: 66  SLVLESPRIAVRPQGDEISVYQGARWSDPAPALLRDRLMQAFQADGRVRGLSSDDSNLQA 125

Query: 125 DYQIISAIRSFEINI--DRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQ 182
           D+++   +R+F+      +  A+I    +++ + D  ++  + F V + ++       + 
Sbjct: 126 DFELGGDLRAFQTEYPNGQATALIRYDARLVRSDDKRVIASRRFEVRQPVDGRKVPEVVS 185

Query: 183 SLNRAFSRISSEIIDWTL 200
           +  +A   +S++++DWTL
Sbjct: 186 AFGKAADTLSAQVLDWTL 203


>gi|84516865|ref|ZP_01004223.1| hypothetical protein SKA53_06797 [Loktanella vestfoldensis SKA53]
 gi|84509333|gb|EAQ05792.1| hypothetical protein SKA53_06797 [Loktanella vestfoldensis SKA53]
          Length = 189

 Score = 76.3 bits (186), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 41/186 (22%), Positives = 83/186 (44%), Gaps = 3/186 (1%)

Query: 18  LAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIITEPITEKILNSEDIIVRS 77
           +A+  C+++S+       ++ YDL   +      Q    L++  P     ++++ I+VR 
Sbjct: 1   MALGGCSAVSALNAAGTALDTYDLIPPSGGTTGRQTRRTLLVALPDATAAISTDRILVRP 60

Query: 78  SPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFEI 137
               I YL   +W+ +LPR++Q  L+      G+I  V     G   D  +++ + +F++
Sbjct: 61  DAAAITYLPDGRWTSELPRVVQSLLVRAISGTGRIGYVGPAEGGPVPDSALLTRVDAFDV 120

Query: 138 NI--DR-HCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSE 194
            I  DR   A I ++L ++N  D  ++G + F     +  D+    +         +   
Sbjct: 121 TIGADRMPVAAIDITLTVLNDRDQRVIGSRRFSQSVPVAGDSPAAIVAGFQALVDALLPA 180

Query: 195 IIDWTL 200
           + DW L
Sbjct: 181 MADWVL 186


>gi|209885949|ref|YP_002289806.1| putative ABC transporter [Oligotropha carboxidovorans OM5]
 gi|209874145|gb|ACI93941.1| putative ABC transporter [Oligotropha carboxidovorans OM5]
          Length = 371

 Score = 75.9 bits (185), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 43/170 (25%), Positives = 88/170 (51%), Gaps = 4/170 (2%)

Query: 37  NIYDLTESTKYDES-VQRHIQLIITEPITEKILNSEDIIVRSSPIEIQYLIG-SQWSDKL 94
           ++YDL+    Y  +     +QL I EP     L+++ +IV      +   I  +QW+D +
Sbjct: 202 HVYDLSAVQTYAATRTPLTLQLAIPEPTVILALDTQRLIVTPEGDALDASIAQAQWADSI 261

Query: 95  PRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFEINI-DRHCAIITMSLKII 153
           P+++Q +L+ +FEN  +    V+P  G+  D  ++S IR F ++      A I++S+K++
Sbjct: 262 PKLVQARLLESFENYSEEKAPVRPTDGVQTDATLLSEIRRFGVDTSGSPTAEISLSVKLV 321

Query: 154 NAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEIIDWTLSSL 203
            A    +V  ++F   + +   +    + +++RAF+  + +I+ W    L
Sbjct: 322 -AKSGQIVASRIFRSNQPVAHLDAKTAVSAIDRAFTDTAKQIVTWAADKL 370


>gi|115523757|ref|YP_780668.1| hypothetical protein RPE_1739 [Rhodopseudomonas palustris BisA53]
 gi|115517704|gb|ABJ05688.1| Mammalian cell entry related domain protein [Rhodopseudomonas
           palustris BisA53]
          Length = 384

 Score = 75.5 bits (184), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 53/166 (31%), Positives = 89/166 (53%), Gaps = 2/166 (1%)

Query: 38  IYDLTESTKYDESVQRHIQLIITEPITEKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRM 97
           IYDL   T +        QL I EP    +L+++ I+     ++   L G QWSD +P+M
Sbjct: 203 IYDLATPTDFTPGKPIRGQLAIAEPSAVVMLDTQRILTAPG-LDFPQLAGVQWSDSIPKM 261

Query: 98  IQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFEINIDRHCAIITMSLKIINAHD 157
           +Q KLI +FEN       +K N  + AD+Q+   +  FEI  D   A I ++ K+++  D
Sbjct: 262 LQAKLIQSFENYDIAHAPIKANDMVSADHQLAIDLHGFEIAGDPPQAAIALAAKLLD-KD 320

Query: 158 NSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEIIDWTLSSL 203
             ++  K+F V   L+K   L  + + N AFS ++ +++ WT+++L
Sbjct: 321 GKVMTAKLFRVNRPLDKVEPLAALAAFNAAFSELAKDLVGWTVAAL 366


>gi|313108531|ref|ZP_07794532.1| putative ABC-type uncharacterized transport system [Pseudomonas
           aeruginosa 39016]
 gi|310881034|gb|EFQ39628.1| putative ABC-type uncharacterized transport system [Pseudomonas
           aeruginosa 39016]
          Length = 210

 Score = 74.7 bits (182), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 35/146 (23%), Positives = 74/146 (50%), Gaps = 2/146 (1%)

Query: 57  LIITEPITEKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVV 116
           L I  P T  +L S  I VR    EI    G++WSD  P +++ +L+  F+ +G++  + 
Sbjct: 54  LRIARPRTSLVLESPRIAVRPHGDEISVYQGARWSDPAPSLLRDRLMQAFQADGRVRGLS 113

Query: 117 KPNQGIYADYQIISAIRSFEINI--DRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEK 174
             +  + AD+++   +R+F+      +  A+I    +++   D  +V  + F V + ++ 
Sbjct: 114 SDDSNLQADFELGGDLRAFQTEYPNGQASALIRYDARLVRTDDKRVVASRRFEVSQPVDG 173

Query: 175 DNKLHFIQSLNRAFSRISSEIIDWTL 200
                 + +  +A   +S++++DWTL
Sbjct: 174 KKVAAVVSAFGKAGDTLSAQVLDWTL 199


>gi|15598410|ref|NP_251904.1| hypothetical protein PA3214 [Pseudomonas aeruginosa PAO1]
 gi|107102744|ref|ZP_01366662.1| hypothetical protein PaerPA_01003811 [Pseudomonas aeruginosa PACS2]
 gi|116051204|ref|YP_789965.1| putative ABC-type uncharacterized transport system [Pseudomonas
           aeruginosa UCBPP-PA14]
 gi|218890593|ref|YP_002439457.1| putative ABC-type uncharacterized transport system [Pseudomonas
           aeruginosa LESB58]
 gi|254236176|ref|ZP_04929499.1| hypothetical protein PACG_02141 [Pseudomonas aeruginosa C3719]
 gi|254241902|ref|ZP_04935224.1| hypothetical protein PA2G_02623 [Pseudomonas aeruginosa 2192]
 gi|296388299|ref|ZP_06877774.1| putative ABC-type uncharacterized transport system [Pseudomonas
           aeruginosa PAb1]
 gi|9949334|gb|AAG06602.1|AE004744_17 hypothetical protein PA3214 [Pseudomonas aeruginosa PAO1]
 gi|115586425|gb|ABJ12440.1| putative ABC-type uncharacterized transport system [Pseudomonas
           aeruginosa UCBPP-PA14]
 gi|126168107|gb|EAZ53618.1| hypothetical protein PACG_02141 [Pseudomonas aeruginosa C3719]
 gi|126195280|gb|EAZ59343.1| hypothetical protein PA2G_02623 [Pseudomonas aeruginosa 2192]
 gi|218770816|emb|CAW26581.1| putative ABC-type uncharacterized transport system [Pseudomonas
           aeruginosa LESB58]
          Length = 214

 Score = 74.3 bits (181), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 35/146 (23%), Positives = 74/146 (50%), Gaps = 2/146 (1%)

Query: 57  LIITEPITEKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVV 116
           L I  P T  +L S  I VR    EI    G++WSD  P +++ +L+  F+ +G++  + 
Sbjct: 58  LRIARPRTSLVLESPRIAVRPHGDEISVYQGARWSDPAPSLLRDRLMQAFQADGRVRGLS 117

Query: 117 KPNQGIYADYQIISAIRSFEINI--DRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEK 174
             +  + AD+++   +R+F+      +  A+I    +++   D  +V  + F V + ++ 
Sbjct: 118 SDDSNLQADFELGGDLRAFQTEYPNGQASALIRYDARLVRTDDKRVVASRRFEVSQPVDG 177

Query: 175 DNKLHFIQSLNRAFSRISSEIIDWTL 200
                 + +  +A   +S++++DWTL
Sbjct: 178 KKVAAVVSAFGKAGDTLSAQVLDWTL 203


>gi|49079164|gb|AAT49861.1| PA3214 [synthetic construct]
          Length = 215

 Score = 74.3 bits (181), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 35/146 (23%), Positives = 74/146 (50%), Gaps = 2/146 (1%)

Query: 57  LIITEPITEKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVV 116
           L I  P T  +L S  I VR    EI    G++WSD  P +++ +L+  F+ +G++  + 
Sbjct: 58  LRIARPRTSLVLESPRIAVRPHGDEISVYQGARWSDPAPSLLRDRLMQAFQADGRVRGLS 117

Query: 117 KPNQGIYADYQIISAIRSFEINI--DRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEK 174
             +  + AD+++   +R+F+      +  A+I    +++   D  +V  + F V + ++ 
Sbjct: 118 SDDSNLQADFELGGDLRAFQTEYPNGQASALIRYDARLVRTDDKRVVASRRFEVSQPVDG 177

Query: 175 DNKLHFIQSLNRAFSRISSEIIDWTL 200
                 + +  +A   +S++++DWTL
Sbjct: 178 KKVAAVVSAFGKAGDTLSAQVLDWTL 203


>gi|146277756|ref|YP_001167915.1| ABC-type uncharacterized transport system auxiliary component-like
           protein [Rhodobacter sphaeroides ATCC 17025]
 gi|145555997|gb|ABP70610.1| ABC-type uncharacterized transport system auxiliary component-like
           protein [Rhodobacter sphaeroides ATCC 17025]
          Length = 201

 Score = 74.3 bits (181), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 39/198 (19%), Positives = 87/198 (43%), Gaps = 7/198 (3%)

Query: 5   LNKIIKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIITEPIT 64
           +  + +  ++  +L +  C +++S    +  ++ Y L+          RH+   + EP+T
Sbjct: 1   MRALTRSTLLVATLMLAGCGAVTSLSRASEQLDTYTLSPLPGPGGGGARHV---VVEPVT 57

Query: 65  EK-ILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIY 123
               L+++ I+++ S ++ QYL  ++WSD  P ++Q  L+ + +N G    V +   G+ 
Sbjct: 58  AGGALSTDRILIKPSRVQAQYLPDARWSDPAPALVQTLLVGSLQNAGGFRLVAREAAGLI 117

Query: 124 ADYQIISAIRSFEINIDRHCAI---ITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHF 180
            DY +++ +R F+            + M L +I   D S+   +          D     
Sbjct: 118 PDYTLMTELRDFQAEAPPGATPVVRVAMVLTLIRESDRSVASSRRVEAVAPAASDTTGDV 177

Query: 181 IQSLNRAFSRISSEIIDW 198
           + +   A ++   + I W
Sbjct: 178 VVAFEAAVTQALGQAIGW 195


>gi|288962792|ref|YP_003453086.1| hypothetical protein AZL_e01970 [Azospirillum sp. B510]
 gi|288915058|dbj|BAI76542.1| hypothetical protein AZL_e01970 [Azospirillum sp. B510]
          Length = 213

 Score = 73.9 bits (180), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 37/185 (20%), Positives = 84/185 (45%), Gaps = 11/185 (5%)

Query: 23  CTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIITEPITEKILNSEDIIVRSSPIEI 82
           C++L+    H     +Y LT         +   QL++  P     +++  I +  +P  +
Sbjct: 26  CSTLNPTAPH-----LYTLTPRAGVAPGPKADWQLLVETPAAAAGIDTPRIALARTPTSL 80

Query: 83  QYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFEINIDRH 142
            Y     W+D+ P M+Q  ++  FE++G+I +V +   G+ +DY + S +R F+      
Sbjct: 81  DYFADVSWADRAPNMVQGLVVQTFEDSGRIVSVGRDTVGLRSDYVLKSELRDFQAEYSTP 140

Query: 143 CAI------ITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEII 196
            A       + +S K++     S+   + F     +   +    + + + A  +++ +++
Sbjct: 141 GAAMPDRVHVRLSAKLVAMPRRSIEAGETFEASVPVRGRSFTDVVAAFDEALGKVTGDLV 200

Query: 197 DWTLS 201
           +W+LS
Sbjct: 201 NWSLS 205


>gi|114570551|ref|YP_757231.1| hypothetical protein Mmar10_2001 [Maricaulis maris MCS10]
 gi|114341013|gb|ABI66293.1| conserved hypothetical protein [Maricaulis maris MCS10]
          Length = 209

 Score = 73.6 bits (179), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 45/200 (22%), Positives = 92/200 (46%), Gaps = 9/200 (4%)

Query: 6   NKIIKKKIISCS-LAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIITEPIT 64
           ++ ++  ++  S L+V  C SL      + PV++Y L+     +   +    + I  P  
Sbjct: 4   SRYLRAALVGVSALSVSACVSL---LPESEPVSVYRLSSPEPVELQGESWTVIEIDVPNA 60

Query: 65  EKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYA 124
            + L+ + I +      + Y+ G++W    PR++Q  L+ +F  +G     ++ + GI A
Sbjct: 61  PRGLSGDQIAIMQDGSSLAYIQGARWISPTPRLLQSLLVESFNAHGGRLAPIRSDDGIRA 120

Query: 125 DYQIISAIRSFEINIDRHCAI-----ITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLH 179
           DY++   ++ FE   DR   I     + +S++++  H     G +V   E +   +    
Sbjct: 121 DYELRLDMQEFEAVYDRGADIAPLVRVRISVRLVAEHGRRFAGARVVTAEVRASANRTSA 180

Query: 180 FIQSLNRAFSRISSEIIDWT 199
            + + ++A    S EI DWT
Sbjct: 181 IVAAFDQASQTASREIADWT 200


>gi|226942631|ref|YP_002797704.1| hypothetical protein Avin_04750 [Azotobacter vinelandii DJ]
 gi|226717558|gb|ACO76729.1| conserved hypothetical protein [Azotobacter vinelandii DJ]
          Length = 205

 Score = 72.0 bits (175), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 42/186 (22%), Positives = 89/186 (47%), Gaps = 6/186 (3%)

Query: 22  LCTSLSSC--FFHNNPVNIYDLTESTKYDESVQRHIQ--LIITEPITEKILNSEDIIVRS 77
           L  SL++C       P++IY L  +    +     +   L I  P  +++L S  I V  
Sbjct: 11  LLGSLTACSVLPEAEPIHIYRLPGTPLQAQPATARLDQALRIATPKADRMLGSARIAVMP 70

Query: 78  SPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFEI 137
               I    G++WSD  P +++ +LI  F  +G+ ++V   +  +YAD +++  +RSF  
Sbjct: 71  EGNRISNYQGARWSDDAPTLLRDRLIEAFREDGRTASVSSDDNHLYADLELLGDLRSFHS 130

Query: 138 N-IDRHCAI-ITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEI 195
             +D    + + + + ++++    ++  + F V + +        + +   A  R+S ++
Sbjct: 131 EYVDGQPQVRLGLDVSLVHSASQRILASRRFEVRQSVSDGRLDSVVAAFGAASDRLSRQL 190

Query: 196 IDWTLS 201
           +DWTL+
Sbjct: 191 VDWTLA 196


>gi|154252957|ref|YP_001413781.1| ABC transporter auxiliary component-like protein [Parvibaculum
           lavamentivorans DS-1]
 gi|154156907|gb|ABS64124.1| ABC-type uncharacterized transport system auxiliary component-like
           protein [Parvibaculum lavamentivorans DS-1]
          Length = 228

 Score = 71.2 bits (173), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 48/213 (22%), Positives = 86/213 (40%), Gaps = 13/213 (6%)

Query: 1   MDKKLNKIIKKKIISCSLAVLLCTSLSSCFFHN---NPV-NIYDLTESTKY--DESVQRH 54
           M   + K    K+   +  VL+   L +C   +    P  ++Y LT  T      ++  +
Sbjct: 1   MRGAMMKTAIAKLTRLAALVLVLAPLGACALADVASGPAPSLYVLTAPTPALPGTAMAAN 60

Query: 55  IQLIITEPITEKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKIST 114
            QL + E      +++  I+ + SP EI+Y  G++WSD+ PRMI   L+    N G+   
Sbjct: 61  TQLSVREFQAPSAIDTGRIVFQPSPNEIKYYAGARWSDRAPRMIASLLVETLTNTGRFPA 120

Query: 115 VVKPNQGIYADYQIISAIRSFEINIDRHC-------AIITMSLKIINAHDNSLVGQKVFH 167
           ++ P      D  +   IR+F    D            +   ++++ A    ++  + F 
Sbjct: 121 ILGPETQARTDLALTGDIRAFSAFRDGAGLGEGATKVRVAFFVRLVRARGGVVLAGREFT 180

Query: 168 VEEKLEKDNKLHFIQSLNRAFSRISSEIIDWTL 200
            E           + + N A     S+I  WTL
Sbjct: 181 AEAASASGRMDDIVAAYNAALDTALSDITAWTL 213


>gi|218886597|ref|YP_002435918.1| ABC transporter [Desulfovibrio vulgaris str. 'Miyazaki F']
 gi|218757551|gb|ACL08450.1| protein of unknown function DUF330 [Desulfovibrio vulgaris str.
           'Miyazaki F']
          Length = 247

 Score = 69.3 bits (168), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 34/138 (24%), Positives = 69/138 (50%), Gaps = 18/138 (13%)

Query: 54  HIQLIITEPITEKILNSEDIIV---RSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNG 110
           H+QL I+ P T ++L+++ I++     +  E++Y  G++W+   PR++Q  L+  FE  G
Sbjct: 87  HLQLAISLPETSRMLDTDRIVLVLGGENGREVRYYAGAKWTSPAPRLVQRLLVEAFERAG 146

Query: 111 KISTVVKPNQGIYADYQIISAIRSFEINIDRHCAI---ITMSLKIIN------------A 155
           ++    + + GIY DY++++ +R F   +    A    + ++L+++N             
Sbjct: 147 RLDGAAEESAGIYPDYRLMTDLRRFNTRMGEGAAPLVEVELALRLVNLKTGRIVAFTSIG 206

Query: 156 HDNSLVGQKVFHVEEKLE 173
            D    G  +  V E  E
Sbjct: 207 RDCPAAGSALPQVAEAFE 224


>gi|209964742|ref|YP_002297657.1| lipoprotein, putative [Rhodospirillum centenum SW]
 gi|209958208|gb|ACI98844.1| lipoprotein, putative [Rhodospirillum centenum SW]
          Length = 224

 Score = 68.9 bits (167), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 41/194 (21%), Positives = 88/194 (45%), Gaps = 17/194 (8%)

Query: 15  SCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQR-HIQLIITEPITEKILNSEDI 73
            CS+A +L            P  +Y L+ + ++   + R   QL++  P+    +++  I
Sbjct: 22  GCSVADVLTPP---------PPRLYVLSPAREFTAGLPRVDWQLLVETPLANTGIDTARI 72

Query: 74  IVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIR 133
            +  +   + Y  G+ W D+ P M QL LI +FEN+ +I  V +   G+ AD+ + + +R
Sbjct: 73  ALGETQSRLTYFAGANWVDRAPSMAQLLLIESFENSNRIVAVGREATGLRADFILKTDLR 132

Query: 134 SFEINID-------RHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNR 186
            F+   +       R    + M+ K++      +V  + F  +   +       I++++ 
Sbjct: 133 DFQAEYNGGTPGESRPVGRVRMTAKLVRMPRRIIVASESFEAQVPAKGSAFSDMIEAMDD 192

Query: 187 AFSRISSEIIDWTL 200
           A   +   +++WT+
Sbjct: 193 ALEAVMRRMVEWTI 206


>gi|77463399|ref|YP_352903.1| hypothetical protein RSP_2812 [Rhodobacter sphaeroides 2.4.1]
 gi|77387817|gb|ABA79002.1| conserved hypothetical protein [Rhodobacter sphaeroides 2.4.1]
          Length = 201

 Score = 68.6 bits (166), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 38/180 (21%), Positives = 80/180 (44%), Gaps = 5/180 (2%)

Query: 23  CTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIITEPITEKILNSEDIIVRSSPIEI 82
           C ++SS    +  ++ Y L+          RHI  ++        L ++ I+++ S ++ 
Sbjct: 19  CGAVSSLSRASEQLDTYTLSPLPGTGGGGSRHI--VVEAATAGGALATDRILIKPSRVQA 76

Query: 83  QYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFEINIDRH 142
            YL  ++WSD  P ++Q  L+ + +N G    V +   G+  DY +++ +R F+  +   
Sbjct: 77  LYLPDARWSDPAPALVQTLLVGSLQNGGGFRLVAREAAGLVPDYTLMTELREFQAEVPPG 136

Query: 143 CAI---ITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEIIDWT 199
            A    I+M L +I   D S+   +    +     D+    + + + A ++   E + W 
Sbjct: 137 QAPIVRISMVLTLIRESDRSVASTRRIETQAPAASDSTGDVVVAFDTAVTQALGEAVGWA 196


>gi|126462254|ref|YP_001043368.1| hypothetical protein Rsph17029_1486 [Rhodobacter sphaeroides ATCC
           17029]
 gi|126103918|gb|ABN76596.1| conserved hypothetical protein [Rhodobacter sphaeroides ATCC 17029]
          Length = 201

 Score = 68.6 bits (166), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 38/180 (21%), Positives = 80/180 (44%), Gaps = 5/180 (2%)

Query: 23  CTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIITEPITEKILNSEDIIVRSSPIEI 82
           C ++SS    +  ++ Y L+          RHI  ++        L ++ I+++ S ++ 
Sbjct: 19  CGAVSSLSRASEQLDTYTLSPLPGTGGGGSRHI--VVEAATAGGALATDRILIKPSRVQA 76

Query: 83  QYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFEINIDRH 142
            YL  ++WSD  P ++Q  L+ + +N G    V +   G+  DY +++ +R F+  +   
Sbjct: 77  LYLPDARWSDPAPALVQTLLVGSLQNGGGFRLVAREAAGLVPDYTLMTELREFQAEVPPG 136

Query: 143 CAI---ITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEIIDWT 199
            A    I+M L +I   D S+   +    +     D+    + + + A ++   E + W 
Sbjct: 137 QAPVVRISMVLTLIRESDRSVASTRRIETQAPAASDSTGDVVVAFDTAVTQALGEAVGWA 196


>gi|119385045|ref|YP_916101.1| hypothetical protein Pden_2314 [Paracoccus denitrificans PD1222]
 gi|119374812|gb|ABL70405.1| conserved hypothetical protein [Paracoccus denitrificans PD1222]
          Length = 208

 Score = 67.8 bits (164), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 38/171 (22%), Positives = 78/171 (45%), Gaps = 4/171 (2%)

Query: 37  NIYDLTESTKYDESVQRH--IQLIITEPITEKILNSEDIIVRSSPIEIQYLIGSQWSDKL 94
           ++++L   +    S  R    +L+I  P     L+++ I+VR + ++ QYL  ++W D +
Sbjct: 30  DVFELRPPSDVPRSCGRGRLAELVIEPPKARGTLDTDRIMVRPNELQTQYLPDARWGDTV 89

Query: 95  PRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFEINIDRHCAII--TMSLKI 152
           P  +Q  L+  F      + V +   G   DY +IS +  F   +    AII  T+  ++
Sbjct: 90  PVTLQTLLVRGFGVYDAFTHVGRAPLGTAGDYALISEVNDFNAEVAGQGAIIKLTVDAQM 149

Query: 153 INAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEIIDWTLSSL 203
           +   D  +V +  F    +         I + + A  ++ +++ DW L ++
Sbjct: 150 VREMDARVVSRGHFTATAQAPTTKTADLIPAFDAAGQQLVAQMTDWGLRAV 200


>gi|319788028|ref|YP_004147503.1| hypothetical protein Psesu_2440 [Pseudoxanthomonas suwonensis 11-1]
 gi|317466540|gb|ADV28272.1| protein of unknown function DUF330 [Pseudoxanthomonas suwonensis
           11-1]
          Length = 219

 Score = 66.2 bits (160), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 40/149 (26%), Positives = 69/149 (46%), Gaps = 3/149 (2%)

Query: 56  QLIITEPITEKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTV 115
           QL I  P   ++L+S  I VR  P E+Q   G+ W+     M++  ++   E++GKI  V
Sbjct: 59  QLAIARPSAPRLLDSPRIGVRPVPGELQVYKGAVWAQTPADMLEASVLRVLEDSGKIEAV 118

Query: 116 VKPNQGIYADYQIISAIRSFEINI---DRHCAIITMSLKIINAHDNSLVGQKVFHVEEKL 172
            +   G+ A Y++   IR FE +    D   A + +  K+++  D  +V    F      
Sbjct: 119 GRQAAGLRAHYRLTMDIRRFEADYRGGDMPVASLEVVAKLVHNIDQRVVASHSFARTLPA 178

Query: 173 EKDNKLHFIQSLNRAFSRISSEIIDWTLS 201
                     + ++A + +S EI  WTL+
Sbjct: 179 SSTGIASVAAAFDQALAEVSGEIAGWTLA 207


>gi|300114236|ref|YP_003760811.1| hypothetical protein Nwat_1603 [Nitrosococcus watsonii C-113]
 gi|299540173|gb|ADJ28490.1| protein of unknown function DUF330 [Nitrosococcus watsonii C-113]
          Length = 217

 Score = 65.9 bits (159), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 42/202 (20%), Positives = 100/202 (49%), Gaps = 8/202 (3%)

Query: 3   KKLNKIIKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLI--IT 60
           + +++++     S S+ +  CT L S    + P+  + L  S   D S    ++ I  I 
Sbjct: 11  RVISRMMFLAFASLSMTLPACTLLPS----SAPLQTFILPPSKPVDASNAAPLKAILRIA 66

Query: 61  EPITEKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQ 120
            P   +IL    I+V  +  ++    G++WS   P +++  L+  F  NG+++ V+  N 
Sbjct: 67  TPQANEILKGRRILVMPTSNQLNVYQGARWSLDAPSLLRDHLMDVFRRNGRLAGVIGENN 126

Query: 121 GIYADYQIISAIRSF--EINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKL 178
            + +D+ ++S + +F  E    +  A+I + +++I++    L+  + F V  + + +   
Sbjct: 127 PVDSDFLLLSELHAFHSEYRGKKPWAVIRLDVQLIDSTSRDLLASRRFSVPVESQDERLE 186

Query: 179 HFIQSLNRAFSRISSEIIDWTL 200
             +++  +A   +S ++++W+L
Sbjct: 187 SVVEAFGQAVDELSRQLVEWSL 208


>gi|323136831|ref|ZP_08071912.1| protein of unknown function DUF330 [Methylocystis sp. ATCC 49242]
 gi|322398148|gb|EFY00669.1| protein of unknown function DUF330 [Methylocystis sp. ATCC 49242]
          Length = 213

 Score = 65.9 bits (159), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 33/147 (22%), Positives = 70/147 (47%), Gaps = 4/147 (2%)

Query: 57  LIITEPITEKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVV 116
           LI+ EP   +   S+ ++VR     +  L G QWS++LPR+ Q +LI   +  G  +  +
Sbjct: 71  LIVREPAAVQPTGSDRVVVRDVDGSVSVLPGVQWSERLPRLFQNRLIEAMQRAGVPAGQI 130

Query: 117 KPNQGIYADYQIISAIRSFEINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDN 176
                + A   + + IR FEI++ R  A++ +  ++++  + +    ++F  E    +  
Sbjct: 131 S----LGATAALATDIRRFEIDVARSIAVVEIEARLVSESNGATRAAQLFTAEAPAPEHT 186

Query: 177 KLHFIQSLNRAFSRISSEIIDWTLSSL 203
               + +L  A + +++ I  W    +
Sbjct: 187 GAPAVHALGEASATVAARIAVWARGRM 213


>gi|221639254|ref|YP_002525516.1| hypothetical protein RSKD131_1155 [Rhodobacter sphaeroides KD131]
 gi|221160035|gb|ACM01015.1| Hypothetical Protein RSKD131_1155 [Rhodobacter sphaeroides KD131]
          Length = 195

 Score = 65.9 bits (159), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 37/179 (20%), Positives = 79/179 (44%), Gaps = 5/179 (2%)

Query: 23  CTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIITEPITEKILNSEDIIVRSSPIEI 82
           C ++SS    +  ++ Y L+          RHI  ++        L ++ I+V+ S ++ 
Sbjct: 13  CGAVSSLSRASEQLDTYTLSPLPGTGGGGSRHI--VVEAATAGGALATDRILVKPSRVQA 70

Query: 83  QYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFEINIDRH 142
            YL  ++WSD  P ++Q  L+ + +N G    V +   G+  DY +++ +R F+  +   
Sbjct: 71  LYLPDARWSDPAPALLQTLLVGSLQNGGGFRLVAREAAGLVPDYTLMTELRDFQAEVPPG 130

Query: 143 CAI---ITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEIIDW 198
                 ++M L +I   D S+   +    +     D+    + + + A ++   E + W
Sbjct: 131 QTPTVHVSMVLTLIRESDRSVASTRRIEAQAPAASDSTGDVVVAFDTAVTQALGEAVAW 189


>gi|238791987|ref|ZP_04635623.1| hypothetical protein yinte0001_8870 [Yersinia intermedia ATCC
           29909]
 gi|238728618|gb|EEQ20136.1| hypothetical protein yinte0001_8870 [Yersinia intermedia ATCC
           29909]
          Length = 207

 Score = 65.5 bits (158), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 32/150 (21%), Positives = 77/150 (51%), Gaps = 2/150 (1%)

Query: 57  LIITEPITEKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVV 116
           L +++P T + LNS  I V+    EI     S+WSD  P +++ +LI  F ++G+I  V 
Sbjct: 55  LRVSQPATNQFLNSSRIAVQPQGQEIAVYKNSRWSDSAPILVRNRLIQAFRSDGRIRAVS 114

Query: 117 KPNQGIYADYQIISAIRSFE--INIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEK 174
             +  + AD ++   + +F+   ++     +I    +++   D  ++  + F + + ++ 
Sbjct: 115 SDDDSLQADVELSGDLSAFQGVYHVGSSEVLIRFDARLVRISDRRIIATRQFEIRQPIKG 174

Query: 175 DNKLHFIQSLNRAFSRISSEIIDWTLSSLP 204
           +     +Q+   A  ++++++++WT+   P
Sbjct: 175 NEMNEVVQAFGLASDQLATQVLNWTMQQSP 204


>gi|300917990|ref|ZP_07134616.1| lipofamily protein [Escherichia coli MS 115-1]
 gi|300414816|gb|EFJ98126.1| lipofamily protein [Escherichia coli MS 115-1]
          Length = 213

 Score = 65.1 bits (157), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 32/150 (21%), Positives = 77/150 (51%), Gaps = 2/150 (1%)

Query: 57  LIITEPITEKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVV 116
           L +++P T + LNS  I V+    EI     S+WSD  P +++ +LI  F ++G+I  V 
Sbjct: 61  LRVSQPATNQFLNSSRIAVQPQGQEIAVYKNSRWSDSAPILVRNRLIQAFRSDGRIRAVS 120

Query: 117 KPNQGIYADYQIISAIRSFE--INIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEK 174
             +  + AD ++   + +F+   ++     +I    +++   D  ++  + F + + ++ 
Sbjct: 121 SDDDSLQADVELSGDLSAFQGVYHVGSSEVLIRFDARLVRISDRRIIATRQFDIRQPIKG 180

Query: 175 DNKLHFIQSLNRAFSRISSEIIDWTLSSLP 204
           +     +Q+   A  ++++++++WT+   P
Sbjct: 181 NEMNEVVQAFGLASDQLATQVLNWTMQQSP 210


>gi|237808110|ref|YP_002892550.1| hypothetical protein Tola_1349 [Tolumonas auensis DSM 9187]
 gi|237500371|gb|ACQ92964.1| protein of unknown function DUF330 [Tolumonas auensis DSM 9187]
          Length = 207

 Score = 65.1 bits (157), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 42/179 (23%), Positives = 85/179 (47%), Gaps = 3/179 (1%)

Query: 25  SLSSCFFHNNPVNIYDLTESTKYD-ESVQRHIQLIITEPITEKILNSEDIIVRSSPIEIQ 83
           S  S F    PVN+Y L EST    +S      L I  P   + L+S  I V     +I 
Sbjct: 18  SACSLFPETRPVNVYMLPESTPVQTQSSSVDWSLRINTPYANQTLDSTRIAVIPDGNQIN 77

Query: 84  YLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFEINI--DR 141
               ++W+D++P +++ +LI  F ++G+I T+   N  I  D ++IS +R+F+      +
Sbjct: 78  SYKSARWNDRVPVLLRERLIDTFRSDGRIKTITNDNGLINTDAELISELRAFQSEYIHGK 137

Query: 142 HCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEIIDWTL 200
               + +   ++  ++  ++    F   +  +  +    +Q+  +A  ++S E++ W +
Sbjct: 138 PEVRVQLDTHLVQRNNQQVLASYRFEARQASKDASVASVVQAFGQATDQLSREVVAWAI 196


>gi|217969578|ref|YP_002354812.1| hypothetical protein Tmz1t_1157 [Thauera sp. MZ1T]
 gi|217506905|gb|ACK53916.1| protein of unknown function DUF330 [Thauera sp. MZ1T]
          Length = 247

 Score = 65.1 bits (157), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 30/146 (20%), Positives = 70/146 (47%), Gaps = 2/146 (1%)

Query: 57  LIITEPITEKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVV 116
           L +  P     L  + I+V      +    G+ WSD  P +++ +L+  F  +G++  + 
Sbjct: 95  LRVVRPAAGVHLAGQRIVVMPEGNRVSVYQGAGWSDPAPALLRDRLLEAFRADGRVGALS 154

Query: 117 KPNQGIYADYQIISAIRSF--EINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEK 174
              + ++AD+++ S +R+F  E    R  A++ +  ++++     +V  + F   +    
Sbjct: 155 SDERQLHADFELDSDLRAFQSEYRGGRPEAVLRLDARLVHTASRRIVASRTFEQRQPTAD 214

Query: 175 DNKLHFIQSLNRAFSRISSEIIDWTL 200
                 +Q+   A  R+S+E+++WT+
Sbjct: 215 PAVPAVVQAFGAAADRLSAEVVEWTV 240


>gi|149374949|ref|ZP_01892722.1| putative ABC-type uncharacterized transport system [Marinobacter
           algicola DG893]
 gi|149360838|gb|EDM49289.1| putative ABC-type uncharacterized transport system [Marinobacter
           algicola DG893]
          Length = 203

 Score = 65.1 bits (157), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 45/195 (23%), Positives = 91/195 (46%), Gaps = 9/195 (4%)

Query: 18  LAVLLCTSLSSC-FFHNNPVN-IYDLTESTKYDESVQRH----IQLIITEPITEKILNSE 71
           L V + T LS+C  F + P N ++ L  ST  + S+  +      L    P+ E  ++S 
Sbjct: 10  LCVTVATMLSACTLFPDRPANRLFQLPAST-VETSITGNKPFSTTLRFVTPLAEGPVDSS 68

Query: 72  DIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISA 131
            I+V+    EI+   G++WS+K P +++ +LI  F  +G+ + ++       +D  +   
Sbjct: 69  RILVKPEGNEIKAYQGARWSNKSPILVRDQLIDAFRRDGRFAGIITGTSPARSDLTMAGE 128

Query: 132 IRSF--EINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFS 189
           + +F  E       A+I + L +I+    + +  K F  +     +     +++   A +
Sbjct: 129 LSAFQSEYQDGMPVALIRLDLHLIDERTRNTLANKRFEYQHPATGEQVEAIVEAFGEASN 188

Query: 190 RISSEIIDWTLSSLP 204
            ++ E+I WT+   P
Sbjct: 189 ALAREVIHWTVEQRP 203


>gi|146342152|ref|YP_001207200.1| ABC transporter substrate-binding protein [Bradyrhizobium sp.
           ORS278]
 gi|146194958|emb|CAL78983.1| Putative ABC transporter (substrate binding protein)
           [Bradyrhizobium sp. ORS278]
          Length = 366

 Score = 64.7 bits (156), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 44/169 (26%), Positives = 84/169 (49%), Gaps = 8/169 (4%)

Query: 39  YDLTESTKYDESVQRHI--QLIITEPITEKILNSEDIIVRSSPIEIQYLIGS-QWSDKLP 95
           YDLT        V + I  QL I EP    +L ++ ++   SP +     G   W+D +P
Sbjct: 202 YDLTAPRDLGP-VNKTIKGQLAIPEPTAVAMLQTQRMLF--SPAKDYPGFGDVLWADSIP 258

Query: 96  RMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFEINIDRHC-AIITMSLKIIN 154
           +++Q +LI  FEN       ++ +     D Q++  +R F IN+D    A I +S ++++
Sbjct: 259 KLLQARLIDTFENYDVAHAPLRASDLGQPDVQLLIDVRRFRINVDATAVADIGLSARLVD 318

Query: 155 AHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEIIDWTLSSL 203
                ++  ++F   + + + N    + + ++AF R++  I+ WT+ SL
Sbjct: 319 -KSGKIIASRLFDESQPVGQINPADAVAAFDQAFGRLAKSILAWTVQSL 366


>gi|312958195|ref|ZP_07772718.1| lipoprotein [Pseudomonas fluorescens WH6]
 gi|311287626|gb|EFQ66184.1| lipoprotein [Pseudomonas fluorescens WH6]
          Length = 203

 Score = 64.7 bits (156), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 36/184 (19%), Positives = 85/184 (46%), Gaps = 4/184 (2%)

Query: 20  VLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIITEPITEKILNSEDIIVRSSP 79
            L   S  S     +P ++Y L  +    +       L +T+P T + L+S  I V  + 
Sbjct: 12  ALALISACSILPKADPSDVYRLAATQTATQGAPVSWSLRVTKPQTSEFLDSPRIAVVPNG 71

Query: 80  IEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFEINI 139
             I     S+WSD  P +++ +L+  F+ +G+++ +      + ADY++   +++F+   
Sbjct: 72  DLISSYANSRWSDPAPVLLRNRLLDGFQRDGRVTLLSTDETNLQADYELGGQLQAFQSEY 131

Query: 140 DRHCA---IITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEII 196
            R  A   +I +  +++   D  ++  + F V + +        + +  +A  +++ +++
Sbjct: 132 -RGSAVEVVIRLDARLVRGSDQRIMASRRFEVRQPVADTKVPAVVAAFGQAGDQLNKQVV 190

Query: 197 DWTL 200
           DW +
Sbjct: 191 DWVV 194


>gi|123441587|ref|YP_001005573.1| hypothetical protein YE1250 [Yersinia enterocolitica subsp.
           enterocolitica 8081]
 gi|122088548|emb|CAL11342.1| putative exported protein [Yersinia enterocolitica subsp.
           enterocolitica 8081]
          Length = 211

 Score = 64.3 bits (155), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 34/150 (22%), Positives = 75/150 (50%), Gaps = 2/150 (1%)

Query: 57  LIITEPITEKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVV 116
           L +++P T + +NS  I V+    EI     S+W+D  P +++ +LI  F  NG+I  V 
Sbjct: 61  LRVSQPATNQFINSSRIAVQPEGQEIAVYKNSRWTDPAPILVRNRLIQEFRANGRIPAVS 120

Query: 117 KPNQGIYADYQIISAIRSFE--INIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEK 174
             +  + AD ++   + +F+   + D    +I    +++   D  ++  + F V + ++ 
Sbjct: 121 SDDDSLQADVELSGDLSAFQGVYHADSSEVLIRFDARLVRISDRRIMATRHFEVRQPIKG 180

Query: 175 DNKLHFIQSLNRAFSRISSEIIDWTLSSLP 204
                 + +   A ++++S++++WTL   P
Sbjct: 181 AQMNEVVDAFGLASNQLASQVLNWTLQQSP 210


>gi|70733609|ref|YP_257249.1| putative lipoprotein [Pseudomonas fluorescens Pf-5]
 gi|68347908|gb|AAY95514.1| lipoprotein, putative [Pseudomonas fluorescens Pf-5]
          Length = 209

 Score = 63.9 bits (154), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 40/205 (19%), Positives = 94/205 (45%), Gaps = 11/205 (5%)

Query: 3   KKLNKIIKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDL----TESTKYDESVQRHIQLI 58
           K+  +++    +S +LA+   T   S      P++IY L      +T  ++++   +QL+
Sbjct: 2   KRAYRLLAPLGLSAALAL---TGACSILPKGEPLDIYRLPVSQAGATAPNQALPWSLQLL 58

Query: 59  ITEPITEKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKP 118
             +P     LNS  I V      I     S+WSD  P +++ +L+  F+ +G++  +   
Sbjct: 59  --KPQAGDALNSARIAVIPQGNLISSYKASRWSDPAPILLRNRLLDGFQRDGRVQLLSTD 116

Query: 119 NQGIYADYQIISAIRSFEINIDRHCA--IITMSLKIINAHDNSLVGQKVFHVEEKLEKDN 176
           +  +  D  +   +++F+     + A  +I +  ++I  +D  ++  + F V + L +  
Sbjct: 117 DSNLQTDLALGGDLQAFQTEYQGNAAQVVIRLDARLIRGYDQKILASRRFEVRQALAETG 176

Query: 177 KLHFIQSLNRAFSRISSEIIDWTLS 201
               +    +A   ++ +++DW + 
Sbjct: 177 VPAVVTGFGQAGDALTRQVVDWAVG 201


>gi|104779405|ref|YP_605903.1| lipoprotein [Pseudomonas entomophila L48]
 gi|95108392|emb|CAK13086.1| putative lipoprotein [Pseudomonas entomophila L48]
          Length = 204

 Score = 63.9 bits (154), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 35/179 (19%), Positives = 79/179 (44%), Gaps = 3/179 (1%)

Query: 28  SCFFHNNPVNIYDLTESTKYDESVQRHIQLIITEPITEKILNSEDIIVRSSPIEIQYLIG 87
           S      PV+IY L        +      L + +P+  + L    I V      I    G
Sbjct: 21  SILPQGEPVDIYRLPVGQTARGASPLDWSLRLNKPLASEALAGPRIAVIPQGDVISSYKG 80

Query: 88  SQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFEINIDRHCA--- 144
           ++WSD +P +++ +L+  F+ +G++  +   +  + ADY++   +++F+       +   
Sbjct: 81  ARWSDPVPMLVRNRLLDGFQRDGRVQRLSADDSNLQADYELGGELQAFQAEYRPGGSVEV 140

Query: 145 IITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEIIDWTLSSL 203
           +I    +++      ++  K F V + L +      +     A  +++ ++IDWT+S +
Sbjct: 141 VIRYDARLVQGRSQRILASKRFEVRQPLGQLQVPAVVAGFGTASDQLARQVIDWTVSQV 199


>gi|229587672|ref|YP_002869791.1| putative lipoprotein [Pseudomonas fluorescens SBW25]
 gi|229359538|emb|CAY46379.1| putative lipoprotein [Pseudomonas fluorescens SBW25]
          Length = 203

 Score = 63.5 bits (153), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 35/184 (19%), Positives = 84/184 (45%), Gaps = 4/184 (2%)

Query: 20  VLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIITEPITEKILNSEDIIVRSSP 79
            L   S  S     +P ++Y LT +    +       L + +P T + L+S  I V  + 
Sbjct: 12  ALALVSACSILPKADPSDVYRLTSAQTTSQGAPVSWSLRVNKPQTSEFLDSPRIAVVPNG 71

Query: 80  IEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFEINI 139
             I     S+WSD  P +++ + +  F+ +G+++ +   +  + +DY++   +++F+   
Sbjct: 72  DLISSYANSRWSDPSPVLLRNRFMDGFQRDGRVTLLSTDDTNLQSDYELGGQLQAFQSEY 131

Query: 140 DRHCA---IITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEII 196
            R  A   +I +  +++   D  +V  + F V + +        +    +A  +++ +++
Sbjct: 132 -RGSAVEVVIRLDARLVRGSDQRIVASRRFEVRQPVSDTKVPAVVAGFGQAGDQLNKQVV 190

Query: 197 DWTL 200
           DW +
Sbjct: 191 DWVV 194


>gi|302039180|ref|YP_003799502.1| putative ABC transporter auxiliary component [Candidatus Nitrospira
           defluvii]
 gi|300607244|emb|CBK43577.1| putative ABC-type transport system, auxiliary component [Candidatus
           Nitrospira defluvii]
          Length = 215

 Score = 63.2 bits (152), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 48/211 (22%), Positives = 88/211 (41%), Gaps = 19/211 (9%)

Query: 8   IIKKKIISCSLAVLLCTSLSSCFF---HNNPVNIYDLTESTKYDESVQR----------H 54
           ++ ++ I    AV++  +L++C       NPV+ + LT     DES  R          H
Sbjct: 1   MVSRRAIPWVGAVMMSCALAACVLPRSAENPVHTFLLT----IDESAWRAGARAGQPEVH 56

Query: 55  IQLIITEPITEKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKIST 114
             L++  P  E       +     P E+ Y   + W D   RM+   L+ + E  G    
Sbjct: 57  GVLVVGLPQAEAGFEQPRMAYLQRPYEVSYYATNVWVDAPARMLAPLLVRSLEATGLWRV 116

Query: 115 VVKPNQGIYADYQIISAIRSFEINIDRHCAIITMSLK--IINAHDNSLVGQKVFHVEEKL 172
           VV     +  DY++ ++    +    +  +   + L+  ++   D  ++G + F V E  
Sbjct: 117 VVSMPTVVRGDYRLDTSGLVLQQEFLQQPSRTRLHLRAQLLEMKDQRVLGVRSFEVLEPA 176

Query: 173 EKDNKLHFIQSLNRAFSRISSEIIDWTLSSL 203
             D+    +Q+ NRA +R+   + DW  S L
Sbjct: 177 SSDDAYGGVQAANRAVTRVLEALNDWIASCL 207


>gi|238789960|ref|ZP_04633739.1| hypothetical protein yfred0001_37270 [Yersinia frederiksenii ATCC
           33641]
 gi|238721908|gb|EEQ13569.1| hypothetical protein yfred0001_37270 [Yersinia frederiksenii ATCC
           33641]
          Length = 205

 Score = 63.2 bits (152), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 41/199 (20%), Positives = 96/199 (48%), Gaps = 9/199 (4%)

Query: 12  KIISCSLAVLLCTSLSSC-FFHNNPV-NIY--DLTESTKYDESVQRHIQLIITEPITEKI 67
           ++++ S+ V+L   LS+C      PV  +Y   +  +T    +   +  L +++P T + 
Sbjct: 9   RLLTASMLVML---LSACTILPTAPVAQVYLLPVPPATNTPRTQTVNWSLRVSQPATNQF 65

Query: 68  LNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQ 127
           +NS  I V+    EI     S+W+D  P +++ +LI  F  +G+IS V   +  + AD +
Sbjct: 66  INSSRIAVQPEGQEIAVYKNSRWTDPAPILLRNRLIHEFRTDGRISAVSSDDDSLQADVE 125

Query: 128 IISAIRSFE--INIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLN 185
           +   + +F+          +I    +++   D  ++  + F + + ++       + +  
Sbjct: 126 LSGDLSAFQGVYQAGNSEVLIRFDARLVRISDRRIIATRHFEIRQPIKGSQMNEVVDAFG 185

Query: 186 RAFSRISSEIIDWTLSSLP 204
            A +++++++++WTL   P
Sbjct: 186 LASNQLATQVLNWTLQQSP 204


>gi|148545414|ref|YP_001265516.1| ABC transporter auxiliary component-like protein [Pseudomonas
           putida F1]
 gi|148509472|gb|ABQ76332.1| ABC-type uncharacterized transport system auxiliary component-like
           protein [Pseudomonas putida F1]
          Length = 211

 Score = 62.8 bits (151), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 34/180 (18%), Positives = 80/180 (44%), Gaps = 3/180 (1%)

Query: 25  SLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIITEPITEKILNSEDIIVRSSPIEIQY 84
           S  S    + PV++Y L  +     +      L + +P+  ++L    I V      I  
Sbjct: 18  SACSILPKSEPVDLYRLPVNQPSRTAPPLEWSLRLNKPLASEVLAGPRIAVIPQGDVISS 77

Query: 85  LIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFEINIDRHCA 144
             G++WSD  P +++ +L+  F+ +G++  +   +  + ADY++   +++F+       A
Sbjct: 78  YKGARWSDAAPVLLRNRLLDGFQRDGQVQRLSADDSNLQADYELAGELQAFQSEYRPGGA 137

Query: 145 ---IITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEIIDWTLS 201
              +I    +++N  D  +   K F + + L        +    +A  ++  +++ WT++
Sbjct: 138 VEVVIRYDARLVNGRDQRIQASKRFEIRQPLADKQVSAVVAGFGQASDQLVGQVVSWTIA 197


>gi|238754550|ref|ZP_04615904.1| hypothetical protein yruck0001_4180 [Yersinia ruckeri ATCC 29473]
 gi|238707181|gb|EEP99544.1| hypothetical protein yruck0001_4180 [Yersinia ruckeri ATCC 29473]
          Length = 145

 Score = 62.4 bits (150), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 31/144 (21%), Positives = 69/144 (47%), Gaps = 2/144 (1%)

Query: 63  ITEKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGI 122
           +  + +NS  I V+    EI     S+WSD  P +++ +LI  F  +G++  V   +  +
Sbjct: 1   MANQFINSTRIAVQPQGQEIAVYKASRWSDATPILVRNRLIQEFRADGRVRAVSSDDDSL 60

Query: 123 YADYQIISAIRSFE--INIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHF 180
            AD ++   + +F+   N D     I    +++   D  ++  + F + + ++  +    
Sbjct: 61  QADVELSGDLSAFQGVYNSDGSIVRIRFDARLVRVSDRRIIATRQFDIHQPIKGTDMNDV 120

Query: 181 IQSLNRAFSRISSEIIDWTLSSLP 204
           +Q+   A  R++++++ WTL   P
Sbjct: 121 VQAFGAAGDRLAAQVLKWTLQQAP 144


>gi|238784665|ref|ZP_04628670.1| hypothetical protein yberc0001_28090 [Yersinia bercovieri ATCC
           43970]
 gi|238714437|gb|EEQ06444.1| hypothetical protein yberc0001_28090 [Yersinia bercovieri ATCC
           43970]
          Length = 207

 Score = 62.4 bits (150), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 32/146 (21%), Positives = 73/146 (50%), Gaps = 2/146 (1%)

Query: 57  LIITEPITEKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVV 116
           L +++P T + LNS  I V+    EI     S+WSD  P +++ +LI  F  +G+I  V 
Sbjct: 55  LRVSQPATSQFLNSSRIAVQPQGQEIAVYQNSRWSDPAPILVRNRLIQEFRADGRIRAVS 114

Query: 117 KPNQGIYADYQIISAIRSFE--INIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEK 174
             +  + AD ++   + +F+     D+   +I    +++   D  ++  + F + + ++ 
Sbjct: 115 SDDDSLQADVELSGDLSAFQGVYLTDKSEVLIRFDARLVRISDRRIIATRHFEIRQPIKG 174

Query: 175 DNKLHFIQSLNRAFSRISSEIIDWTL 200
                 +Q+   A  ++++++++W L
Sbjct: 175 TEMNEVVQAFGLASDQLATQVLNWML 200


>gi|238796787|ref|ZP_04640292.1| hypothetical protein ymoll0001_25890 [Yersinia mollaretii ATCC
           43969]
 gi|238719275|gb|EEQ11086.1| hypothetical protein ymoll0001_25890 [Yersinia mollaretii ATCC
           43969]
          Length = 207

 Score = 62.0 bits (149), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 36/153 (23%), Positives = 75/153 (49%), Gaps = 3/153 (1%)

Query: 57  LIITEPITEKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVV 116
           L +++P T + LNS  I V+    EI     S+WSD  P +++ +LI  F  +G+I  V 
Sbjct: 55  LRVSQPTTSQFLNSSRIAVQPQGQEIAVYQNSRWSDPAPILLRNRLIQEFRADGRIRAVS 114

Query: 117 KPNQGIYADYQIISAIRSFE--INIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEK 174
             +  + AD ++   + +F+     D+   +I    +++   D  ++    F + + +  
Sbjct: 115 SDDDSLQADVELSGDLSAFQGVYLTDKSEVLIRFDARLVRISDRRIIATHHFEIRQPISG 174

Query: 175 DNKLHFIQSLNRAFSRISSEIIDWTL-SSLPLS 206
                 +Q+   A  ++++++++W L  SLP S
Sbjct: 175 TKMDEVVQAFGLASDQLAAQVLNWMLQQSLPSS 207


>gi|325273985|ref|ZP_08140144.1| ABC transporter auxiliary component-like protein [Pseudomonas sp.
           TJI-51]
 gi|324100874|gb|EGB98561.1| ABC transporter auxiliary component-like protein [Pseudomonas sp.
           TJI-51]
          Length = 205

 Score = 61.2 bits (147), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 38/197 (19%), Positives = 88/197 (44%), Gaps = 4/197 (2%)

Query: 9   IKKKIISCSLAVLLC-TSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIITEPITEKI 67
           +K  +   +LAV +  TS  S    + PV++Y L  +     +      L + +P+  ++
Sbjct: 1   MKSSLRLVALAVTIGLTSACSILPTSEPVDLYRLPVNQVSRSAPPLDWSLRLNKPLASEV 60

Query: 68  LNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQ 127
           L    I V      +    G++WSD  P +++ +L+  F+ +G++  +   +  + ADY+
Sbjct: 61  LAGPRIAVIPQGNVVSSYKGARWSDPAPMLLRNRLLDGFQRDGQVQRLSADDSNLQADYE 120

Query: 128 IISAIRSF--EINIDRHC-AIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSL 184
           +   +++F  E   D     +I    +++      ++  K F V + L        +   
Sbjct: 121 LAGELQAFQSEYRADGTVEVVIRYDARLVQGRTQRILASKRFEVRQPLADKQVAGVVAGF 180

Query: 185 NRAFSRISSEIIDWTLS 201
            +A   ++ +++DW ++
Sbjct: 181 GQACDLLTGQVVDWAIA 197


>gi|330806716|ref|YP_004351178.1| Putative lipoprotein [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
 gi|327374824|gb|AEA66174.1| Putative lipoprotein [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
          Length = 211

 Score = 61.2 bits (147), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 42/202 (20%), Positives = 86/202 (42%), Gaps = 8/202 (3%)

Query: 3   KKLNKIIKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQ--LIIT 60
           K  N+ I+  ++   LA  +     S      P ++Y L   T+   S    +   L + 
Sbjct: 2   KPSNRFIRPLLL---LAGFVLVGGCSILPKAEPSDVYRL-PVTQAPASAGAAVSWSLRLA 57

Query: 61  EPITEKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQ 120
            P   ++LNS  I V            S+WSD  P +++ +L+  F  +G++  +   + 
Sbjct: 58  NPQASEVLNSPKIAVIPQGNLFSSYAASRWSDPAPVLLRNRLLDGFAQDGRVRLLSVADS 117

Query: 121 GIYADYQIISAIRSFEINIDRHCA--IITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKL 178
            + AD ++   +++F+       A  +I +   ++   D  ++  + F V + L      
Sbjct: 118 NLQADLELGGQLQAFQTEYQGTAASVVIRLDALLVRGFDQRILASRRFEVRQPLSDVKVP 177

Query: 179 HFIQSLNRAFSRISSEIIDWTL 200
             +    RA  R+++E++ WTL
Sbjct: 178 AVVDGFGRAGDRLTAEVVAWTL 199


>gi|119897562|ref|YP_932775.1| hypothetical protein azo1271 [Azoarcus sp. BH72]
 gi|119669975|emb|CAL93888.1| conserved hypothetical secreted protein [Azoarcus sp. BH72]
          Length = 214

 Score = 61.2 bits (147), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 37/170 (21%), Positives = 81/170 (47%), Gaps = 3/170 (1%)

Query: 34  NPVNIYDLTES-TKYDESVQRHIQLIITEPITEKILNSEDIIVRSSPIEIQYLIGSQWSD 92
            PV++Y L  + T    S    + L + +P T   L  + I+V      +    G+ WSD
Sbjct: 36  EPVDVYLLPATRTPPAASPALALALRVAKPETSLHLAGQRIVVLPEGDRVSVYKGASWSD 95

Query: 93  KLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSF--EINIDRHCAIITMSL 150
             P +++ +L+  F  +G+I+ +   ++ ++AD ++ S +R+F  E    R  A++ +  
Sbjct: 96  PAPLLVRNRLLDAFHGDGRIAALSSDDRSLHADLELDSDLRAFHSEYRDGRPEAVVRLDA 155

Query: 151 KIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEIIDWTL 200
           +++      ++  + F V       +    +++   A   +S+E++ WTL
Sbjct: 156 RLVAPASLRILASRRFEVRHPAASADVKDVVRAFGAAADALSAEVVAWTL 205


>gi|148257021|ref|YP_001241606.1| ABC transporter substrate-binding protein [Bradyrhizobium sp.
           BTAi1]
 gi|146409194|gb|ABQ37700.1| Putative ABC transporter (substrate binding protein)
           [Bradyrhizobium sp. BTAi1]
          Length = 367

 Score = 60.5 bits (145), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 35/150 (23%), Positives = 77/150 (51%), Gaps = 5/150 (3%)

Query: 56  QLIITEPITEKILNSEDIIVRSSPIEIQYLIG-SQWSDKLPRMIQLKLIANFENNGKIST 114
           QL I EP    +L ++ I+   SP +     G + W+D +P+++Q +LI  FEN      
Sbjct: 221 QLAIPEPTAVAMLQTQRILF--SPAKDYPGFGDALWADSIPKLLQARLIDAFENYDIAHA 278

Query: 115 VVKPNQGIYADYQIISAIRSFEINIDRHCAI-ITMSLKIINAHDNSLVGQKVFHVEEKLE 173
            ++       D Q++  +R F IN D    + I +S ++++     ++  ++F   + ++
Sbjct: 279 PLRTADLGQPDVQLLVDVRRFRINTDPTAVVEIGLSARLVD-KSGKIIASRLFDESQPVD 337

Query: 174 KDNKLHFIQSLNRAFSRISSEIIDWTLSSL 203
           + +    + + ++AF R++  ++ WT+ +L
Sbjct: 338 RLDPAIAVTAFDQAFGRVAKSLLTWTVQAL 367


>gi|206575545|ref|YP_002235752.1| hypothetical protein KPK_A0104 [Klebsiella pneumoniae 342]
 gi|206570389|gb|ACI12035.1| conserved hypothetical protein [Klebsiella pneumoniae 342]
          Length = 214

 Score = 60.1 bits (144), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 39/188 (20%), Positives = 88/188 (46%), Gaps = 9/188 (4%)

Query: 18  LAVLLCTSLSSC-FFHNNPVN-IYDLTESTKYDES---VQRHIQLIITEPITEKILNSED 72
           L VL+C  L++C      PV+ ++ L        S   + R ++++  +P T + +NS  
Sbjct: 19  LIVLVCLPLAACTVLPQRPVSQVWLLPAQPGVPASGPTINRSLRVM--QPSTSQFINSSR 76

Query: 73  IIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAI 132
           I V+    EI    GS+WSD +P + + +L      +G+  +V      + AD+++   +
Sbjct: 77  IAVQPQGAEITVYSGSRWSDSVPVLFRNRLTQELRTDGRFISVSSDEDNLQADFELGGDL 136

Query: 133 RSFE--INIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSR 190
            SF+      +   +I    +++   D  ++  + F + + +   +    +++   A  R
Sbjct: 137 SSFQGVYRGKKGEVLIQFDARLVQTSDRRVIASQRFVIHQPISGSSMNEVVEAFGLASDR 196

Query: 191 ISSEIIDW 198
           ++++I+ W
Sbjct: 197 LAADILRW 204


>gi|332162487|ref|YP_004299064.1| hypothetical protein YE105_C2865 [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|318606567|emb|CBY28065.1| membrane lipoprotein lipid attachment site containing protein
           USSDB6D [Yersinia enterocolitica subsp. palearctica Y11]
 gi|325666717|gb|ADZ43361.1| hypothetical protein YE105_C2865 [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|330861185|emb|CBX71442.1| hypothetical protein YEW_CA08670 [Yersinia enterocolitica W22703]
          Length = 211

 Score = 59.7 bits (143), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 40/193 (20%), Positives = 87/193 (45%), Gaps = 6/193 (3%)

Query: 16  CSLAVLL--CTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIITEPITEKILNSEDI 73
             LA+LL  CT L S       V +  +  +     +   +  L +++P T + +NS  I
Sbjct: 20  SGLAMLLSACTILPSAPVSQ--VYLLPVPPAANAPRAQAVNWSLRVSQPATNQFINSSRI 77

Query: 74  IVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIR 133
            V+    EI     S+W+D  P +++ +LI  F  +G+I  V   +  + AD ++   + 
Sbjct: 78  AVQPEGQEIAVYKNSRWTDPAPILVRNRLIQEFRTDGRIPAVSSDDDSLQADVELSGDLS 137

Query: 134 SFE--INIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRI 191
           +F+          +I    +++   D  ++  + F V + ++       + +   A +++
Sbjct: 138 AFQGVYQAGNSEVLIRFDARLVRISDRRIMATRHFEVRQPIKGAQMNEVVDAFGLASNQL 197

Query: 192 SSEIIDWTLSSLP 204
           +S++++W L   P
Sbjct: 198 ASQVLNWALQQSP 210


>gi|238751980|ref|ZP_04613465.1| hypothetical protein yrohd0001_23850 [Yersinia rohdei ATCC 43380]
 gi|238709814|gb|EEQ02047.1| hypothetical protein yrohd0001_23850 [Yersinia rohdei ATCC 43380]
          Length = 205

 Score = 58.9 bits (141), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 31/150 (20%), Positives = 76/150 (50%), Gaps = 2/150 (1%)

Query: 57  LIITEPITEKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVV 116
           L +++P T + +NS  I V+    EI     S+W+D  P +++ +LI  F  +G+I  V 
Sbjct: 55  LRVSQPATNQFINSSRIAVQPEGQEIAVYKNSRWTDPTPILVRNRLIQEFRTDGRIPAVS 114

Query: 117 KPNQGIYADYQIISAIRSFE-INIDRHCAI-ITMSLKIINAHDNSLVGQKVFHVEEKLEK 174
             +  + AD ++   + +F+ + +  +  + I    +++   D  ++  + F + + ++ 
Sbjct: 115 SDDDSLQADVELSGDLSAFQGVYLAGNSEVLIRFDARLVRISDRRIIATRHFEIRQPIKG 174

Query: 175 DNKLHFIQSLNRAFSRISSEIIDWTLSSLP 204
                 I +   A +++++++++WTL   P
Sbjct: 175 SQMDEVIDAFGLASNQLATQVLNWTLQQSP 204


>gi|238764192|ref|ZP_04625145.1| hypothetical protein ykris0001_6580 [Yersinia kristensenii ATCC
           33638]
 gi|238697605|gb|EEP90369.1| hypothetical protein ykris0001_6580 [Yersinia kristensenii ATCC
           33638]
          Length = 194

 Score = 58.5 bits (140), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 32/150 (21%), Positives = 71/150 (47%), Gaps = 2/150 (1%)

Query: 57  LIITEPITEKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVV 116
           L +++P T + +NS  I V+    EI     S+W+D  P +++ +LI  F  +G+I  V 
Sbjct: 44  LRVSQPATNQFINSSRIAVQPDGQEIAVYKNSRWTDPAPILVRNRLIQEFRTDGRIPAVS 103

Query: 117 KPNQGIYADYQIISAIRSFE--INIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEK 174
             +  + AD ++   + +F+          +I    +++   D  ++  + F V + ++ 
Sbjct: 104 SDDDSLQADVELSGDLSAFQGVYQAGNSEVLIRFDARLVRISDRRIMATRHFEVRQPIKG 163

Query: 175 DNKLHFIQSLNRAFSRISSEIIDWTLSSLP 204
                 + +   A  ++ S++++WTL   P
Sbjct: 164 AQMNEVVAAFGLASDQLVSQVLNWTLQQSP 193


>gi|313496510|gb|ADR57876.1| Putative lipoprotein [Pseudomonas putida BIRD-1]
          Length = 211

 Score = 58.2 bits (139), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 29/173 (16%), Positives = 79/173 (45%), Gaps = 3/173 (1%)

Query: 32  HNNPVNIYDLTESTKYDESVQRHIQLIITEPITEKILNSEDIIVRSSPIEIQYLIGSQWS 91
            + PV++Y L  +     +      L + +P+  ++L    I V      +    G++WS
Sbjct: 25  QSEPVDLYRLPVNQPSRTAPPLDWSLRLNKPLASEVLAGPRIAVVPQGNVVSSYKGARWS 84

Query: 92  DKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFEINIDRHCA---IITM 148
           D  P +++ +L+  F+  G++  +   +  + ADY++   +++F+       A   +I  
Sbjct: 85  DAAPVLLRNRLLDGFQREGQVQRLSADDSNLQADYELAGELQAFQSEYRTDGAVEVVIRY 144

Query: 149 SLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEIIDWTLS 201
             +++   +  ++  K F + + L+       +    +A  ++  ++++WT++
Sbjct: 145 DARLVQGRNQRILASKRFEIRQPLDDKQVSAVVAGFGQASDQLVGQVVNWTIT 197


>gi|170724245|ref|YP_001751933.1| hypothetical protein PputW619_5088 [Pseudomonas putida W619]
 gi|169762248|gb|ACA75564.1| protein of unknown function DUF330 [Pseudomonas putida W619]
          Length = 207

 Score = 58.2 bits (139), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 31/177 (17%), Positives = 80/177 (45%), Gaps = 3/177 (1%)

Query: 28  SCFFHNNPVNIYDLTESTKYDESVQRHIQLIITEPITEKILNSEDIIVRSSPIEIQYLIG 87
           S    + PV+IY L  +     +      L + +P+  ++L    I V      +    G
Sbjct: 21  SILPQSEPVDIYRLPVNQASHSATPVPWSLRLNKPLASEVLAGPRIAVIPKGDVVSSYKG 80

Query: 88  SQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFEINIDRHCA--- 144
           ++WSD +P +++ +L+  F+ +G++  +   +  + ADY++   +++F+           
Sbjct: 81  ARWSDPVPLLLRNRLLDGFQRDGRVQRLSADDSNLQADYELAGELQAFQSEYRPTGTVEV 140

Query: 145 IITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEIIDWTLS 201
           +I    +++      ++  K F V + L        +     A  ++++++++WT++
Sbjct: 141 VIRYDARLVQGRSQRILASKRFEVRQPLVDTQVSAVVAGFGVANDQLAAQVVNWTVA 197


>gi|23011784|ref|ZP_00052043.1| COG3218: ABC-type uncharacterized transport system, auxiliary
           component [Magnetospirillum magnetotacticum MS-1]
          Length = 125

 Score = 56.6 bits (135), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 30/114 (26%), Positives = 58/114 (50%), Gaps = 6/114 (5%)

Query: 6   NKIIKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIITEPITE 65
            + ++   +  SLA L       C     P+  +DL        +      ++++EP+  
Sbjct: 12  GRGLRAGALVASLAFL-----GGCGGGATPLT-FDLAALPGQPRAGGPARSIVVSEPVGL 65

Query: 66  KILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPN 119
           + + ++ IIVR +   + +L G QW+D+LPR+IQ ++I + EN G++ +V  P 
Sbjct: 66  QPMEADRIIVREAGGSLSFLGGGQWADRLPRLIQTRVIQSLENTGRLRSVSYPG 119


>gi|167031176|ref|YP_001666407.1| lipoprotein [Pseudomonas putida GB-1]
 gi|166857664|gb|ABY96071.1| lipoprotein [Pseudomonas putida GB-1]
          Length = 211

 Score = 56.6 bits (135), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 30/177 (16%), Positives = 79/177 (44%), Gaps = 3/177 (1%)

Query: 28  SCFFHNNPVNIYDLTESTKYDESVQRHIQLIITEPITEKILNSEDIIVRSSPIEIQYLIG 87
           S    + PV++Y L  +     +      L + +P+  ++L    I V      +    G
Sbjct: 21  SILPKSEPVDLYRLPVNQPSRTAPALDWSLRLNKPLASEVLAGPRIAVIPQGDMVSSYKG 80

Query: 88  SQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFEINIDRHCA--- 144
           ++WSD  P +++ +L+  F+ +G++  +   +  + ADY++   +++F+       A   
Sbjct: 81  ARWSDAAPVLLRNRLLDGFQRDGQVQRLSADDSNLQADYELAGELQAFQSEYRPGGAVEV 140

Query: 145 IITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEIIDWTLS 201
           +I    +++   +  ++  K F + + L        +    +A  ++  +++ WT++
Sbjct: 141 VIRYDARLVQGRNQRILASKRFEIRQPLTDKQVSAVVIGFGQASDQLVGQVVSWTIA 197


>gi|300312195|ref|YP_003776287.1| ABC transporter auxiliary component protein [Herbaspirillum
           seropedicae SmR1]
 gi|300074980|gb|ADJ64379.1| ABC-type uncharacterized transport system, auxiliary component
           protein [Herbaspirillum seropedicae SmR1]
          Length = 204

 Score = 56.6 bits (135), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 38/203 (18%), Positives = 88/203 (43%), Gaps = 14/203 (6%)

Query: 8   IIKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQ------RHIQLIITE 61
           +++  +++ SL +  C+ L       +P  +Y L  +T             R   L I  
Sbjct: 5   LLRTSLVAASLMLAACSILP----KPDPQAVYRLPTATAMPAQASTTAGDIRLRALRIAT 60

Query: 62  PITEKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQG 121
           P   + ++SE I+V      I+   G +WSD  P + + +L+  F  +G+   +      
Sbjct: 61  PYANRSIDSERILVLPEGDVIKSYAGVRWSDAAPLLWRDRLLEAFRADGRYQRLSSDTGN 120

Query: 122 IYADYQIISAIRSFEINIDRH---CAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKL 178
           I AD ++  A+ +F+    RH     +I    ++I+  +   +  + F ++  ++     
Sbjct: 121 IAADIELDGALSAFQTEY-RHGVPTVVIVYDARLIDTANRQQLASQRFAIQRAVDGSKVP 179

Query: 179 HFIQSLNRAFSRISSEIIDWTLS 201
             + +  +A  +++ E+++W  +
Sbjct: 180 EVVSAFGQACDQLAKEVVNWAAA 202


>gi|163793378|ref|ZP_02187353.1| hypothetical protein BAL199_02684 [alpha proteobacterium BAL199]
 gi|159181180|gb|EDP65695.1| hypothetical protein BAL199_02684 [alpha proteobacterium BAL199]
          Length = 211

 Score = 56.2 bits (134), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 45/202 (22%), Positives = 93/202 (46%), Gaps = 8/202 (3%)

Query: 7   KIIKKKIISCSLAVLLCTSLSSCFFHNNPVN-IYDLTESTKYDESVQR-HIQLIITEPIT 64
           ++++  +    +A L+  +  S      P   +Y LT  + +  ++     QL +  P +
Sbjct: 5   RLVRNAVGGALIAALVMVAGCSGLSLGGPSQQLYTLTPKSTFPANLPTVDWQLAVDRPSS 64

Query: 65  EKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYA 124
              L +  I V      I Y  G+QW D  P M+Q  LI +FEN+  I  V + +  + +
Sbjct: 65  PAGLATTRIAVIRGAHRIDYYAGAQWIDDAPNMVQRLLIESFENSKAIIGVGRESVSLRS 124

Query: 125 DYQIISAIRSFEINIDRHCAIITMSLKIINAHDNSLVGQKVFH---VEEKL-EKDNKLH- 179
           D+ +   +R F+           ++++ INA    +  +++     VE  +   DNK+H 
Sbjct: 125 DFVLRVELREFQAEYQEGVEAPKVNVR-INAKLVRMPQRRIIASTTVERVIASPDNKIHS 183

Query: 180 FIQSLNRAFSRISSEIIDWTLS 201
            + + ++A  ++  +I+ WT++
Sbjct: 184 IVDTFDQALGKVLRDIVVWTVT 205


>gi|26986884|ref|NP_742309.1| putative lipoprotein [Pseudomonas putida KT2440]
 gi|24981487|gb|AAN65773.1|AE016203_6 lipoprotein, putative [Pseudomonas putida KT2440]
          Length = 211

 Score = 55.8 bits (133), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 29/173 (16%), Positives = 78/173 (45%), Gaps = 3/173 (1%)

Query: 32  HNNPVNIYDLTESTKYDESVQRHIQLIITEPITEKILNSEDIIVRSSPIEIQYLIGSQWS 91
            + PV+ Y L  +     +      L + +P+  ++L    I V      +    G++WS
Sbjct: 25  QSEPVDHYRLPVNQPSRTAPPLDWSLRLNKPLASEVLAGPRIAVVPQGNVVSSYKGARWS 84

Query: 92  DKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFEINIDRHCA---IITM 148
           D  P +++ +L+  F+  G++  +   +  + ADY++   +++F+       A   +I  
Sbjct: 85  DAAPVLLRNRLLDGFQREGQVQRLSADDSNLQADYELAGELQAFQSEYRTDGAVEVVIRY 144

Query: 149 SLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEIIDWTLS 201
             +++   +  ++  K F + + L+       +    +A  ++  ++++WT++
Sbjct: 145 DARLVQGRNQRILASKRFEIRQPLDDKQVSAVVAGFGQASDQLVGQVVNWTIT 197


>gi|54294943|ref|YP_127358.1| hypothetical protein lpl2022 [Legionella pneumophila str. Lens]
 gi|53754775|emb|CAH16262.1| hypothetical protein lpl2022 [Legionella pneumophila str. Lens]
          Length = 200

 Score = 55.8 bits (133), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 44/194 (22%), Positives = 89/194 (45%), Gaps = 4/194 (2%)

Query: 12  KIISCSLAVLLCTSLSSCFFHNNPV-NIYDLTE-STKYDESVQRHIQLIITEPITEKILN 69
           +++S    +L   +L SC     PV N Y LT  STK      R I + +T P       
Sbjct: 2   RVLSSVCFILGILTLMSCSPVKVPVTNEYQLTAYSTKQLTRKPRPITIQVTVPEAVAGYQ 61

Query: 70  SEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQII 129
           +E+++    P +++  + + W+     M+   L+ + +++G    V        ADY++ 
Sbjct: 62  TEEMLYMKKPFKLEPFVKNAWTSPPADMLFPLLVQSLQSSGYFYAVTSSPYSEEADYRLD 121

Query: 130 SAIRSFEINIDRHCAIITMSLKIINAH--DNSLVGQKVFHVEEKLEKDNKLHFIQSLNRA 187
           + +   E N  +  +I+  S KI+  H  DN ++G ++  ++    +D     + + N+A
Sbjct: 122 TQVLKLEQNFIKKPSILEFSAKIVLTHISDNQIIGSRIVSLQIPCSQDTPYGGVIAANQA 181

Query: 188 FSRISSEIIDWTLS 201
             R ++   D+ +S
Sbjct: 182 TFRFTATATDFVVS 195


>gi|54297972|ref|YP_124341.1| hypothetical protein lpp2027 [Legionella pneumophila str. Paris]
 gi|53751757|emb|CAH13179.1| hypothetical protein lpp2027 [Legionella pneumophila str. Paris]
          Length = 200

 Score = 55.1 bits (131), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 43/194 (22%), Positives = 89/194 (45%), Gaps = 4/194 (2%)

Query: 12  KIISCSLAVLLCTSLSSCFFHNNPV-NIYDLTE-STKYDESVQRHIQLIITEPITEKILN 69
           +++S    +L   +L SC     PV N Y LT  STK      R I + +T P       
Sbjct: 2   RVLSSVCLILGILTLMSCSPVKVPVTNEYQLTAYSTKQLTRKPRPITIQVTVPEAVAGYQ 61

Query: 70  SEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQII 129
           +E+++    P +++  + + W+     M+   L+ + +++G    V        ADY++ 
Sbjct: 62  TEEMLYMKKPFKLEPFVKNAWTSPPADMLFPLLVQSLQSSGYFYAVTSSPYSEEADYRLD 121

Query: 130 SAIRSFEINIDRHCAIITMSLKIINAH--DNSLVGQKVFHVEEKLEKDNKLHFIQSLNRA 187
           + +   E N  +  +++  S KI+  H  DN ++G ++  ++    +D     + + N+A
Sbjct: 122 TQLLKLEQNFIKKPSVLEFSAKIVLTHISDNQIIGSRIVSLQIPCSQDTPYGGVIAANQA 181

Query: 188 FSRISSEIIDWTLS 201
             R ++   D+ +S
Sbjct: 182 TFRFTATATDFVVS 195


>gi|52842261|ref|YP_096060.1| hypothetical protein lpg2044 [Legionella pneumophila subsp.
           pneumophila str. Philadelphia 1]
 gi|52629372|gb|AAU28113.1| conserved domain protein [Legionella pneumophila subsp. pneumophila
           str. Philadelphia 1]
          Length = 200

 Score = 54.7 bits (130), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 43/194 (22%), Positives = 89/194 (45%), Gaps = 4/194 (2%)

Query: 12  KIISCSLAVLLCTSLSSCFFHNNPV-NIYDLTE-STKYDESVQRHIQLIITEPITEKILN 69
           +++S    +L   +L SC     PV N Y LT  STK      R I + +T P       
Sbjct: 2   RVLSSVCFILGILTLMSCSPVKVPVTNEYQLTAYSTKQLTRKPRPITIQVTVPEAVAGYQ 61

Query: 70  SEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQII 129
           +E+++    P +++  + + W+     M+   L+ + +++G    V        ADY++ 
Sbjct: 62  TEEMLYMKKPFKLEPFVKNAWTSPPADMLFPLLVQSLQSSGYFYAVTSSPYSEEADYRLD 121

Query: 130 SAIRSFEINIDRHCAIITMSLKIINAH--DNSLVGQKVFHVEEKLEKDNKLHFIQSLNRA 187
           + +   E N  +  +++  S KI+  H  DN ++G ++  ++    +D     + + N+A
Sbjct: 122 TQLLKLEQNFIKKPSVLEFSAKIVLTHISDNQIIGSRIVSLQIPCSQDTPYGGVIAANQA 181

Query: 188 FSRISSEIIDWTLS 201
             R ++   D+ +S
Sbjct: 182 TFRFTATATDFVVS 195


>gi|307610775|emb|CBX00387.1| hypothetical protein LPW_21081 [Legionella pneumophila 130b]
          Length = 200

 Score = 54.7 bits (130), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 43/194 (22%), Positives = 89/194 (45%), Gaps = 4/194 (2%)

Query: 12  KIISCSLAVLLCTSLSSCFFHNNPV-NIYDLTE-STKYDESVQRHIQLIITEPITEKILN 69
           +++S    +L   +L SC     PV N Y LT  STK      R I + +T P       
Sbjct: 2   RVLSSVCFILGILTLMSCSPVKVPVTNEYQLTAYSTKQLTRKPRAITIQVTVPEAVAGYQ 61

Query: 70  SEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQII 129
           +E+++    P +++  + + W+     M+   L+ + +++G    V        ADY++ 
Sbjct: 62  TEEMLYMKKPFKLEPFVKNAWTSPPADMLFPLLVQSLQSSGYFYAVTSSPYSEEADYRLD 121

Query: 130 SAIRSFEINIDRHCAIITMSLKIINAH--DNSLVGQKVFHVEEKLEKDNKLHFIQSLNRA 187
           + +   E N  +  +++  S KI+  H  DN ++G ++  ++    +D     + + N+A
Sbjct: 122 TQLLKLEQNFIKKPSVLEFSAKIVLTHISDNQIIGSRIVSLQIPCSQDTPYGGVIAANQA 181

Query: 188 FSRISSEIIDWTLS 201
             R ++   D+ +S
Sbjct: 182 TFRFTATATDFVVS 195


>gi|148925788|ref|ZP_01809476.1| putative lipoprotein [Campylobacter jejuni subsp. jejuni CG8486]
 gi|145845798|gb|EDK22889.1| putative lipoprotein [Campylobacter jejuni subsp. jejuni CG8486]
          Length = 199

 Score = 54.7 bits (130), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 33/117 (28%), Positives = 64/117 (54%), Gaps = 2/117 (1%)

Query: 90  WSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFE--INIDRHCAIIT 147
           W D    +    +++ FE +   +T++     + ADY + S I SFE  +N + + A I+
Sbjct: 83  WGDLPSNLYSFLILSKFEQSNIFTTLLSSTSSLSADYALESRINSFEQILNNNENYAQIS 142

Query: 148 MSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEIIDWTLSSLP 204
           +S+  IN  +N ++  K+F+ +EK+EK +      +  +A ++I +EI+ W  S+L 
Sbjct: 143 VSVNFINLENNQIIAHKIFNTKEKIEKKDIRSIYNAFQKALNKIGNEIVFWVNSNLS 199


>gi|319956953|ref|YP_004168216.1| hypothetical protein Nitsa_1214 [Nitratifractor salsuginis DSM
           16511]
 gi|319419357|gb|ADV46467.1| protein of unknown function DUF330 [Nitratifractor salsuginis DSM
           16511]
          Length = 195

 Score = 54.3 bits (129), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 47/195 (24%), Positives = 83/195 (42%), Gaps = 5/195 (2%)

Query: 11  KKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIITEPITEKILNS 70
           K ++S  +A  L   L  C      +++Y L  +        R   + +  P   +    
Sbjct: 2   KNLLSLLIAGALFFLLGGC--SGKTIHMYTLDAAGNLPRVHPRFSAIRVDYPKGIEDTMG 59

Query: 71  EDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIIS 130
             I    S +   Y   SQWS  L R++   LI   + +G    V+       A Y++  
Sbjct: 60  TRIYFSRSDLTQSYYGYSQWSKSLNRILMANLIEALQRSGIARNVLDYASQADAPYELEC 119

Query: 131 AIRSFE--INIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAF 188
            +  FE  I      A I++ L++I   D  L+  K+F+      + +   F+++ NRA 
Sbjct: 120 TVYRFEHQITPQGSTAEISIGLRLIRTEDKKLIASKIFNYSIPCTQTDARGFVEAANRAI 179

Query: 189 SRISSEIIDWTLSSL 203
            R+S+++I W LSS+
Sbjct: 180 FRLSTDMIRW-LSSV 193


>gi|315927600|gb|EFV06931.1| conserved hypothetical protein [Campylobacter jejuni subsp. jejuni
           DFVF1099]
          Length = 186

 Score = 54.3 bits (129), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 33/117 (28%), Positives = 64/117 (54%), Gaps = 2/117 (1%)

Query: 90  WSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFE--INIDRHCAIIT 147
           W D    +    +++ FE +   +T++     + ADY + S I SFE  +N + + A I+
Sbjct: 70  WGDLPSNLYSFLILSKFEQSNIFTTLLSSTSSLSADYSLESRINSFEQILNNNENYAQIS 129

Query: 148 MSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEIIDWTLSSLP 204
           +S+  IN  +N ++  K+F+ +EK+EK +      +  +A ++I +EI+ W  S+L 
Sbjct: 130 ISVNFINLENNQIIAHKIFNTKEKIEKKDIRSTYNAFQKALNKIGNEIVFWVNSNLS 186


>gi|86149476|ref|ZP_01067707.1| lipoprotein, putative [Campylobacter jejuni subsp. jejuni CF93-6]
 gi|88596065|ref|ZP_01099302.1| lipoprotein, putative [Campylobacter jejuni subsp. jejuni 84-25]
 gi|218563238|ref|YP_002345018.1| putative lipoprotein [Campylobacter jejuni subsp. jejuni NCTC
           11168]
 gi|85840258|gb|EAQ57516.1| lipoprotein, putative [Campylobacter jejuni subsp. jejuni CF93-6]
 gi|88190906|gb|EAQ94878.1| lipoprotein, putative [Campylobacter jejuni subsp. jejuni 84-25]
 gi|112360945|emb|CAL35746.1| putative lipoprotein [Campylobacter jejuni subsp. jejuni NCTC
           11168]
 gi|284926843|gb|ADC29195.1| putative lipoprotein [Campylobacter jejuni subsp. jejuni IA3902]
 gi|315929477|gb|EFV08673.1| conserved hypothetical protein [Campylobacter jejuni subsp. jejuni
           305]
          Length = 199

 Score = 53.9 bits (128), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 33/117 (28%), Positives = 64/117 (54%), Gaps = 2/117 (1%)

Query: 90  WSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFE--INIDRHCAIIT 147
           W D    +    +++ FE +   +T++     + ADY + S I SFE  +N + + A I+
Sbjct: 83  WGDLPSNLYSFLILSKFEQSNIFTTLLSSTSSLSADYSLESRINSFEQILNNNENYAQIS 142

Query: 148 MSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEIIDWTLSSLP 204
           +S+  IN  +N ++  K+F+ +EK+EK +      +  +A ++I +EI+ W  S+L 
Sbjct: 143 ISVNFINLENNQIIAHKIFNTKEKIEKKDIRSTYNAFQKALNKIGNEIVFWVNSNLS 199


>gi|152086|gb|AAA26208.1| ORF 180 [Bradyrhizobium japonicum]
          Length = 180

 Score = 53.9 bits (128), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 42/148 (28%), Positives = 78/148 (52%), Gaps = 9/148 (6%)

Query: 57  LIITEPITEKILNSEDII---VRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKIS 113
           L I EP    +L ++ ++   V  +P    +L    W+D +P+++Q +LI +FEN     
Sbjct: 35  LAIPEPTAVAMLQTQRMLFAPVGDNPGFADFL----WADSIPKLVQARLIDSFENYDIAH 90

Query: 114 TVVKPNQGIYADYQIISAIRSFEINIDRHCAI-ITMSLKIINAHDNSLVGQKVFHVEEKL 172
             ++ +    ADYQ++  IR F I  D    + I +S +I++  +  +V  ++    EKL
Sbjct: 91  APLRTSDLGQADYQLLIDIRRFRIATDGETRVEIGLSARIVD-KNGKVVASRLVETSEKL 149

Query: 173 EKDNKLHFIQSLNRAFSRISSEIIDWTL 200
           +K      + + + AF+RI+ E+I WT+
Sbjct: 150 DKVEPAAAVAAFDAAFARIAKELIGWTV 177


>gi|27381174|ref|NP_772703.1| ABC transporter substrate-binding protein [Bradyrhizobium japonicum
           USDA 110]
 gi|30179810|sp|P29285|Y6063_BRAJA RecName: Full=Uncharacterized protein bll6063
 gi|27354341|dbj|BAC51328.1| ABC transporter substrate-binding protein [Bradyrhizobium japonicum
           USDA 110]
          Length = 367

 Score = 53.9 bits (128), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 42/148 (28%), Positives = 78/148 (52%), Gaps = 9/148 (6%)

Query: 57  LIITEPITEKILNSEDII---VRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKIS 113
           L I EP    +L ++ ++   V  +P    +L    W+D +P+++Q +LI +FEN     
Sbjct: 222 LAIPEPTAVAMLQTQRMLFAPVGDNPGFADFL----WADSIPKLVQARLIDSFENYDIAH 277

Query: 114 TVVKPNQGIYADYQIISAIRSFEINIDRHCAI-ITMSLKIINAHDNSLVGQKVFHVEEKL 172
             ++ +    ADYQ++  IR F I  D    + I +S +I++  +  +V  ++    EKL
Sbjct: 278 APLRTSDLGQADYQLLIDIRRFRIATDGETRVEIGLSARIVD-KNGKVVASRLVETSEKL 336

Query: 173 EKDNKLHFIQSLNRAFSRISSEIIDWTL 200
           +K      + + + AF+RI+ E+I WT+
Sbjct: 337 DKVEPAAAVAAFDAAFARIAKELIGWTV 364


>gi|57238660|ref|YP_179791.1| putative lipoprotein [Campylobacter jejuni RM1221]
 gi|57167464|gb|AAW36243.1| lipoprotein, putative [Campylobacter jejuni RM1221]
 gi|315059099|gb|ADT73428.1| Putative lipoprotein [Campylobacter jejuni subsp. jejuni S3]
          Length = 199

 Score = 53.9 bits (128), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 33/117 (28%), Positives = 64/117 (54%), Gaps = 2/117 (1%)

Query: 90  WSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFE--INIDRHCAIIT 147
           W D    +    +++ FE +   +T++     + ADY + S I SFE  +N + + A I+
Sbjct: 83  WGDLPSNLYSFLILSKFEQSNIFTTLLSSTSSLSADYALESRINSFEQILNNNENYAQIS 142

Query: 148 MSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEIIDWTLSSLP 204
           +S+  IN  +N ++  K+F+ +EK+EK +      +  +A ++I +EI+ W  S+L 
Sbjct: 143 VSVNFINLENNQIIAHKIFNTKEKIEKKDIRSTYNAFQKALNKIGNEIVFWVNSNLS 199


>gi|86152615|ref|ZP_01070820.1| conserved hypothetical protein [Campylobacter jejuni subsp. jejuni
           HB93-13]
 gi|85843500|gb|EAQ60710.1| conserved hypothetical protein [Campylobacter jejuni subsp. jejuni
           HB93-13]
          Length = 199

 Score = 53.5 bits (127), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 33/117 (28%), Positives = 64/117 (54%), Gaps = 2/117 (1%)

Query: 90  WSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFE--INIDRHCAIIT 147
           W D    +    +++ FE +   +T++     + ADY + S I SFE  +N + + A I+
Sbjct: 83  WGDLPSNLYSFLILSKFEQSNIFTTLLSSTSSLSADYALESRINSFEQILNNNENYAQIS 142

Query: 148 MSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEIIDWTLSSLP 204
           +S+  IN  +N ++  K+F+ +EK+EK +      +  +A ++I +EI+ W  S+L 
Sbjct: 143 ISVNFINLENNQIIAHKIFNTKEKIEKKDIHSTYNAFQKALNKIGNEIVFWVNSNLS 199


>gi|205355661|ref|ZP_03222431.1| putative lipoprotein [Campylobacter jejuni subsp. jejuni CG8421]
 gi|205346438|gb|EDZ33071.1| putative lipoprotein [Campylobacter jejuni subsp. jejuni CG8421]
          Length = 140

 Score = 53.5 bits (127), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 33/117 (28%), Positives = 64/117 (54%), Gaps = 2/117 (1%)

Query: 90  WSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFE--INIDRHCAIIT 147
           W D    +    +++ FE +   +T++     + ADY + S I SFE  +N + + A I+
Sbjct: 24  WGDLPSNLYSFLILSKFEQSNIFTTLLSSTSSLSADYALESRINSFEQILNNNENYAQIS 83

Query: 148 MSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEIIDWTLSSLP 204
           +S+  IN  +N ++  K+F+ +EK+EK +      +  +A ++I +EI+ W  S+L 
Sbjct: 84  VSVNFINLENNQIIAHKIFNTKEKIEKKDIRSTYNAFQKALNKIGNEIVFWVNSNLS 140


>gi|86152317|ref|ZP_01070528.1| lipoprotein, putative [Campylobacter jejuni subsp. jejuni 260.94]
 gi|121613719|ref|YP_001001292.1| putative lipoprotein [Campylobacter jejuni subsp. jejuni 81-176]
 gi|167006186|ref|ZP_02271944.1| lipoprotein, putative [Campylobacter jejuni subsp. jejuni 81-176]
 gi|315125048|ref|YP_004067052.1| lipoprotein, putative [Campylobacter jejuni subsp. jejuni
           ICDCCJ07001]
 gi|85840806|gb|EAQ58057.1| lipoprotein, putative [Campylobacter jejuni subsp. jejuni 260.94]
 gi|87249863|gb|EAQ72822.1| lipoprotein, putative [Campylobacter jejuni subsp. jejuni 81-176]
 gi|315018770|gb|ADT66863.1| lipoprotein, putative [Campylobacter jejuni subsp. jejuni
           ICDCCJ07001]
          Length = 199

 Score = 53.5 bits (127), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 33/117 (28%), Positives = 64/117 (54%), Gaps = 2/117 (1%)

Query: 90  WSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFE--INIDRHCAIIT 147
           W D    +    +++ FE +   +T++     + ADY + S I SFE  +N + + A I+
Sbjct: 83  WGDLPSNLYSFLILSKFEQSNIFTTLLSSTSSLNADYALESRINSFEQILNNNENYAQIS 142

Query: 148 MSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEIIDWTLSSLP 204
           +S+  IN  +N ++  K+F+ +EK+EK +      +  +A ++I +EI+ W  S+L 
Sbjct: 143 ISVNFINLENNQIIAHKIFNTKEKIEKKDIRSTYNAFQKALNKIGNEIVFWVNSNLS 199


>gi|283957035|ref|ZP_06374507.1| lipoprotein, putative [Campylobacter jejuni subsp. jejuni 1336]
 gi|283791536|gb|EFC30333.1| lipoprotein, putative [Campylobacter jejuni subsp. jejuni 1336]
          Length = 199

 Score = 53.1 bits (126), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 33/117 (28%), Positives = 64/117 (54%), Gaps = 2/117 (1%)

Query: 90  WSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFE--INIDRHCAIIT 147
           W D    +    +++ FE +   +T++     + ADY + S I SFE  +N + + A I+
Sbjct: 83  WGDLPSNLYSFLILSKFEQSNIFTTLLSSTSSLNADYALESRINSFEQILNNNENYAQIS 142

Query: 148 MSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEIIDWTLSSLP 204
           +S+  IN  +N ++  K+F+ +EK+EK +      +  +A ++I +EI+ W  S+L 
Sbjct: 143 ISVNFINLENNQIIAHKIFNTKEKIEKKDIRSTYNAFQKALNKIGNEIVFWVNSNLS 199


>gi|77456268|ref|YP_345773.1| putative lipoprotein [Pseudomonas fluorescens Pf0-1]
 gi|77380271|gb|ABA71784.1| putative lipoprotein [Pseudomonas fluorescens Pf0-1]
          Length = 208

 Score = 53.1 bits (126), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 34/188 (18%), Positives = 81/188 (43%), Gaps = 5/188 (2%)

Query: 18  LAVLLCTSLSSCFFHNNPVNIYDLTES---TKYDESVQRHIQLIITEPITEKILNSEDII 74
           LA     S  S    + P+++Y L  +        S  +H  L + +    + LN   I 
Sbjct: 9   LAGFTLISACSILPKSEPLDVYRLPAAQAPASAGSSATQHWSLRLNKLQASEALNRPSIA 68

Query: 75  VRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRS 134
           V      I     S+WSD  P +++ +L+  F+ +G++S +   +    AD ++  ++++
Sbjct: 69  VIPQGDVISSYKASRWSDPAPVLVRNRLLDGFQRDGRVSLLSTDDSNFQADLELGGSLQA 128

Query: 135 F--EINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRIS 192
           F  E    +   ++ +   ++  +D  ++  + F   + L        +    +A  R++
Sbjct: 129 FQTEYQGTQASVVVRVDALLVRGYDQRILASRRFEERQPLSDVQVPAVVAGFGQASDRLT 188

Query: 193 SEIIDWTL 200
           ++++ W +
Sbjct: 189 AKVVAWAV 196


>gi|157415869|ref|YP_001483125.1| putative lipoprotein [Campylobacter jejuni subsp. jejuni 81116]
 gi|157386833|gb|ABV53148.1| lipoprotein, putative [Campylobacter jejuni subsp. jejuni 81116]
 gi|307748506|gb|ADN91776.1| probable lipoprotein [Campylobacter jejuni subsp. jejuni M1]
 gi|315931382|gb|EFV10351.1| conserved hypothetical protein [Campylobacter jejuni subsp. jejuni
           327]
          Length = 199

 Score = 52.0 bits (123), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 33/117 (28%), Positives = 64/117 (54%), Gaps = 2/117 (1%)

Query: 90  WSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFE--INIDRHCAIIT 147
           W D    +    +++ FE +   +T++     + ADY + S I SFE  ++ + + A I+
Sbjct: 83  WGDLPSNLYSFLILSKFEQSNIFTTLLSSTSSLNADYALESRINSFEQILSNNENYAQIS 142

Query: 148 MSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEIIDWTLSSLP 204
           +S+  IN  +N ++  K+F+ +EK+EK +      +  +A ++I +EII W  S+L 
Sbjct: 143 ISVNFINLENNQIIAHKIFNTKEKIEKKDIRSTYNAFQKALNKIGNEIIFWVNSNLS 199


>gi|153951354|ref|YP_001398926.1| putative lipoprotein [Campylobacter jejuni subsp. doylei 269.97]
 gi|152938800|gb|ABS43541.1| putative lipoprotein [Campylobacter jejuni subsp. doylei 269.97]
          Length = 199

 Score = 52.0 bits (123), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 37/118 (31%), Positives = 66/118 (55%), Gaps = 4/118 (3%)

Query: 90  WSDKLPRMIQLKLI-ANFENNGKISTVVKPNQGIYADYQIISAIRSFE--INIDRHCAII 146
           W D LP  +   LI + FE +   +T++     + ADY + S I SFE  +N + + A I
Sbjct: 83  WGD-LPSNLYSSLILSKFEQSNIFTTLLSSTSSLNADYALESRINSFEQILNNNENYAQI 141

Query: 147 TMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEIIDWTLSSLP 204
           ++S+  IN  +N ++  K+F+ +EK+EK +      +  +A ++I +EI+ W  S+L 
Sbjct: 142 SISVNFINLENNQIIAHKIFNTKEKIEKKDIRSTYNAFQKALNKIGNEIVFWVNSNLS 199


>gi|148359618|ref|YP_001250825.1| transport protein [Legionella pneumophila str. Corby]
 gi|296107660|ref|YP_003619361.1| ABC-type uncharacterized transport system, auxiliary component
           [Legionella pneumophila 2300/99 Alcoy]
 gi|148281391|gb|ABQ55479.1| transport system, auxiliary component [Legionella pneumophila str.
           Corby]
 gi|295649562|gb|ADG25409.1| ABC-type uncharacterized transport system, auxiliary component
           [Legionella pneumophila 2300/99 Alcoy]
          Length = 184

 Score = 51.6 bits (122), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 40/178 (22%), Positives = 81/178 (45%), Gaps = 4/178 (2%)

Query: 28  SCFFHNNPV-NIYDLTE-STKYDESVQRHIQLIITEPITEKILNSEDIIVRSSPIEIQYL 85
           SC     PV N Y LT  STK      R I + +T P       +E+++    P +++  
Sbjct: 2   SCSPVKVPVTNEYQLTAYSTKQLTRKPRPITIQVTVPEAVAGYQTEEMLYMKKPFKLEPF 61

Query: 86  IGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFEINIDRHCAI 145
           + + W+     M+   L+ + +++G    V        ADY++ + +   E N  +  ++
Sbjct: 62  VKNAWTSPPADMLFPLLVQSLQSSGYFYAVTSSPYSEEADYRLDTQLLKLEQNFIKKPSV 121

Query: 146 ITMSLKIINAH--DNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEIIDWTLS 201
           +  S KI+  H  DN ++G ++  ++    +D     + + N+A  R ++   D+ +S
Sbjct: 122 LEFSAKIVLTHISDNQIIGSRIVSLQIPCSQDTPYGGVIAANQATFRFTATATDFVVS 179


>gi|121998621|ref|YP_001003408.1| putative ABC transporter [Halorhodospira halophila SL1]
 gi|121590026|gb|ABM62606.1| putative ABC-type uncharacterized transport system [Halorhodospira
           halophila SL1]
          Length = 208

 Score = 50.8 bits (120), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 31/148 (20%), Positives = 69/148 (46%), Gaps = 2/148 (1%)

Query: 57  LIITEPITEKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVV 116
           L +T P +  +L    I V +    +    G++W   LPR+ Q  LI  F  +G+I  + 
Sbjct: 57  LRVTTPSSSDLLAGNRIAVATGEHRMSTFAGARWVSPLPRLWQEHLIETFYADGRIHRLS 116

Query: 117 KPNQGIYADYQIISAIRSFEINI--DRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEK 174
              + + AD ++ + +R+F+I    +   A + +  ++++     +V  + F     +  
Sbjct: 117 ADGERLSADLELRTTLRAFQIETRDEGPRARVVVDARLVDVGQRRIVATERFAATRDVAS 176

Query: 175 DNKLHFIQSLNRAFSRISSEIIDWTLSS 202
           D+    + +L  A   +  E++ WT+++
Sbjct: 177 DDTDAAVAALGAANRSVGRELVAWTVTA 204


>gi|283953733|ref|ZP_06371264.1| putative lipoprotein [Campylobacter jejuni subsp. jejuni 414]
 gi|283794774|gb|EFC33512.1| putative lipoprotein [Campylobacter jejuni subsp. jejuni 414]
          Length = 114

 Score = 50.4 bits (119), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 28/83 (33%), Positives = 50/83 (60%), Gaps = 2/83 (2%)

Query: 124 ADYQIISAIRSFE--INIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFI 181
           A+Y + S I SFE  +N D + A I++S+  IN  +N ++  K+F+++E +EK +     
Sbjct: 32  ANYVLESRINSFEQILNGDENYAQISISVNFINLENNQIIAHKIFNIKENIEKKDIRSTY 91

Query: 182 QSLNRAFSRISSEIIDWTLSSLP 204
            +  +A ++I +EII W  S+L 
Sbjct: 92  NAFQKALNKIGNEIIFWVNSNLS 114


>gi|292490600|ref|YP_003526039.1| hypothetical protein Nhal_0466 [Nitrosococcus halophilus Nc4]
 gi|291579195|gb|ADE13652.1| protein of unknown function DUF330 [Nitrosococcus halophilus Nc4]
          Length = 208

 Score = 50.4 bits (119), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 38/197 (19%), Positives = 80/197 (40%), Gaps = 10/197 (5%)

Query: 10  KKKIISCSLAVLLCTSLSSCFF---HNNPVNIYDLTES-TKYDESVQRHIQLIITEPITE 65
           ++++    L +++   LSSC        PV  Y L         +    + L+++ P   
Sbjct: 6   RRQLPYRGLCLIMVVILSSCTLSPKQPGPVRTYLLAPQLPPQTTAAPTPLTLLVSTPQAA 65

Query: 66  KILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYA- 124
               +  I     P E+ Y   +QW D   RM++  L+   E +G   ++   +  I A 
Sbjct: 66  AGYGTSQIAYTRKPYELDYFSRNQWVDTPERMLKPILVNALEASGHFQSIAPDDTRILAE 125

Query: 125 ---DYQIISAIRSFEINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFI 181
              D +I+  ++ F     +  + + +  ++I+      +  + F   E   ++     +
Sbjct: 126 LRLDTEILRLVQDFSGQPSQ--SHLVLRARLIDLAKGEEIASQTFEAREPAPEEGPYGGV 183

Query: 182 QSLNRAFSRISSEIIDW 198
            +LNRA  RI  E++ +
Sbjct: 184 IALNRALERILRELVTF 200


>gi|46579023|ref|YP_009831.1| putative lipoprotein [Desulfovibrio vulgaris str. Hildenborough]
 gi|120603388|ref|YP_967788.1| lipoprotein [Desulfovibrio vulgaris DP4]
 gi|46448436|gb|AAS95090.1| lipoprotein, putative [Desulfovibrio vulgaris str. Hildenborough]
 gi|120563617|gb|ABM29361.1| lipoprotein, putative [Desulfovibrio vulgaris DP4]
 gi|311232873|gb|ADP85727.1| protein of unknown function DUF330 [Desulfovibrio vulgaris RCH1]
          Length = 211

 Score = 50.1 bits (118), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 30/146 (20%), Positives = 66/146 (45%), Gaps = 3/146 (2%)

Query: 55  IQLIITEPITEKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKIST 114
           +QL ++ P T + L+++ I +     E+ YL   +W   +P+M+Q  +I   +   +I T
Sbjct: 58  VQLAVSLPETTRSLDTDHIAILQG-RELSYLPNVRWGSHVPQMLQRHIIDALDAGTRIGT 116

Query: 115 VVKPNQGIYADYQIISAIRSFEINID-RHCAI-ITMSLKIINAHDNSLVGQKVFHVEEKL 172
           V   + G++ D +++  I+ F    + R   + I + L++++     ++  +       L
Sbjct: 117 VSAESAGVFPDVRLMVDIQQFAARTEARETGVDIRLRLQMLDVRKGRIIASQNVEAYVPL 176

Query: 173 EKDNKLHFIQSLNRAFSRISSEIIDW 198
             D +   +     A S I  +   W
Sbjct: 177 ADDRRATLLDGFEAALSGILEKTARW 202


>gi|57168791|ref|ZP_00367922.1| probable lipoprotein Cj1649 [Campylobacter coli RM2228]
 gi|305432467|ref|ZP_07401629.1| probable lipoprotein [Campylobacter coli JV20]
 gi|57019838|gb|EAL56521.1| probable lipoprotein Cj1649 [Campylobacter coli RM2228]
 gi|304444506|gb|EFM37157.1| probable lipoprotein [Campylobacter coli JV20]
          Length = 200

 Score = 49.7 bits (117), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 28/116 (24%), Positives = 64/116 (55%), Gaps = 2/116 (1%)

Query: 90  WSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFEINIDRHCAIITMS 149
           W+D    + Q  L++ FE +     ++     + +DY + S I SFE  +D +   +++S
Sbjct: 82  WADLPNNLYQSLLLSKFEQSQIFKALLSQGSSVGSDYILESRIDSFEQVVDENENYVSIS 141

Query: 150 LKI--INAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEIIDWTLSSL 203
           + I  I+A ++ ++  ++F ++E+++K +     QS  +A + + +EI+ W  ++L
Sbjct: 142 ISINFIDAKESKIIAHRLFSIKERVKKIDIFDVYQSFEKALNSLGNEIVLWINATL 197


>gi|295690465|ref|YP_003594158.1| hypothetical protein Cseg_3100 [Caulobacter segnis ATCC 21756]
 gi|295432368|gb|ADG11540.1| protein of unknown function DUF330 [Caulobacter segnis ATCC 21756]
          Length = 211

 Score = 48.5 bits (114), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 41/207 (19%), Positives = 89/207 (42%), Gaps = 9/207 (4%)

Query: 11  KKIISCSLAVLLCTSLSSC---FFHNNPVNIYDLTEST-KYDESVQRHIQLIITEPITEK 66
           + I   +    L   LS+C   F    PV +Y   E+     +     +  ++  P T  
Sbjct: 5   RSIARLTAVAALAIGLSACISVFPKTKPVGLYRFGEAEISATKGPPGAMFGVLKSPSTFT 64

Query: 67  ILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADY 126
              + D I+ S+  ++ Y+  ++W      + +  +   FEN+   + ++   +   AD 
Sbjct: 65  RAAASDRILTSNQGQVAYIADARWVSPAFVLFEEAVARAFENDPGRARLIGRGEVAKADL 124

Query: 127 QIISAIRSFEIN-IDRHCA---IITMSLKIINAH-DNSLVGQKVFHVEEKLEKDNKLHFI 181
            +   +R+FE + +D   A   ++     ++N + D  LVG +VF    K   +     +
Sbjct: 125 VLRLEVRTFETDYVDGPKAAPEVVVRVRGVLNRNSDRVLVGDQVFEARVKAADNRVSAIV 184

Query: 182 QSLNRAFSRISSEIIDWTLSSLPLSDN 208
            + ++A +++  E++ WT ++ P   N
Sbjct: 185 PAYDKAVAQVLGEVVAWTNAAGPAIAN 211


>gi|83858855|ref|ZP_00952377.1| hypothetical protein OA2633_05111 [Oceanicaulis alexandrii
           HTCC2633]
 gi|83853678|gb|EAP91530.1| hypothetical protein OA2633_05111 [Oceanicaulis alexandrii
           HTCC2633]
          Length = 211

 Score = 48.1 bits (113), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 35/182 (19%), Positives = 78/182 (42%), Gaps = 8/182 (4%)

Query: 23  CTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIITEPITEKILNSEDIIVRSSPIEI 82
           C SL      + PV++Y L      +++   + Q ++ E IT     + D +      E+
Sbjct: 23  CISL---LPESEPVSLYRLNALVDEEQAPSANAQTLVIERITAPRGLAVDRVALLREGEL 79

Query: 83  QYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFEINIDR- 141
            Y+ G+ W    P M+Q +++   ++        +   G+ A Y++   +R FE   D+ 
Sbjct: 80  AYMAGAAWLSPAPVMVQDRILDVLQSETPELIPARTEDGVDARYRLQIELRRFEAEYDQG 139

Query: 142 --HCAIITMSL--KIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEIID 197
                +I M +  ++I+  + +L   + F V  +   + +   I + + A +  +  +  
Sbjct: 140 PSRAPVIQMRVMARLIDREERTLAAARRFDVSVRASDNRQSALIAAFSEATNDTARSLAQ 199

Query: 198 WT 199
           W+
Sbjct: 200 WS 201


>gi|254496225|ref|ZP_05109119.1| conserved hypothetical protein [Legionella drancourtii LLAP12]
 gi|254354530|gb|EET13171.1| conserved hypothetical protein [Legionella drancourtii LLAP12]
          Length = 201

 Score = 47.8 bits (112), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 43/194 (22%), Positives = 87/194 (44%), Gaps = 7/194 (3%)

Query: 12  KIISCSLAVLLCTSLSSCFFHNNPV-NIYDLTE-STKYDESVQRHIQLIITEPITEKILN 69
           K I  S++ L   +L +C     PV N Y LTE S+K      RHI L +T P       
Sbjct: 5   KGIGVSMSAL---TLIACSPVKIPVTNQYQLTEYSSKQLAKHPRHIALWVTAPEAVAGYQ 61

Query: 70  SEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQII 129
           +E ++  + P +    + + W++    M+   ++ + +  G    V+       ADY++ 
Sbjct: 62  TEQMLYVNKPFQRAPFVKNAWTNPPGDMLYPLMVQSLQRTGFFYAVMSSVYSQGADYRLD 121

Query: 130 SAIRSFEINIDRHCAIITMSLKII--NAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRA 187
           + + S E N  +  ++I  S K++     DN ++  K+   +     +     + + N+A
Sbjct: 122 TQLLSLEQNFLKKPSVIEFSAKVVLTKVADNKVIASKIISQQIPCPAETPYGGVVAANKA 181

Query: 188 FSRISSEIIDWTLS 201
             + ++ + D+ +S
Sbjct: 182 TRQFTAIMSDFVVS 195


>gi|114320358|ref|YP_742041.1| ABC-type uncharacterized transport system auxiliary component-like
           protein [Alkalilimnicola ehrlichii MLHE-1]
 gi|114226752|gb|ABI56551.1| ABC-type uncharacterized transport system auxiliary component-like
           protein [Alkalilimnicola ehrlichii MLHE-1]
          Length = 208

 Score = 46.6 bits (109), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/121 (20%), Positives = 59/121 (48%), Gaps = 4/121 (3%)

Query: 81  EIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRS----FE 136
           E+Q     QW +   RM+   L+A  E++G    V+     + A  ++ + ++     FE
Sbjct: 79  ELQRFAHHQWVEPPARMLTPALVAVLEHDGPFRQVIHGPTVVDAPLRLHTELKRLEHRFE 138

Query: 137 INIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEII 196
            + D    ++T+ ++++++    ++  + FH E   E+ + +   ++ NRA + +  +I 
Sbjct: 139 HDEDAGRVVLTLRIQLLDSEAGEVLTTRRFHAEVTAERRHPVAGAKAANRALAELLPQIT 198

Query: 197 D 197
           D
Sbjct: 199 D 199


>gi|16126560|ref|NP_421124.1| hypothetical protein CC_2321 [Caulobacter crescentus CB15]
 gi|221235342|ref|YP_002517779.1| membrane lipoprotein [Caulobacter crescentus NA1000]
 gi|13423844|gb|AAK24292.1| hypothetical protein CC_2321 [Caulobacter crescentus CB15]
 gi|220964515|gb|ACL95871.1| membrane lipoprotein [Caulobacter crescentus NA1000]
          Length = 216

 Score = 46.2 bits (108), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 35/213 (16%), Positives = 96/213 (45%), Gaps = 9/213 (4%)

Query: 5   LNKIIKKKIISCSLAVLLCTSLSSC---FFHNNPVNIYDLTES-TKYDESVQRHIQLIIT 60
           +N+   +++     A  L  SLS+C   F  + P  +Y   ++     +  +  +  ++ 
Sbjct: 4   MNRKAPRRVAKVVAATALALSLSACISVFPESEPATLYRFGQADVGVPKGPKGAVFSVLK 63

Query: 61  EPITEKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQ 120
            P T    ++ D ++ S+  E+ Y+  ++W      + +  + + F+ +   + ++   +
Sbjct: 64  APTTFTRASAGDRLLTSTRGEVAYIADARWVSPAFVLFEEAVASAFQTDQGRARLIGRGE 123

Query: 121 GIYADYQIISAIRSFE---INIDRHCAIITMSLK-IINA-HDNSLVGQKVFHVEEKLEKD 175
              AD  +   +++FE   +N  +    + + ++ ++N   D +LV  +VF    K + +
Sbjct: 124 IAKADLVLRLEVQTFEAQYVNGPKSAPEVVVRVRGVLNRNQDRTLVSDQVFEARVKADDN 183

Query: 176 NKLHFIQSLNRAFSRISSEIIDWTLSSLPLSDN 208
                + + ++A +++  E++ W  ++ P   N
Sbjct: 184 RVSAIVPAYDQAVAQVLGEVVTWVNATGPAIQN 216


>gi|94496557|ref|ZP_01303133.1| hypothetical protein SKA58_17672 [Sphingomonas sp. SKA58]
 gi|94423917|gb|EAT08942.1| hypothetical protein SKA58_17672 [Sphingomonas sp. SKA58]
          Length = 203

 Score = 46.2 bits (108), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 41/182 (22%), Positives = 76/182 (41%), Gaps = 12/182 (6%)

Query: 26  LSSC--FFHNNPVNIYDLTESTKYDESVQR----HIQLIITEPITEKILNSEDIIVRSSP 79
           LS C  F    P  +  L  + K      R       LI+TEP   K +++  + V++SP
Sbjct: 19  LSGCVSFGGKPPERLLSLDAAHKVPSGTPRVAGNGRTLIVTEPEAPKTVDTVRVPVQTSP 78

Query: 80  IEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIY---ADYQIISAIRSFE 136
             + Y+   QW+D  PR +  +L+A  E     +  V  + G +      ++   +  F 
Sbjct: 79  TSVAYVTDVQWADT-PRHLFRRLLA--ETISATTDRVVLDTGQFSGDGGQRLTGELIDFG 135

Query: 137 INIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEII 196
           I+  +  AI+T    ++     +L  Q+         K N       LN A +++++++ 
Sbjct: 136 IDEAQQSAIVTYDAMLMTPSGVALARQRFTASAPVGGKINATSVGAPLNAAANQVATDVA 195

Query: 197 DW 198
            W
Sbjct: 196 AW 197


>gi|270159821|ref|ZP_06188477.1| putative lipoprotein [Legionella longbeachae D-4968]
 gi|289165421|ref|YP_003455559.1| hypothetical protein LLO_2088 [Legionella longbeachae NSW150]
 gi|269988160|gb|EEZ94415.1| putative lipoprotein [Legionella longbeachae D-4968]
 gi|288858594|emb|CBJ12475.1| Conserved hypothetical protein [Legionella longbeachae NSW150]
          Length = 199

 Score = 45.4 bits (106), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 43/199 (21%), Positives = 84/199 (42%), Gaps = 13/199 (6%)

Query: 11  KKIISCSLAVLLCTSLSSCFFHNNPVNI-----YDLTE-STKYDESVQRHIQLIITEPIT 64
           KK+  C L  L    LS+C    +PV I     Y L+  S K        I L++T P  
Sbjct: 2   KKLAVCLLG-LSAVILSAC----SPVRISVKDQYQLSAFSAKQLAKKPMPITLLVTAPDA 56

Query: 65  EKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYA 124
                +E ++    P E++    + W +    M+   ++ + +       V      + A
Sbjct: 57  AGGYQTEQMLYIKRPYELEAFAKNAWVNPPADMLYPLILQSLQKTNLFEAVTSNAYALGA 116

Query: 125 DYQIISAIRSFEINIDRHCAIITMSLKIINAH--DNSLVGQKVFHVEEKLEKDNKLHFIQ 182
           DY++ S +     N  +  ++I  S+KI+  H  DN ++G ++ ++      D     + 
Sbjct: 117 DYRLDSQLLYLNQNFLKKPSVIEFSVKIVLTHVSDNKILGSRIINLSVPCPSDTPYGGVI 176

Query: 183 SLNRAFSRISSEIIDWTLS 201
           + N+A    ++E+  + +S
Sbjct: 177 AANKATQIFTAELAHFVVS 195


>gi|294010010|ref|YP_003543470.1| ABC-type transport system auxiliary component (lipoprotein)
           [Sphingobium japonicum UT26S]
 gi|139001581|dbj|BAF51701.1| putative lipoprotein [Sphingobium japonicum]
 gi|292673340|dbj|BAI94858.1| ABC-type transport system auxiliary component (lipoprotein)
           [Sphingobium japonicum UT26S]
          Length = 202

 Score = 45.1 bits (105), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 39/193 (20%), Positives = 78/193 (40%), Gaps = 8/193 (4%)

Query: 17  SLAVLLCTSLSSC--FFHNNPVNIYDLTESTKYDESVQR----HIQLIITEPITEKILNS 70
            LA +    L+ C  F    P  +  L  + K      R       + + +P   K+L++
Sbjct: 9   GLAAVGALMLAGCVSFGGKPPERLLSLNAAQKVAPGTLRSASSGTSITVADPEAPKMLDT 68

Query: 71  EDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQ-GIYADYQII 129
             + V +SP  + Y+   QW+D  PR +  KL+A          V+ P Q    A  +++
Sbjct: 69  VRVPVITSPTSVAYVTKVQWADT-PRHLFQKLLAETIAATSNRIVLDPGQYSADAGQRLM 127

Query: 130 SAIRSFEINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFS 189
             +  F ++   + A++T    +      ++  Q+         K +       LN A +
Sbjct: 128 GELVDFGVDEASNSAVVTYDAMLAGPGGTAIAKQRFTASAPIGGKIDANSVGAPLNAAAN 187

Query: 190 RISSEIIDWTLSS 202
           ++++++  W  SS
Sbjct: 188 KVAADVAAWLASS 200


>gi|307545042|ref|YP_003897521.1| hypothetical protein HELO_2452 [Halomonas elongata DSM 2581]
 gi|307217066|emb|CBV42336.1| K09857 hypothetical protein [Halomonas elongata DSM 2581]
          Length = 196

 Score = 43.9 bits (102), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 43/193 (22%), Positives = 81/193 (41%), Gaps = 21/193 (10%)

Query: 13  IISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQ-LIITEPIT-EKILNS 70
           + + SLA L    LS C     P   Y L ++   D+++    + L++  PI   + L+ 
Sbjct: 7   LFAASLAALW---LSGCATGGTPPTHYTLPDAPLADDAIDASTERLLVIRPIRLARYLDV 63

Query: 71  EDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQII- 129
           E I+ +   I +Q   G QW++ L R ++  L        +++T + P+  I  D     
Sbjct: 64  EGIVFQLDDITVQQAKGHQWAEPLGRQLERGL------RDRLATRL-PDTRIMLDGDTAR 116

Query: 130 -SAIRSFEINIDR------HCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQ 182
             A  S  + +DR        A+     ++ +A    L+    F +   LE D     +Q
Sbjct: 117 GDAPLSLRLEMDRFQGRHDGMAVAEGRWQLRDAS-GELLALTPFSLTTPLEADGYPALVQ 175

Query: 183 SLNRAFSRISSEI 195
           +L +   R++  +
Sbjct: 176 ALGQDLDRLADRL 188


>gi|56551911|ref|YP_162750.1| hypothetical protein ZMO1015 [Zymomonas mobilis subsp. mobilis ZM4]
 gi|241761773|ref|ZP_04759859.1| conserved hypothetical protein [Zymomonas mobilis subsp. mobilis
           ATCC 10988]
 gi|260752533|ref|YP_003225426.1| hypothetical protein Za10_0290 [Zymomonas mobilis subsp. mobilis
           NCIMB 11163]
 gi|56543485|gb|AAV89639.1| protein of unknown function DUF330 [Zymomonas mobilis subsp.
           mobilis ZM4]
 gi|241373687|gb|EER63247.1| conserved hypothetical protein [Zymomonas mobilis subsp. mobilis
           ATCC 10988]
 gi|258551896|gb|ACV74842.1| protein of unknown function DUF330 [Zymomonas mobilis subsp.
           mobilis NCIMB 11163]
          Length = 208

 Score = 43.5 bits (101), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 35/169 (20%), Positives = 66/169 (39%), Gaps = 6/169 (3%)

Query: 35  PVNIYDLTESTKYDES---VQRHIQLIITEPITEKILNSEDIIVRSSPIEIQYLIGSQWS 91
           P N+  LT S     +    Q    L++  P     L    I V +SP  + YL    W 
Sbjct: 30  PKNLLTLTSSAAPAANSDLTQNKPLLLVVPPAVPAELKVTRIPVTTSPTTVAYLTDGVWV 89

Query: 92  DKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFEINIDRHCAIITMS-- 149
           D   R+    L     ++     VV       A Y +   + +F ++   H  +++    
Sbjct: 90  DLPSRLFSNILSTTIASHNHF-MVVNYRAATGAAYHLTGNLTAFGLDAAHHQIVVSYDAF 148

Query: 150 LKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEIIDW 198
           L+    H    V  + F + +  +K + +    +LN A ++++ ++ DW
Sbjct: 149 LRGSKDHRTETVTSRHFEIRQPAQKQDAVSVANNLNTAANQMAGQVADW 197


>gi|75675225|ref|YP_317646.1| ABC transporter substrate-binding protein [Nitrobacter winogradskyi
           Nb-255]
 gi|74420095|gb|ABA04294.1| ABC transporter substrate-binding protein [Nitrobacter winogradskyi
           Nb-255]
          Length = 101

 Score = 43.5 bits (101), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 26/99 (26%), Positives = 47/99 (47%), Gaps = 5/99 (5%)

Query: 90  WSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFEINIDRHCAIITMS 149
           W+D +P ++Q KL+ +FEN       ++   G+ AD+Q++  +R F+I  D    +  + 
Sbjct: 2   WADSIPNLLQAKLLESFENYDIAHAPLRSMDGVQADHQLLIDVRRFQITTDPE-PVADIG 60

Query: 150 LKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAF 188
           L      D  +V  ++F   +KL          + N AF
Sbjct: 61  LN----KDVKVVAARLFEETQKLRTIEPDTASAAFNEAF 95


>gi|197120795|ref|YP_002132746.1| ABC transporter [Anaeromyxobacter sp. K]
 gi|196170644|gb|ACG71617.1| ABC-type uncharacterized transport system auxiliary component-like
           protein [Anaeromyxobacter sp. K]
          Length = 220

 Score = 43.5 bits (101), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 27/148 (18%), Positives = 61/148 (41%), Gaps = 6/148 (4%)

Query: 57  LIITEPITEKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVV 116
           L++  P      +   I       E+Q+   S+W D   RM+   L+   E +G    V 
Sbjct: 52  LVVAVPTAAAGFDGPRIAYVRRAHELQFFARSEWVDAPARMLAPLLVQALERSGGFQAVA 111

Query: 117 KPN----QGIYADYQIISAIRSFEINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKL 172
                   G+  + +++   + F +   R    +T+ +++ +     ++G +     E+ 
Sbjct: 112 GARTPAAAGLRLESELVRLQQEFTVRPSR--VRLTLRVQLSDVASRRVLGTRELEAVEEA 169

Query: 173 EKDNKLHFIQSLNRAFSRISSEIIDWTL 200
             D+    +++ NRA  R+  E++ + L
Sbjct: 170 RSDDPYGGVEAANRAVRRLLDEVVAYCL 197


>gi|85707664|ref|ZP_01038730.1| hypothetical protein NAP1_00475 [Erythrobacter sp. NAP1]
 gi|85689198|gb|EAQ29201.1| hypothetical protein NAP1_00475 [Erythrobacter sp. NAP1]
          Length = 203

 Score = 42.7 bits (99), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 37/195 (18%), Positives = 75/195 (38%), Gaps = 8/195 (4%)

Query: 12  KIISCSLAVLLCTSLSSC-----FFHNNPVNIYDLTESTKYDESVQRHIQLIITEPITEK 66
            ++  SLA+  C SL             P  +        ++ + +     ++T  +  K
Sbjct: 10  ALVGASLALSACVSLGGAEPPESLLSLTPTAMAPAGSGASHNRAGESSAIAVLTPEVPAK 69

Query: 67  ILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADY 126
            L+ + + V  S  EI YL  + W +K  R+ +  L       G +  +   +    A  
Sbjct: 70  -LDVQRVPVNVSDTEIAYLQEAVWVEKPARLFRRLLGETLRTRGSMLVLDGEDSPTVATR 128

Query: 127 QIISAIRSFEINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNR 186
            +  ++   E+  D   + + +S   I   D+  V  + F   E+           +LNR
Sbjct: 129 YLRGSL--IELGYDAPTSSVVVSFNAILTSDDGTVTSRRFEAREEGILAEASDVGPALNR 186

Query: 187 AFSRISSEIIDWTLS 201
           A + ++ E+ DW ++
Sbjct: 187 AANTLAGEVADWAIA 201


>gi|88810289|ref|ZP_01125546.1| hypothetical protein NB231_14453 [Nitrococcus mobilis Nb-231]
 gi|88791919|gb|EAR23029.1| hypothetical protein NB231_14453 [Nitrococcus mobilis Nb-231]
          Length = 156

 Score = 41.6 bits (96), Expect = 0.065,   Method: Compositional matrix adjust.
 Identities = 25/142 (17%), Positives = 61/142 (42%), Gaps = 3/142 (2%)

Query: 58  IITEPITEKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVK 117
           ++  P      ++  +  R +P EI+Y   S+W D   RM++  L +     G   +   
Sbjct: 1   MVEPPQVAAGYDTTAMAYRRTPWEIRYYSLSRWVDDPARMLREALTSALNQLGPFRSAFA 60

Query: 118 PNQGIYADYQIISAIRSFE---INIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEK 174
              GI  DY + + +   E    N       + + ++++N   ++L+  +V  +      
Sbjct: 61  SPAGIAVDYSLRTELLRLEQDFSNAPPSRERLVVRVQLVNLAHDTLLASQVLELNTTAPS 120

Query: 175 DNKLHFIQSLNRAFSRISSEII 196
           ++    + + N A  ++++E++
Sbjct: 121 EDAYGGVVAANTALQQLAAEVV 142


>gi|82702736|ref|YP_412302.1| hypothetical protein Nmul_A1609 [Nitrosospira multiformis ATCC
           25196]
 gi|82410801|gb|ABB74910.1| conserved hypothetical protein [Nitrosospira multiformis ATCC
           25196]
          Length = 220

 Score = 41.6 bits (96), Expect = 0.074,   Method: Compositional matrix adjust.
 Identities = 39/187 (20%), Positives = 77/187 (41%), Gaps = 5/187 (2%)

Query: 19  AVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQ--LIITEPITEKILNSEDIIVR 76
           A+LL  S  S       + IY L  +     S    +   L +  P +  I +S  ++  
Sbjct: 22  AMLLLVSSCSILPATENLEIYQLPAAEFAPRSSGSPLPWTLRLATPHSNYITDSPRVLAL 81

Query: 77  SSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISA-IRSF 135
               ++    G +WSD +P +++ +L   F  +G+ ++++  N         +   + +F
Sbjct: 82  RQGSQLSSYKGIRWSDPVPVLLRNRLAGAFRADGRFNSIINGNNNNLIANLELGGDLSAF 141

Query: 136 EINI--DRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISS 193
           ++    D   A I     +     N +V  + F V E ++       I +   A  R ++
Sbjct: 142 QVEYTNDGPQATIYFYATLSQPLRNRIVAVRRFEVGEPVQSRGTSGIITAFGVAADRFAA 201

Query: 194 EIIDWTL 200
           EI+DWT+
Sbjct: 202 EIVDWTV 208


>gi|83309428|ref|YP_419692.1| ABC transporter [Magnetospirillum magneticum AMB-1]
 gi|82944269|dbj|BAE49133.1| ABC-type uncharacterized transport system [Magnetospirillum
           magneticum AMB-1]
          Length = 197

 Score = 41.2 bits (95), Expect = 0.088,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 34/72 (47%)

Query: 90  WSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFEINIDRHCAIITMS 149
           WS+    ++Q +L       G    VV P   + AD+ +   +R FE   DR  A++ + 
Sbjct: 83  WSEPPGLLLQDRLAHYLAAAGIADKVVTPELRVLADWVLRGKVRRFEQIADRAEAVVDLE 142

Query: 150 LKIINAHDNSLV 161
           L ++ A D  LV
Sbjct: 143 LAVVRARDGRLV 154


>gi|182416426|ref|YP_001821492.1| hypothetical protein Oter_4622 [Opitutus terrae PB90-1]
 gi|177843640|gb|ACB77892.1| protein of unknown function DUF330 [Opitutus terrae PB90-1]
          Length = 214

 Score = 40.4 bits (93), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 40/195 (20%), Positives = 85/195 (43%), Gaps = 13/195 (6%)

Query: 11  KKIISCSLAVLLCTSLSSCFFHNNPVNIYDLT------ESTKYDESVQRHIQLIITEPIT 64
           K  ++ SL V + T  S      +    Y LT      E  K  E+  R   +++   + 
Sbjct: 20  KPALAGSLLVGMLTGCSLPEAQPDLTRFYVLTPTLAAAEMAKPAEAAPR---VLLRGVMV 76

Query: 65  EKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYA 124
            + L  + + VR S  E++Y+  ++W++ L   +Q  L  + E +G++  V + ++    
Sbjct: 77  PEFLRGKIMPVRLSDTELRYIDQARWAEPLEAGLQRTLKVDLERSGRVRVVGRGSE--PH 134

Query: 125 DYQIISAIRSFEINIDRHCAIITMSLKIINAH-DNSLVGQKVFHVE-EKLEKDNKLHFIQ 182
           D++I   +R  E  +    A +   +++ +   +  LV Q  F  E    +  N     +
Sbjct: 135 DFEIALQVRQCEGVVPGRVARLAARIEVYSGDVEAKLVAQDEFTTEIAGWDGANHAELAK 194

Query: 183 SLNRAFSRISSEIID 197
            L+ A ++++  + D
Sbjct: 195 KLSEAAAQLAQRVAD 209


>gi|317056897|ref|YP_004105364.1| hypothetical protein Rumal_2244 [Ruminococcus albus 7]
 gi|315449166|gb|ADU22730.1| protein of unknown function DUF214 [Ruminococcus albus 7]
          Length = 671

 Score = 39.7 bits (91), Expect = 0.23,   Method: Composition-based stats.
 Identities = 18/59 (30%), Positives = 36/59 (61%)

Query: 34  NPVNIYDLTESTKYDESVQRHIQLIITEPITEKILNSEDIIVRSSPIEIQYLIGSQWSD 92
           + ++++  T  ++YD++V   I L +    T  ++  +D+I  SSP+E++Y IG+  SD
Sbjct: 446 DEISVFGRTLRSQYDDTVDGFITLDVARTNTGIVIVPDDVITGSSPLEMEYFIGNYLSD 504


>gi|144898321|emb|CAM75185.1| ABC-type uncharacterized transport system, auxiliary component
           [Magnetospirillum gryphiswaldense MSR-1]
          Length = 194

 Score = 38.5 bits (88), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 30/155 (19%), Positives = 64/155 (41%), Gaps = 2/155 (1%)

Query: 17  SLAVLLCTSLSSCFFHNNPVN-IYDLTESTKYDESVQRHIQLI-ITEPITEKILNSEDII 74
           SL   L  +L++C     P +  Y L             + +I ++ P T+ +L+   + 
Sbjct: 5   SLIAALAVTLAACAQQAPPKDRFYRLETPPVAARFAAPSLGVIEVSRPTTDGVLSERPLA 64

Query: 75  VRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRS 134
            +     +       W++    ++Q  L+ +   +G   TV+ P   +  D+ I   +  
Sbjct: 65  YQDGDGTLGRYRYDLWAEPPTALLQNALVDSLRLSGISHTVITPETRVPPDWMIRGRLNR 124

Query: 135 FEINIDRHCAIITMSLKIINAHDNSLVGQKVFHVE 169
           FE+       +  + L ++++ D SL+  K + VE
Sbjct: 125 FEMLAGAGKVVANVELAVVSSRDGSLLLLKTYQVE 159


>gi|307297004|ref|ZP_07576820.1| protein of unknown function DUF330 [Sphingobium chlorophenolicum
           L-1]
 gi|306877530|gb|EFN08758.1| protein of unknown function DUF330 [Sphingobium chlorophenolicum
           L-1]
          Length = 200

 Score = 38.5 bits (88), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 32/155 (20%), Positives = 63/155 (40%), Gaps = 8/155 (5%)

Query: 17  SLAVLLCTSLSSC--FFHNNPVNIYDLTESTKYDESVQR----HIQLIITEPITEKILNS 70
            LA +    L+ C  F    P  +  L  + K      R       + + +P   K+L++
Sbjct: 7   GLAAVGALMLAGCVSFGGKPPERLLSLNAAQKVAPGTLRSASSGTAITVADPEAPKMLDT 66

Query: 71  EDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQ-GIYADYQII 129
             + V +SP  + Y+   QW+D  PR +  KL+A          V+ P Q    A  +++
Sbjct: 67  VRVPVITSPTSVAYVTKVQWADT-PRHLFQKLLAETIAATSSRIVLDPGQYSADAGQRLM 125

Query: 130 SAIRSFEINIDRHCAIITMSLKIINAHDNSLVGQK 164
             +  F ++   + A++T    +      ++  Q+
Sbjct: 126 GELVDFGLDEASNSAVVTYDAMLAGPGGTAIAKQR 160


>gi|160871905|ref|ZP_02062037.1| conserved hypothetical protein [Rickettsiella grylli]
 gi|159120704|gb|EDP46042.1| conserved hypothetical protein [Rickettsiella grylli]
          Length = 218

 Score = 38.1 bits (87), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 46/211 (21%), Positives = 89/211 (42%), Gaps = 13/211 (6%)

Query: 1   MDKKLNKIIKKKIISCSLAVLLCTSLSSCFFHNN----PVNIYDLT-ESTKYDESVQRHI 55
            +KK N II   II C LA LL   LS+C         P + + L       D  +QR  
Sbjct: 9   FNKKNNFIIA--IIVCFLAFLL---LSACSLFEPIKIPPTHYFTLAIPDPNGDCPIQRGC 63

Query: 56  Q-LIITEPITEKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKIST 114
           + +++ +P    + N+  +I   +  +IQY   ++W      M+   LI   ++ G    
Sbjct: 64  RTILVNQPRVNAVYNTSRMIYIPACYQIQYFSQNRWVGTPAEMLHPLLINALQHTGYFQA 123

Query: 115 VVKPNQGIYADYQIISAIRSFEINIDRHCAIITMSLK--IINAHDNSLVGQKVFHVEEKL 172
           ++        D+ + + + SF+       +   ++++  +I+A    ++  + F   E  
Sbjct: 124 IINTPSTTDYDWVLNTQLLSFQQEFIYFPSRFRIAIRAQLIDARSRHILATQDFVAVEIA 183

Query: 173 EKDNKLHFIQSLNRAFSRISSEIIDWTLSSL 203
             D+      + N A  +I +EI  + L +L
Sbjct: 184 PHDDPYGGTLAANSAIQKILNEINCFCLKNL 214


>gi|83648820|ref|YP_437255.1| hypothetical protein HCH_06186 [Hahella chejuensis KCTC 2396]
 gi|83636863|gb|ABC32830.1| hypothetical protein HCH_06186 [Hahella chejuensis KCTC 2396]
          Length = 148

 Score = 38.1 bits (87), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 33/117 (28%), Positives = 53/117 (45%), Gaps = 10/117 (8%)

Query: 11  KKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIITE--PITEKIL 68
           K II  +L++ L  S+  C  ++ PV  YD +       S+++ I     E  PI   +L
Sbjct: 2   KSIIKLALSIALNASILGCATYSQPVRFYDASSCEYRITSLRQDIHTCYGEAFPIEYAVL 61

Query: 69  ---NSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGI 122
               S+D I R    +++ L G  W  +  R I +  +A+  NN    T VK  Q +
Sbjct: 62  VAAQSDDQIFRG---QLKTLAGFDWEHE--RAILITALASKANNDGYHTDVKTAQDV 113


>gi|239787373|emb|CAX83849.1| ABC-type uncharacterized transport system, auxiliary component
           [uncultured bacterium]
          Length = 196

 Score = 37.0 bits (84), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 23/107 (21%), Positives = 48/107 (44%), Gaps = 1/107 (0%)

Query: 90  WSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFEINIDRHC-AIITM 148
           W++   RM+Q  L+ +  +    S V+     +   + +   +  FE  +      +I  
Sbjct: 83  WTEAPGRMLQQHLVKSLNDAKAASQVLTDEVKVEGVWLLKGRLLHFEQVLGGQPKVVIEA 142

Query: 149 SLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEI 195
            + ++ A D SLV   ++  EE  + D+    + ++ +AF R+S  I
Sbjct: 143 DMTLMKAKDYSLVHHGLYREEEPAQGDSPAAAVDAMQKAFERLSQRI 189


>gi|321461591|gb|EFX72621.1| hypothetical protein DAPPUDRAFT_110456 [Daphnia pulex]
          Length = 162

 Score = 36.6 bits (83), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 29/110 (26%), Positives = 50/110 (45%), Gaps = 14/110 (12%)

Query: 85  LIGSQWSDKLPRMIQLKLIANFEN-----------NGKISTVVKPNQGIYADYQIISAIR 133
           L+ S++   L R   L+  +N EN           N K   +    Q IY D+  + A  
Sbjct: 39  LMASKYGSSLYRAFLLREFSN-ENLEFWLAVEEYKNSKPQKMAAKAQQIYNDFVAVQA-- 95

Query: 134 SFEINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQS 183
           S E+N+D    +IT++    N  D  +  +    ++  +E+D+ L F+QS
Sbjct: 96  SKEVNLDSETRLITLTNVQSNNPDQHVFDRAQRRIQHMMERDSYLRFLQS 145


>gi|332187462|ref|ZP_08389200.1| hypothetical protein SUS17_2543 [Sphingomonas sp. S17]
 gi|332012623|gb|EGI54690.1| hypothetical protein SUS17_2543 [Sphingomonas sp. S17]
          Length = 186

 Score = 36.6 bits (83), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 30/180 (16%), Positives = 79/180 (43%), Gaps = 9/180 (5%)

Query: 26  LSSC--FFHNNPVNIYDL----TESTKYDESVQRHIQLIITEPITEKILNSEDIIVRSSP 79
           L+ C  F    P ++  L      +    +   R   + I  P T + L +  + V+ + 
Sbjct: 6   LAGCISFGAKPPPSLMTLQAQSAPTVGQTQDSARAKSITIQVPTTPQELATARVPVQENA 65

Query: 80  IEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIY-ADYQIISAIRSFEIN 138
             I Y+  +QW++   R+   +L+++     +   V+   + +  +  ++   +R F ++
Sbjct: 66  TSIAYVKDAQWAEPPARLF-ARLVSDTLTAREGRVVLSARESVVDSGDRLAGELRQFGMD 124

Query: 139 IDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEIIDW 198
             RH A++     ++  +  + + ++ F     + K +      +LN+A ++++ ++ DW
Sbjct: 125 AVRHDAVVIFDASLMR-NGQTAIEKRRFEARVPVGKIDAQSVGPALNQAANQVAQQVADW 183


>gi|84387809|ref|ZP_00990824.1| hypothetical protein V12B01_07448 [Vibrio splendidus 12B01]
 gi|84377324|gb|EAP94192.1| hypothetical protein V12B01_07448 [Vibrio splendidus 12B01]
          Length = 164

 Score = 36.6 bits (83), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 29/90 (32%), Positives = 45/90 (50%), Gaps = 17/90 (18%)

Query: 35  PVNIYDLTESTK--YDESVQRHIQLIITEPITEK--ILNSEDIIVRSSPIEIQYLIGSQW 90
           P     LT+  K  Y E+   H QL+  + I  K  +L+ +  I+R S  +I Y IGSQ 
Sbjct: 85  PATFSQLTDDGKTLYGEADDLHYQLVADKLIMTKNAMLSQDGSIIRGS--KITYQIGSQ- 141

Query: 91  SDKLPRMIQLKLIANFENNGKISTVVKPNQ 120
                     KL+A+   N ++STV++P +
Sbjct: 142 ----------KLVADSGENKRVSTVLQPTE 161


>gi|148977772|ref|ZP_01814328.1| hypothetical protein VSWAT3_21295 [Vibrionales bacterium SWAT-3]
 gi|145962986|gb|EDK28256.1| hypothetical protein VSWAT3_21295 [Vibrionales bacterium SWAT-3]
          Length = 164

 Score = 36.6 bits (83), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 29/90 (32%), Positives = 45/90 (50%), Gaps = 17/90 (18%)

Query: 35  PVNIYDLTESTK--YDESVQRHIQLIITEPITEK--ILNSEDIIVRSSPIEIQYLIGSQW 90
           P     LT+  K  Y E+   H QL+  + I  K  +L+ +  I+R S  +I Y IGSQ 
Sbjct: 85  PATFSQLTDDGKTLYGEADDLHYQLVADKLIMTKNAMLSQDGSIIRGS--KITYQIGSQ- 141

Query: 91  SDKLPRMIQLKLIANFENNGKISTVVKPNQ 120
                     KL+A+   N ++STV++P +
Sbjct: 142 ----------KLVADSGENKRVSTVLQPTE 161


>gi|308272471|emb|CBX29075.1| hypothetical protein N47_J00560 [uncultured Desulfobacterium sp.]
          Length = 200

 Score = 36.2 bits (82), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 28/144 (19%), Positives = 59/144 (40%), Gaps = 6/144 (4%)

Query: 67  ILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADY 126
           + NS+ I  R +  +    +  +W     R++   L  + +N+G    V     G  A +
Sbjct: 53  LYNSDKISYRKNDFQTDEYLYHRWETDPARLVSYFLFRDIKNSGLFKGVFTYEAGFPATH 112

Query: 127 QIISAIRSFEINIDRHCAIITMSLKIINAHDNS------LVGQKVFHVEEKLEKDNKLHF 180
            +   +  F  +         +SL I+   +N       ++ QK +   ++  K N    
Sbjct: 113 SVSGTVDEFFEDDRGKTWEAVLSLDIVLMAENEPDLSKKILFQKKYSTRKECAKKNPKAL 172

Query: 181 IQSLNRAFSRISSEIIDWTLSSLP 204
            +++++A   +S +II+    SLP
Sbjct: 173 AEAMSKAMQELSGQIINDIYKSLP 196


>gi|255553538|ref|XP_002517810.1| conserved hypothetical protein [Ricinus communis]
 gi|223543082|gb|EEF44617.1| conserved hypothetical protein [Ricinus communis]
          Length = 1025

 Score = 35.8 bits (81), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 38/150 (25%), Positives = 64/150 (42%), Gaps = 23/150 (15%)

Query: 33  NNPVNIYDLTESTKYDESVQRHIQLIITEPITEKILNSEDII-VRSSPIEIQYLIGSQWS 91
           NNP  +  L  S     +V+RH   I TE IT   L  + ++ +R +  +I  L+ S W+
Sbjct: 581 NNPSMLNRLKSSYSRAYTVKRHTSPITTEEITRSSLGKKQVMSLRLNSHQITLLLSSIWA 640

Query: 92  DKLPRMIQLKLIANFENNGKISTVV--------KPNQGIYADYQIISAIRSFEIN----- 138
             L     L   AN+E      ++V          N+ +   +Q+  ++RSF I      
Sbjct: 641 QSLS---PLNTPANYEAIAHTYSLVLLFARTKNSSNETLIRSFQLAFSLRSFAIGGGPLQ 697

Query: 139 IDRHCAIITMSLKIINAHDNSLVGQKVFHV 168
             R  ++ T+S  +I      L   K F++
Sbjct: 698 PSRRRSLFTLSTSMI------LFSSKAFNI 721


>gi|254292869|ref|YP_003058892.1| hypothetical protein Hbal_0493 [Hirschia baltica ATCC 49814]
 gi|254041400|gb|ACT58195.1| hypothetical protein Hbal_0493 [Hirschia baltica ATCC 49814]
          Length = 255

 Score = 35.4 bits (80), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 23/120 (19%), Positives = 50/120 (41%)

Query: 82  IQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFEINIDR 141
           IQY+   +W+D   R+ Q  ++     +      V    G   +Y +  +I    ++ ++
Sbjct: 80  IQYINDVRWADSPARLFQAAVVDALTVSEGDGLAVPVQVGARGEYDLRLSILDLTVDNEK 139

Query: 142 HCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEIIDWTLS 201
             A+  + + +  + D S++   V    E LE    +   ++L RA S  +    D+  +
Sbjct: 140 EEAVCKVRVVLTRSGDKSIIASDVLQAVELLENKKSVDRAEALARAISNAAEITADFVAT 199


>gi|301111053|ref|XP_002904606.1| conserved hypothetical protein [Phytophthora infestans T30-4]
 gi|262095923|gb|EEY53975.1| conserved hypothetical protein [Phytophthora infestans T30-4]
          Length = 4063

 Score = 35.4 bits (80), Expect = 5.4,   Method: Composition-based stats.
 Identities = 20/65 (30%), Positives = 38/65 (58%), Gaps = 6/65 (9%)

Query: 21   LLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIITEPITEKILNSEDI---IVRS 77
            ++C S S  FFH +P  I   T ST+  E +  +  ++ T+P+T K L+ + +   +++S
Sbjct: 3756 VVCHSSSGSFFHRSPSTI---TVSTRKVEPLGGYSLVLTTQPLTRKPLDKDAVQLLLLKS 3812

Query: 78   SPIEI 82
            +P E+
Sbjct: 3813 TPSEL 3817


>gi|149190589|ref|ZP_01868858.1| hypothetical protein VSAK1_01949 [Vibrio shilonii AK1]
 gi|148835587|gb|EDL52555.1| hypothetical protein VSAK1_01949 [Vibrio shilonii AK1]
          Length = 165

 Score = 35.0 bits (79), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 28/81 (34%), Positives = 43/81 (53%), Gaps = 21/81 (25%)

Query: 45  TKYDESVQRHI-----QLIITEPITEKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQ 99
           T Y E+ Q H      QL +T    + +L+ +D I+R S I+  Y I SQ          
Sbjct: 97  TLYGEAKQLHYSLKNDQLTMT---NKAMLSQDDSIIRGSVIK--YRISSQ---------- 141

Query: 100 LKLIANFENNGKISTVVKPNQ 120
            KLIA+ ++ G++STV++P Q
Sbjct: 142 -KLIADGDSKGRVSTVLQPQQ 161


>gi|28210240|ref|NP_781184.1| internalin A-like protein/putative S-layer protein [Clostridium
           tetani E88]
 gi|28202676|gb|AAO35121.1| internalin A-like protein/putative S-layer protein [Clostridium
           tetani E88]
          Length = 706

 Score = 35.0 bits (79), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 34/106 (32%), Positives = 54/106 (50%), Gaps = 17/106 (16%)

Query: 4   KLNKIIKKKIISCSLAVLLCTSLSSCF--------FHNNPVNIYDLTESTKY-DESVQRH 54
           K N + KKKI    L   L T++   F        F N+ V+ YDL E  K+ D+++++ 
Sbjct: 14  KANFMRKKKITIILLTAFLTTTIVPAFGVTMQGNNFINSKVHAYDLEEGIKFPDKALEKV 73

Query: 55  IQLIITEPIT--EK--ILNSEDIIVRSSPIE----IQYLIGSQWSD 92
           I+  I +P+   EK  + N  ++ +R+  I+    IQYL G Q  D
Sbjct: 74  IREKINKPVGPIEKSDLSNISELDIRNKAIKSIEGIQYLTGLQTID 119


>gi|307720551|ref|YP_003891691.1| hypothetical protein Saut_0630 [Sulfurimonas autotrophica DSM
           16294]
 gi|306978644|gb|ADN08679.1| conserved hypothetical protein [Sulfurimonas autotrophica DSM
           16294]
          Length = 205

 Score = 34.7 bits (78), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 16/53 (30%), Positives = 27/53 (50%)

Query: 146 ITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEIIDW 198
           I  +  +IN   + +V  K FH +EK   +N L  +++L  A ++I  E   W
Sbjct: 145 IAFTCSLINTATHKIVATKTFHAKEKTSSNNALGGVKALESALNKILKECGLW 197


Searching..................................................done


Results from round 2




>gi|254780141|ref|YP_003064554.1| putative ABC transporter protein [Candidatus Liberibacter asiaticus
           str. psy62]
 gi|254039818|gb|ACT56614.1| putative ABC transporter protein [Candidatus Liberibacter asiaticus
           str. psy62]
          Length = 208

 Score =  253 bits (646), Expect = 1e-65,   Method: Composition-based stats.
 Identities = 208/208 (100%), Positives = 208/208 (100%)

Query: 1   MDKKLNKIIKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIIT 60
           MDKKLNKIIKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIIT
Sbjct: 1   MDKKLNKIIKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIIT 60

Query: 61  EPITEKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQ 120
           EPITEKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQ
Sbjct: 61  EPITEKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQ 120

Query: 121 GIYADYQIISAIRSFEINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHF 180
           GIYADYQIISAIRSFEINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHF
Sbjct: 121 GIYADYQIISAIRSFEINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHF 180

Query: 181 IQSLNRAFSRISSEIIDWTLSSLPLSDN 208
           IQSLNRAFSRISSEIIDWTLSSLPLSDN
Sbjct: 181 IQSLNRAFSRISSEIIDWTLSSLPLSDN 208


>gi|315122743|ref|YP_004063232.1| putative ABC transporter protein [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313496145|gb|ADR52744.1| putative ABC transporter protein [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 202

 Score =  215 bits (548), Expect = 3e-54,   Method: Composition-based stats.
 Identities = 139/204 (68%), Positives = 169/204 (82%), Gaps = 2/204 (0%)

Query: 1   MDKKLNKIIKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIIT 60
           MDKKL KI K   + C  A+ LC  LSSCF  N P NI+DLTESTK+++S+Q +++L I 
Sbjct: 1   MDKKLKKITKNMRL-CIPAISLCMFLSSCF-GNIPKNIFDLTESTKHNQSIQHNVRLTIN 58

Query: 61  EPITEKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQ 120
           EP+T K L+S DIIVRSSP+EIQYLIGSQWSD+LPRM+QLKLIANFENNGKIST++KPNQ
Sbjct: 59  EPVTSKTLDSPDIIVRSSPVEIQYLIGSQWSDRLPRMVQLKLIANFENNGKISTIIKPNQ 118

Query: 121 GIYADYQIISAIRSFEINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHF 180
           GIY +YQI S IR+FEI+I  H AII +SLKII+ +  +++ QKVFHVEE  E+DNKL F
Sbjct: 119 GIYPNYQISSIIRAFEIDIHHHYAIIEISLKIIDINTGNIIAQKVFHVEEAFEEDNKLCF 178

Query: 181 IQSLNRAFSRISSEIIDWTLSSLP 204
           I+SLNRAFSRISSEII+WT+SSLP
Sbjct: 179 IESLNRAFSRISSEIINWTVSSLP 202


>gi|116252404|ref|YP_768242.1| hypothetical protein RL2658 [Rhizobium leguminosarum bv. viciae
           3841]
 gi|115257052|emb|CAK08146.1| conserved hypothetical protein [Rhizobium leguminosarum bv. viciae
           3841]
          Length = 203

 Score =  209 bits (531), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 79/196 (40%), Positives = 116/196 (59%), Gaps = 6/196 (3%)

Query: 9   IKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIITEPITEKIL 68
           I+  +I+  L  L+   LS C       + YDL  +        +  Q++I  P   + L
Sbjct: 13  IRGTVIALPLTALI---LSGCGTAAK-NDTYDLPAAVDGSGPAAKSRQILIASPTALRSL 68

Query: 69  NSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQI 128
           +SE I++R SP EIQYL  +QW DKLPR++Q KL+  FEN+GK+  V  P QG+  DYQI
Sbjct: 69  DSEQIVIRVSPSEIQYLSKAQWGDKLPRIVQSKLVEAFENSGKLGGVGMPGQGLAIDYQI 128

Query: 129 ISAIRSFEINID-RHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRA 187
           ++ IRSFEI+    + A++ +S KI+N  + S+  QKVF        DN   F++ L+RA
Sbjct: 129 VTDIRSFEIDASHGNQAVVEISAKILNDRNGSVRAQKVFRAMAPAGGDN-DGFVKGLDRA 187

Query: 188 FSRISSEIIDWTLSSL 203
           FS ++SEI+ WTL S+
Sbjct: 188 FSTVASEIVSWTLRSI 203


>gi|241204912|ref|YP_002976008.1| hypothetical protein Rleg_2192 [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240858802|gb|ACS56469.1| protein of unknown function DUF330 [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 203

 Score =  207 bits (526), Expect = 9e-52,   Method: Composition-based stats.
 Identities = 79/196 (40%), Positives = 116/196 (59%), Gaps = 6/196 (3%)

Query: 9   IKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIITEPITEKIL 68
           I+  +I+  L  L+   LS C       + YDL  +        +  Q++I  P   + L
Sbjct: 13  IRGTVIALPLTALI---LSGCGTAAK-NDTYDLPAAVDGSGPAAKSRQILIASPTALRSL 68

Query: 69  NSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQI 128
           +SE I++R SP EIQYL  +QW DKLPR++Q KL+  FEN+GK+  V  P QG+  DYQI
Sbjct: 69  DSEQIVIRVSPSEIQYLSKAQWGDKLPRIVQSKLVEAFENSGKLGGVGMPGQGLAIDYQI 128

Query: 129 ISAIRSFEINID-RHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRA 187
           ++ IRSFEI+    + A++ +S KI+N  + S+  QKVF        DN   F++ L+RA
Sbjct: 129 VTDIRSFEIDASRGNQAVVEISAKILNDRNGSVRAQKVFRAMAPAGGDN-DGFVKGLDRA 187

Query: 188 FSRISSEIIDWTLSSL 203
           FS ++SEI+ WTL S+
Sbjct: 188 FSTVASEIVTWTLRSI 203


>gi|86357961|ref|YP_469853.1| putative ABC transporter protein [Rhizobium etli CFN 42]
 gi|86282063|gb|ABC91126.1| putative ABC transporter protein [Rhizobium etli CFN 42]
          Length = 203

 Score =  204 bits (520), Expect = 5e-51,   Method: Composition-based stats.
 Identities = 79/196 (40%), Positives = 117/196 (59%), Gaps = 6/196 (3%)

Query: 9   IKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIITEPITEKIL 68
           I+  +I+  L  L+   LS C       + YDL+ +   D    +  Q++I  P   + L
Sbjct: 13  IRGTVIALPLTALI---LSGCGTAAK-NDTYDLSGAVDGDGPAAKSRQILIAGPTALRAL 68

Query: 69  NSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQI 128
           +SE I++R SP EIQYL  +QW DKLPR++Q KL+  FEN+GK+  V  P QG+  DYQI
Sbjct: 69  DSEQIVIRVSPSEIQYLSRAQWGDKLPRIVQSKLVEAFENSGKLGGVGMPGQGLAIDYQI 128

Query: 129 ISAIRSFEINID-RHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRA 187
           ++ IRSFEI+    + A++ +S KI+N  + S+  QKVF        DN   F++ L+RA
Sbjct: 129 VTDIRSFEIDASNGNQAVVEISAKILNDRNGSVRAQKVFRAMAPAGGDNV-GFVKGLDRA 187

Query: 188 FSRISSEIIDWTLSSL 203
           F+ + SEI+ WTL S+
Sbjct: 188 FAAVVSEIVSWTLRSI 203


>gi|218461268|ref|ZP_03501359.1| putative ABC transporter protein [Rhizobium etli Kim 5]
          Length = 203

 Score =  204 bits (520), Expect = 6e-51,   Method: Composition-based stats.
 Identities = 78/196 (39%), Positives = 117/196 (59%), Gaps = 6/196 (3%)

Query: 9   IKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIITEPITEKIL 68
           I+  +I+  L  L+   LS C       + YDL  +   D    +  Q++I  P   K L
Sbjct: 13  IRGTVIALPLTALI---LSGCGTAAK-NDTYDLAGAVDGDGPAAKTRQILIAGPTALKAL 68

Query: 69  NSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQI 128
           +SE I++R SP EIQYL  +QW D+LPR++Q KL+  FEN+GK+  V  P QG+  DYQI
Sbjct: 69  DSEQIVIRVSPSEIQYLSRAQWGDRLPRIVQSKLVEAFENSGKVGGVGMPGQGLAIDYQI 128

Query: 129 ISAIRSFEINID-RHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRA 187
           ++ IRSFEI+    + A++ +S KI+N  + ++  QKVF        DN   F++ L+RA
Sbjct: 129 VTDIRSFEIDASNGNQAVVEISAKILNDRNGTVRAQKVFRAMAPAGGDNV-AFVKGLDRA 187

Query: 188 FSRISSEIIDWTLSSL 203
           F+ + SEI++WTL S+
Sbjct: 188 FAAVVSEIVNWTLRSI 203


>gi|209549575|ref|YP_002281492.1| ABC transporter [Rhizobium leguminosarum bv. trifolii WSM2304]
 gi|209535331|gb|ACI55266.1| putative ABC transporter protein [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 203

 Score =  203 bits (517), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 79/196 (40%), Positives = 116/196 (59%), Gaps = 6/196 (3%)

Query: 9   IKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIITEPITEKIL 68
           I+  +I+  L  L+   LS C       + YDL+ +   D    +  Q++I  P     +
Sbjct: 13  IRGTVIALPLTALI---LSGCGTAAK-NDTYDLSAAVDGDGPAAKSRQILIASPTALNAV 68

Query: 69  NSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQI 128
            SE I++R SP EIQYL  +QW DKLPRM+Q KL+  FEN+GK+  V  P QG+  DYQ+
Sbjct: 69  GSEQIVIRVSPSEIQYLSRAQWGDKLPRMVQSKLVEAFENSGKLGGVGIPGQGLAIDYQV 128

Query: 129 ISAIRSFEINID-RHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRA 187
           ++ IRSFEI+    + A++ +S KI+N  + S+  QKVF        DN   F++ L+RA
Sbjct: 129 VTDIRSFEIDASNGNQAVVEISAKILNDRNGSVRAQKVFRAVAPAGGDN-AGFVKGLDRA 187

Query: 188 FSRISSEIIDWTLSSL 203
           FS + SEI++WTL S+
Sbjct: 188 FSTVVSEIVNWTLRSI 203


>gi|239831968|ref|ZP_04680297.1| lipoprotein [Ochrobactrum intermedium LMG 3301]
 gi|239824235|gb|EEQ95803.1| lipoprotein [Ochrobactrum intermedium LMG 3301]
          Length = 209

 Score =  203 bits (517), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 54/204 (26%), Positives = 113/204 (55%), Gaps = 6/204 (2%)

Query: 5   LNKIIKKKII--SCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQR-HIQLIITE 61
            N +  ++++  + S+  +    L+ C     P++ ++L+       S  R ++QL++  
Sbjct: 7   FNDMKSRRVVLRTASVPFIFGLLLAGCGT-TTPLDTFNLSAPQPGVTSPSRKNVQLLVPT 65

Query: 62  PITEKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQG 121
           P   K L+SE+I+V S+P  I+YL G+QW D+L  ++Q +L+  +EN G    + +P  G
Sbjct: 66  PTALKALDSENIVVSSAPGSIEYLKGAQWGDRLTNIVQSRLVQAYENTGIFGGIGRPGDG 125

Query: 122 IYADYQIISAIRSFEIN--IDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLH 179
           +  +YQI++ +R F I        A++ ++++++N  +  +   +VF     +       
Sbjct: 126 LAINYQILTDLRMFGIQAYASPKLAVVELAVRLMNDKNGEVRATRVFRTAIPVGGATNAA 185

Query: 180 FIQSLNRAFSRISSEIIDWTLSSL 203
           ++++L+ AF R +SEI+ WT+++L
Sbjct: 186 YVKALDAAFERTASEIVSWTVTTL 209


>gi|153009440|ref|YP_001370655.1| lipoprotein [Ochrobactrum anthropi ATCC 49188]
 gi|151561328|gb|ABS14826.1| lipoprotein, hypothetical [Ochrobactrum anthropi ATCC 49188]
          Length = 209

 Score =  203 bits (516), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 57/197 (28%), Positives = 109/197 (55%), Gaps = 4/197 (2%)

Query: 10  KKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQR-HIQLIITEPITEKIL 68
           +    + S+ VLL   L+ C     P++ ++L+       S  R + QL++  P   K L
Sbjct: 14  RTLCRTTSICVLLSILLAGCGT-TTPLDTFNLSAPQPGVSSPSRKNTQLLVPTPTALKAL 72

Query: 69  NSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQI 128
           +SE+I+V S+P  I+YL G+QW D+L  ++Q +L+  +EN G    + +P  G+  +YQI
Sbjct: 73  DSENIVVSSAPGSIEYLKGAQWGDRLTNIVQSRLVQAYENTGVFGGIGRPGDGLAINYQI 132

Query: 129 ISAIRSFEIN--IDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNR 186
           ++ +R F I        A++ +++K++N  +  +   +VF     +       ++++L+ 
Sbjct: 133 LTDLRMFGIQAYASPKLAVVELAVKLMNDKNGEVRATRVFRTAIPVSGATNAAYVKALDA 192

Query: 187 AFSRISSEIIDWTLSSL 203
           AF R +SEI+ WT+++L
Sbjct: 193 AFERTASEIVSWTVTAL 209


>gi|327190643|gb|EGE57731.1| putative ABC transporter protein [Rhizobium etli CNPAF512]
          Length = 203

 Score =  203 bits (516), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 79/196 (40%), Positives = 119/196 (60%), Gaps = 6/196 (3%)

Query: 9   IKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIITEPITEKIL 68
           I+  +I+  L  L+   LS C       + +DL+ +   D    +  Q+++  P   + L
Sbjct: 13  IRGTVIALPLTALI---LSGCGTAAK-NDTFDLSGAVDGDGPAAKSRQILVAGPTALRAL 68

Query: 69  NSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQI 128
           +SE I++R SP EIQYL  +QW DKLPRM+Q KL+  FEN+GK+  V  P QG+  DYQ+
Sbjct: 69  DSEQIVIRVSPSEIQYLSRAQWGDKLPRMVQSKLVEAFENSGKLGGVGLPGQGLAIDYQV 128

Query: 129 ISAIRSFEINI-DRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRA 187
           ++ IRSFEI+    + A++ +S+KI+N  + S+  QKVF        DN   F++SL+RA
Sbjct: 129 VTDIRSFEIDASSGNQAVVEISVKILNDRNGSVRAQKVFRATAPAGGDN-AGFVKSLDRA 187

Query: 188 FSRISSEIIDWTLSSL 203
           FS + SEI+ WTL S+
Sbjct: 188 FSTVVSEIVSWTLRSI 203


>gi|306838382|ref|ZP_07471227.1| lipoprotein [Brucella sp. NF 2653]
 gi|306406522|gb|EFM62756.1| lipoprotein [Brucella sp. NF 2653]
          Length = 209

 Score =  202 bits (514), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 56/205 (27%), Positives = 115/205 (56%), Gaps = 7/205 (3%)

Query: 2   DKKLNKIIKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTK-YDESVQRHIQLIIT 60
           D K  ++ + +    S+AVLL   L+ C     P++ ++L+          ++++QL+I 
Sbjct: 9   DMKSRRMFRHRG---SVAVLLTAFLAGCGT-TTPLDTFNLSTPQPMVTVPKRKNLQLLIP 64

Query: 61  EPITEKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQ 120
            P   K L+SE+I+V S+P  I+YL G+QW D+L  ++Q +L+  +EN G    + +P  
Sbjct: 65  GPAALKALDSENIVVSSAPGSIEYLKGAQWGDRLTNIVQSRLVQAYENTGAFGGIGRPGD 124

Query: 121 GIYADYQIISAIRSFEIN--IDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKL 178
           G+  +YQ+++ +R F I        A++ M++++++     +   +VF     +   +  
Sbjct: 125 GLAINYQVLTDLRMFGIQAYTSPQTAVVEMAVRLLSDKTGEVRATRVFRTAIPVTGTSNA 184

Query: 179 HFIQSLNRAFSRISSEIIDWTLSSL 203
            ++++L++AF +  +EI+ WT+S+L
Sbjct: 185 AYVKALDKAFDQTVNEIVSWTISTL 209


>gi|218670693|ref|ZP_03520364.1| putative ABC transporter protein [Rhizobium etli GR56]
          Length = 203

 Score =  202 bits (514), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 77/196 (39%), Positives = 117/196 (59%), Gaps = 6/196 (3%)

Query: 9   IKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIITEPITEKIL 68
           I+  +I+  L  L+   LS C       + YDL  +   D    +  Q++I  P   + L
Sbjct: 13  IRGTVIALPLTALI---LSGCGTAAK-NDTYDLAGTVDGDGPAAKSRQILIAGPTALRSL 68

Query: 69  NSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQI 128
           +SE I++R SP EIQYL  +QW DKLPR++Q KL+  FEN+GK+  V  P QG+  DYQ+
Sbjct: 69  DSEQIVIRVSPSEIQYLSRAQWGDKLPRIVQSKLVEAFENSGKLGGVGLPGQGLAIDYQV 128

Query: 129 ISAIRSFEINI-DRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRA 187
           ++ IRSFEI+    + A++ +S+K++N  + S+  QKVF        DN   F+++L+ A
Sbjct: 129 VTDIRSFEIDASSGNQAVVEISVKLLNDRNGSVRAQKVFRAMAPAGGDNV-GFVKALDHA 187

Query: 188 FSRISSEIIDWTLSSL 203
           FS + SEI+ WTL S+
Sbjct: 188 FSIVVSEIVSWTLRSI 203


>gi|190892032|ref|YP_001978574.1| putative ABC transporter protein [Rhizobium etli CIAT 652]
 gi|190697311|gb|ACE91396.1| putative ABC transporter protein [Rhizobium etli CIAT 652]
          Length = 203

 Score =  202 bits (513), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 79/196 (40%), Positives = 119/196 (60%), Gaps = 6/196 (3%)

Query: 9   IKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIITEPITEKIL 68
           I+  +I+  L  L+   LS C       + +DL+ +   D    +  Q+++  P   + L
Sbjct: 13  IRGTVIALPLTALI---LSGCGAAAK-NDTFDLSGAVDGDGPAAKSRQILVAGPTALRAL 68

Query: 69  NSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQI 128
           +SE I++R SP EIQYL  +QW DKLPRM+Q KL+  FEN+GK+  V  P QG+  DYQ+
Sbjct: 69  DSEQIVIRVSPSEIQYLSRAQWGDKLPRMVQSKLVEAFENSGKLGGVGLPGQGLAIDYQV 128

Query: 129 ISAIRSFEINI-DRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRA 187
           ++ IRSFEI+    + A++ +S+KI+N  + S+  QKVF        DN   F++SL+RA
Sbjct: 129 VTDIRSFEIDASSGNQAVVEISVKILNDRNGSVRAQKVFRATAPAGGDN-AGFVKSLDRA 187

Query: 188 FSRISSEIIDWTLSSL 203
           FS + SEI+ WTL S+
Sbjct: 188 FSTVVSEIVSWTLRSI 203


>gi|306843896|ref|ZP_07476491.1| lipoprotein [Brucella sp. BO1]
 gi|306275651|gb|EFM57375.1| lipoprotein [Brucella sp. BO1]
          Length = 209

 Score =  202 bits (513), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 55/205 (26%), Positives = 115/205 (56%), Gaps = 7/205 (3%)

Query: 2   DKKLNKIIKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTK-YDESVQRHIQLIIT 60
           D K  ++ + +    S+A+LL   L+ C     P++ ++L+          ++++QL+I 
Sbjct: 9   DMKSRRMFRHRG---SVAILLTAFLAGCGT-TTPLDTFNLSTPQPMVTVPKRKNLQLLIP 64

Query: 61  EPITEKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQ 120
            P   K L+SE+I+V S+P  I+YL G+QW D+L  ++Q +L+  +EN G    + +P  
Sbjct: 65  GPAALKALDSENIVVSSAPGSIEYLKGAQWGDRLTNIVQSRLVQAYENTGAFGGIGRPGD 124

Query: 121 GIYADYQIISAIRSFEIN--IDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKL 178
           G+  +YQ+++ +R F I        A++ M++++++     +   +VF     +   +  
Sbjct: 125 GLAINYQVLTDLRMFGIQAYTSPQTAVVEMAVRLLSDKTGEVRATRVFRTAIPVTGTSNA 184

Query: 179 HFIQSLNRAFSRISSEIIDWTLSSL 203
            ++++L++AF +  +EI+ WT+S+L
Sbjct: 185 AYVKALDKAFDQTVNEIVSWTISTL 209


>gi|254719098|ref|ZP_05180909.1| hypothetical protein Bru83_06095 [Brucella sp. 83/13]
 gi|265984089|ref|ZP_06096824.1| lipoprotein [Brucella sp. 83/13]
 gi|264662681|gb|EEZ32942.1| lipoprotein [Brucella sp. 83/13]
          Length = 200

 Score =  199 bits (507), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 55/203 (27%), Positives = 114/203 (56%), Gaps = 7/203 (3%)

Query: 4   KLNKIIKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTK-YDESVQRHIQLIITEP 62
           K  ++ + +    S+AVLL   L+ C     P++ ++L+          ++++QL+I  P
Sbjct: 2   KSRRMFRHRG---SVAVLLTAFLAGCGT-TTPLDTFNLSTPQPMVTVPKRKNLQLLIPGP 57

Query: 63  ITEKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGI 122
              K L+SE+I+V S+P  I+YL G+QW D+L  ++Q +L+  +EN G    + +P  G+
Sbjct: 58  AALKALDSENIVVSSAPGSIEYLKGAQWGDRLTNIVQSRLVQAYENTGAFGGIGRPGDGL 117

Query: 123 YADYQIISAIRSFEIN--IDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHF 180
             +YQ+++ +R F I        A++ M++++++     +   +VF     +   +   +
Sbjct: 118 AINYQVLTDLRMFGIQAYTSPQTAVVEMAVRLLSDKTGEVRATRVFRTAIPVTGTSNAAY 177

Query: 181 IQSLNRAFSRISSEIIDWTLSSL 203
           +++L++AF +  +EI+ WT+S+L
Sbjct: 178 VKALDKAFDQTVNEIVSWTISTL 200


>gi|189024188|ref|YP_001934956.1| Protein of unknown function DUF330 [Brucella abortus S19]
 gi|237815446|ref|ZP_04594444.1| Protein of unknown function DUF330 [Brucella abortus str. 2308 A]
 gi|260545306|ref|ZP_05821047.1| lipoprotein [Brucella abortus NCTC 8038]
 gi|260564027|ref|ZP_05834513.1| lipoprotein [Brucella melitensis bv. 1 str. 16M]
 gi|260566438|ref|ZP_05836908.1| lipoprotein [Brucella suis bv. 4 str. 40]
 gi|260754758|ref|ZP_05867106.1| lipoprotein [Brucella abortus bv. 6 str. 870]
 gi|260757981|ref|ZP_05870329.1| lipoprotein [Brucella abortus bv. 4 str. 292]
 gi|260761804|ref|ZP_05874147.1| lipoprotein [Brucella abortus bv. 2 str. 86/8/59]
 gi|260883778|ref|ZP_05895392.1| lipoprotein [Brucella abortus bv. 9 str. C68]
 gi|261214010|ref|ZP_05928291.1| lipoprotein [Brucella abortus bv. 3 str. Tulya]
 gi|261218637|ref|ZP_05932918.1| lipoprotein [Brucella ceti M13/05/1]
 gi|261314251|ref|ZP_05953448.1| lipoprotein [Brucella pinnipedialis M163/99/10]
 gi|261321865|ref|ZP_05961062.1| lipoprotein [Brucella ceti M644/93/1]
 gi|261325115|ref|ZP_05964312.1| lipoprotein [Brucella neotomae 5K33]
 gi|261758210|ref|ZP_06001919.1| lipoprotein [Brucella sp. F5/99]
 gi|265991105|ref|ZP_06103662.1| lipoprotein [Brucella melitensis bv. 1 str. Rev.1]
 gi|265994942|ref|ZP_06107499.1| lipoprotein [Brucella melitensis bv. 3 str. Ether]
 gi|265998155|ref|ZP_06110712.1| lipoprotein [Brucella ceti M490/95/1]
 gi|265999468|ref|ZP_05466515.2| lipoprotein [Brucella melitensis bv. 2 str. 63/9]
 gi|297248346|ref|ZP_06932064.1| conserved hypothetical protein [Brucella abortus bv. 5 str. B3196]
 gi|189019760|gb|ACD72482.1| Protein of unknown function DUF330 [Brucella abortus S19]
 gi|237790283|gb|EEP64493.1| Protein of unknown function DUF330 [Brucella abortus str. 2308 A]
 gi|260096713|gb|EEW80588.1| lipoprotein [Brucella abortus NCTC 8038]
 gi|260154043|gb|EEW89135.1| lipoprotein [Brucella melitensis bv. 1 str. 16M]
 gi|260155956|gb|EEW91036.1| lipoprotein [Brucella suis bv. 4 str. 40]
 gi|260668299|gb|EEX55239.1| lipoprotein [Brucella abortus bv. 4 str. 292]
 gi|260672236|gb|EEX59057.1| lipoprotein [Brucella abortus bv. 2 str. 86/8/59]
 gi|260674866|gb|EEX61687.1| lipoprotein [Brucella abortus bv. 6 str. 870]
 gi|260873306|gb|EEX80375.1| lipoprotein [Brucella abortus bv. 9 str. C68]
 gi|260915617|gb|EEX82478.1| lipoprotein [Brucella abortus bv. 3 str. Tulya]
 gi|260923726|gb|EEX90294.1| lipoprotein [Brucella ceti M13/05/1]
 gi|261294555|gb|EEX98051.1| lipoprotein [Brucella ceti M644/93/1]
 gi|261301095|gb|EEY04592.1| lipoprotein [Brucella neotomae 5K33]
 gi|261303277|gb|EEY06774.1| lipoprotein [Brucella pinnipedialis M163/99/10]
 gi|261738194|gb|EEY26190.1| lipoprotein [Brucella sp. F5/99]
 gi|262552623|gb|EEZ08613.1| lipoprotein [Brucella ceti M490/95/1]
 gi|262766055|gb|EEZ11844.1| lipoprotein [Brucella melitensis bv. 3 str. Ether]
 gi|263001889|gb|EEZ14464.1| lipoprotein [Brucella melitensis bv. 1 str. Rev.1]
 gi|263094127|gb|EEZ18049.1| lipoprotein [Brucella melitensis bv. 2 str. 63/9]
 gi|297175515|gb|EFH34862.1| conserved hypothetical protein [Brucella abortus bv. 5 str. B3196]
 gi|326409043|gb|ADZ66108.1| conserved hypothetical protein [Brucella melitensis M28]
 gi|326538752|gb|ADZ86967.1| conserved hypothetical protein [Brucella melitensis M5-90]
          Length = 209

 Score =  199 bits (505), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 54/205 (26%), Positives = 114/205 (55%), Gaps = 7/205 (3%)

Query: 2   DKKLNKIIKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTK-YDESVQRHIQLIIT 60
           D K  ++ + +    S+A+LL   L+ C     P++ ++L+          ++++QL+I 
Sbjct: 9   DMKSRRMFRHRG---SVAILLTAFLAGCGT-TTPLDTFNLSTPQPMVTVPKRKNLQLLIP 64

Query: 61  EPITEKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQ 120
            P   K L+SE+I+V S+P  I+YL G+QW D+L  ++Q +L+  +EN      + +P  
Sbjct: 65  GPAALKALDSENIVVSSAPGSIEYLKGAQWGDRLTNIVQSRLVQAYENTSAFGGIGRPGD 124

Query: 121 GIYADYQIISAIRSFEIN--IDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKL 178
           G+  +YQ+++ +R F I        A++ M++++++     +   +VF     +   +  
Sbjct: 125 GLAINYQVLTDLRMFGIQAYTSPQTAVVEMAVRLLSDKTGEVRATRVFRTAIPVTGTSNA 184

Query: 179 HFIQSLNRAFSRISSEIIDWTLSSL 203
            ++++L++AF +  +EI+ WT+S+L
Sbjct: 185 AYVKALDKAFDQTVNEIVSWTISTL 209


>gi|294852387|ref|ZP_06793060.1| hypothetical protein BAZG_01314 [Brucella sp. NVSL 07-0026]
 gi|294820976|gb|EFG37975.1| hypothetical protein BAZG_01314 [Brucella sp. NVSL 07-0026]
          Length = 209

 Score =  199 bits (505), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 54/205 (26%), Positives = 114/205 (55%), Gaps = 7/205 (3%)

Query: 2   DKKLNKIIKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTK-YDESVQRHIQLIIT 60
           D K  ++ + +    S+A+LL   L+ C     P++ ++L+          ++++QL+I 
Sbjct: 9   DMKSRRMFRHRG---SVAILLTAFLAGCGT-TTPLDTFNLSTPQPMVTVPKRKNLQLLIP 64

Query: 61  EPITEKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQ 120
            P   K L+SE+I+V S+P  I+YL G+QW D+L  ++Q +L+  +EN      + +P  
Sbjct: 65  GPAALKALDSENIVVSSAPGSIKYLKGAQWGDRLTNIVQSRLVQAYENTSAFGGIGRPGD 124

Query: 121 GIYADYQIISAIRSFEIN--IDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKL 178
           G+  +YQ+++ +R F I        A++ M++++++     +   +VF     +   +  
Sbjct: 125 GLAINYQVLTDLRMFGIQAYTSPQTAVVEMAVRLLSDKTGEVRATRVFRTAIPVTGTSNA 184

Query: 179 HFIQSLNRAFSRISSEIIDWTLSSL 203
            ++++L++AF +  +EI+ WT+S+L
Sbjct: 185 AYVKALDKAFDQTVNEIVSWTISTL 209


>gi|229587672|ref|YP_002869791.1| putative lipoprotein [Pseudomonas fluorescens SBW25]
 gi|229359538|emb|CAY46379.1| putative lipoprotein [Pseudomonas fluorescens SBW25]
          Length = 203

 Score =  199 bits (505), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 34/196 (17%), Positives = 86/196 (43%), Gaps = 2/196 (1%)

Query: 9   IKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIITEPITEKIL 68
           +K+     +   L   S  S     +P ++Y LT +    +       L + +P T + L
Sbjct: 1   MKRAYQMIAPVALALVSACSILPKADPSDVYRLTSAQTTSQGAPVSWSLRVNKPQTSEFL 60

Query: 69  NSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQI 128
           +S  I V  +   I     S+WSD  P +++ + +  F+ +G+++ +   +  + +DY++
Sbjct: 61  DSPRIAVVPNGDLISSYANSRWSDPSPVLLRNRFMDGFQRDGRVTLLSTDDTNLQSDYEL 120

Query: 129 ISAIRSFEINIDRH--CAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNR 186
              +++F+          +I +  +++   D  +V  + F V + +        +    +
Sbjct: 121 GGQLQAFQSEYRGSAVEVVIRLDARLVRGSDQRIVASRRFEVRQPVSDTKVPAVVAGFGQ 180

Query: 187 AFSRISSEIIDWTLSS 202
           A  +++ +++DW +  
Sbjct: 181 AGDQLNKQVVDWVVQQ 196


>gi|325293031|ref|YP_004278895.1| ABC transporter [Agrobacterium sp. H13-3]
 gi|325060884|gb|ADY64575.1| putative ABC transporter protein [Agrobacterium sp. H13-3]
          Length = 201

 Score =  198 bits (504), Expect = 4e-49,   Method: Composition-based stats.
 Identities = 70/205 (34%), Positives = 121/205 (59%), Gaps = 6/205 (2%)

Query: 1   MDKKLNKIIKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQ--RHIQLI 58
           M + +N   ++ ++   L  +     +         + +DL+ S+         +  QL+
Sbjct: 1   MTRLMNGHKRRALLLVPLLAVAVAGCAGTPS----NDTFDLSVSSATVTQGPSLKGRQLL 56

Query: 59  ITEPITEKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKP 118
           I +P   K L+SE+I+VR S  E+QYL  SQWSD+LPRM+Q KL+  FE+ GK+  V +P
Sbjct: 57  IADPTALKALDSENIVVRLSGSEVQYLGNSQWSDRLPRMVQSKLVQAFEDTGKLGGVGRP 116

Query: 119 NQGIYADYQIISAIRSFEINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKL 178
            QG+  DYQ++S IR+FEI+  ++ A I +S+K++N  + ++  Q+VF    ++      
Sbjct: 117 GQGLAIDYQVVSDIRTFEIDTAKNTADIEISVKLLNDRNGTVKAQEVFRASARVSGSGNA 176

Query: 179 HFIQSLNRAFSRISSEIIDWTLSSL 203
           +F+++L++AF+  + EI+ WTL SL
Sbjct: 177 NFVKALDQAFAAATREIVAWTLKSL 201


>gi|90417912|ref|ZP_01225824.1| conserved hypothetical protein [Aurantimonas manganoxydans
           SI85-9A1]
 gi|90337584|gb|EAS51235.1| conserved hypothetical protein [Aurantimonas manganoxydans
           SI85-9A1]
          Length = 194

 Score =  198 bits (504), Expect = 4e-49,   Method: Composition-based stats.
 Identities = 64/193 (33%), Positives = 115/193 (59%), Gaps = 4/193 (2%)

Query: 11  KKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYD-ESVQRHIQLIITEPITEKILN 69
           +  +  S   LL   LS+C   + P + Y+++     D    +   QL+I EP   + ++
Sbjct: 2   RAALKSSFVALLALGLSAC--ASTPPDTYEISPPPFSDVREGKSRRQLLIPEPTALETID 59

Query: 70  SEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQII 129
           S+ II++ SP  IQ+L  SQWSD+LPR++QL+L+  FEN G I  +  P QG+  DYQ++
Sbjct: 60  SKRIIIKPSPNSIQFLGDSQWSDRLPRLVQLRLLQAFENTGSIGAIGVPGQGLAIDYQLV 119

Query: 130 SAIRSFEINIDR-HCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAF 188
             IR FE+N+     A + +S+K++N  + +++  ++F+ +  +       F+ +L++AF
Sbjct: 120 MEIRRFEVNVTGAATAEVQISVKVLNDRNGTVLRTRIFNAQAPVNGAGNPAFVAALDKAF 179

Query: 189 SRISSEIIDWTLS 201
            ++S+EI+DWT+ 
Sbjct: 180 EQVSAEIVDWTIQ 192


>gi|15888954|ref|NP_354635.1| hypothetical protein Atu1644 [Agrobacterium tumefaciens str. C58]
 gi|15156733|gb|AAK87420.1| conserved hypothetical protein [Agrobacterium tumefaciens str. C58]
          Length = 201

 Score =  197 bits (500), Expect = 9e-49,   Method: Composition-based stats.
 Identities = 72/205 (35%), Positives = 119/205 (58%), Gaps = 6/205 (2%)

Query: 1   MDKKLNKIIKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQ--RHIQLI 58
           M   +N   ++ +    L   L    +         + +DL+ S+         +  QL+
Sbjct: 1   MRLSINGQKRRALFLAPLFAALMAGCAG----APNNDTFDLSVSSAAVTQGPSLKSRQLL 56

Query: 59  ITEPITEKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKP 118
           I +P   K L+SE+I+VR S  E+QYL  SQWSD+LPRM+Q KL+  FE+ GK+  V +P
Sbjct: 57  IADPTALKALDSENIVVRLSGSEVQYLGNSQWSDRLPRMVQSKLVEAFEDTGKLGGVGRP 116

Query: 119 NQGIYADYQIISAIRSFEINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKL 178
            QG+  DYQ++S IR+FEI+  R+ A I +S+K++N  + ++  Q+VF    ++      
Sbjct: 117 GQGLAIDYQVVSDIRAFEIDTARNVANIEISVKLLNDRNGTVKAQEVFRASARVSGSGNA 176

Query: 179 HFIQSLNRAFSRISSEIIDWTLSSL 203
           +F+++L++AF+  + EI+ WTL SL
Sbjct: 177 NFVKALDQAFAAATREIVAWTLKSL 201


>gi|222086197|ref|YP_002544729.1| ABC transporter protein [Agrobacterium radiobacter K84]
 gi|221723645|gb|ACM26801.1| ABC transporter protein [Agrobacterium radiobacter K84]
          Length = 218

 Score =  196 bits (498), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 74/191 (38%), Positives = 111/191 (58%), Gaps = 3/191 (1%)

Query: 15  SCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIITEPITEKILNSEDII 74
           +  +  LL   LS C    +  + YDL+ S K    + +  Q++I  P   + L+S  I+
Sbjct: 29  AAIVLPLLAALLSGCGSKPS-NDTYDLSASVKASGPLMKGKQILIPPPTALQALDSNLIV 87

Query: 75  VRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRS 134
           +R SP EIQYL  +QWSDKL RM+Q KL+  FEN GK+  V  P QG+  DYQI++ IRS
Sbjct: 88  IRVSPSEIQYLGKAQWSDKLSRMVQSKLVEAFENTGKLGGVGVPGQGLAIDYQIVTDIRS 147

Query: 135 FEINIDRHC--AIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRIS 192
           FEI+       A + +S+KI+N    ++  Q VF     +   +   FI+ L+ AF+ ++
Sbjct: 148 FEIDAAGGQKSAAVEISVKILNDRTGTIKSQSVFRKVVPVTGGSNPDFIRGLDTAFAGVT 207

Query: 193 SEIIDWTLSSL 203
           +EI+DW+L SL
Sbjct: 208 AEIVDWSLRSL 218


>gi|23501902|ref|NP_698029.1| putative lipoprotein [Brucella suis 1330]
 gi|62289945|ref|YP_221738.1| lipoprotein [Brucella abortus bv. 1 str. 9-941]
 gi|82699873|ref|YP_414447.1| hypothetical protein BAB1_1041 [Brucella melitensis biovar Abortus
           2308]
 gi|161618974|ref|YP_001592861.1| hypothetical protein BCAN_A1037 [Brucella canis ATCC 23365]
 gi|225627500|ref|ZP_03785537.1| lipoprotein [Brucella ceti str. Cudo]
 gi|225852527|ref|YP_002732760.1| hypothetical protein BMEA_A1063 [Brucella melitensis ATCC 23457]
 gi|254689252|ref|ZP_05152506.1| hypothetical protein Babob68_03556 [Brucella abortus bv. 6 str.
           870]
 gi|254693736|ref|ZP_05155564.1| hypothetical protein Babob3T_03559 [Brucella abortus bv. 3 str.
           Tulya]
 gi|254697387|ref|ZP_05159215.1| hypothetical protein Babob28_06690 [Brucella abortus bv. 2 str.
           86/8/59]
 gi|254701773|ref|ZP_05163601.1| hypothetical protein Bsuib55_13076 [Brucella suis bv. 5 str. 513]
 gi|254704315|ref|ZP_05166143.1| hypothetical protein Bsuib36_10369 [Brucella suis bv. 3 str. 686]
 gi|254706783|ref|ZP_05168611.1| hypothetical protein BpinM_07295 [Brucella pinnipedialis
           M163/99/10]
 gi|254710107|ref|ZP_05171918.1| hypothetical protein BpinB_07496 [Brucella pinnipedialis B2/94]
 gi|254714108|ref|ZP_05175919.1| hypothetical protein BcetM6_12275 [Brucella ceti M644/93/1]
 gi|254716835|ref|ZP_05178646.1| hypothetical protein BcetM_10519 [Brucella ceti M13/05/1]
 gi|254730285|ref|ZP_05188863.1| hypothetical protein Babob42_03599 [Brucella abortus bv. 4 str.
           292]
 gi|256031603|ref|ZP_05445217.1| hypothetical protein BpinM2_13278 [Brucella pinnipedialis
           M292/94/1]
 gi|256044681|ref|ZP_05447585.1| hypothetical protein Bmelb1R_09313 [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|256061114|ref|ZP_05451268.1| hypothetical protein Bneo5_12212 [Brucella neotomae 5K33]
 gi|256113575|ref|ZP_05454395.1| hypothetical protein Bmelb3E_12492 [Brucella melitensis bv. 3 str.
           Ether]
 gi|256159741|ref|ZP_05457488.1| hypothetical protein BcetM4_12248 [Brucella ceti M490/95/1]
 gi|256255003|ref|ZP_05460539.1| hypothetical protein BcetB_12050 [Brucella ceti B1/94]
 gi|256257502|ref|ZP_05463038.1| hypothetical protein Babob9C_09143 [Brucella abortus bv. 9 str.
           C68]
 gi|256369446|ref|YP_003106954.1| lipoprotein, putative [Brucella microti CCM 4915]
 gi|260168732|ref|ZP_05755543.1| hypothetical protein BruF5_10258 [Brucella sp. F5/99]
 gi|261222191|ref|ZP_05936472.1| lipoprotein [Brucella ceti B1/94]
 gi|261317656|ref|ZP_05956853.1| lipoprotein [Brucella pinnipedialis B2/94]
 gi|261752326|ref|ZP_05996035.1| lipoprotein [Brucella suis bv. 5 str. 513]
 gi|261754984|ref|ZP_05998693.1| lipoprotein [Brucella suis bv. 3 str. 686]
 gi|265988691|ref|ZP_06101248.1| lipoprotein [Brucella pinnipedialis M292/94/1]
 gi|23347843|gb|AAN29944.1| lipoprotein, putative [Brucella suis 1330]
 gi|62196077|gb|AAX74377.1| lipoprotein, hypothetical [Brucella abortus bv. 1 str. 9-941]
 gi|82615974|emb|CAJ10997.1| Protein of unknown function DUF330 [Brucella melitensis biovar
           Abortus 2308]
 gi|161335785|gb|ABX62090.1| Hypothetical protein BCAN_A1037 [Brucella canis ATCC 23365]
 gi|225617505|gb|EEH14550.1| lipoprotein [Brucella ceti str. Cudo]
 gi|225640892|gb|ACO00806.1| Hypothetical protein, conserved [Brucella melitensis ATCC 23457]
 gi|255999606|gb|ACU48005.1| lipoprotein, putative [Brucella microti CCM 4915]
 gi|260920775|gb|EEX87428.1| lipoprotein [Brucella ceti B1/94]
 gi|261296879|gb|EEY00376.1| lipoprotein [Brucella pinnipedialis B2/94]
 gi|261742079|gb|EEY30005.1| lipoprotein [Brucella suis bv. 5 str. 513]
 gi|261744737|gb|EEY32663.1| lipoprotein [Brucella suis bv. 3 str. 686]
 gi|264660888|gb|EEZ31149.1| lipoprotein [Brucella pinnipedialis M292/94/1]
          Length = 200

 Score =  196 bits (498), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 53/203 (26%), Positives = 113/203 (55%), Gaps = 7/203 (3%)

Query: 4   KLNKIIKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTK-YDESVQRHIQLIITEP 62
           K  ++ + +    S+A+LL   L+ C     P++ ++L+          ++++QL+I  P
Sbjct: 2   KSRRMFRHRG---SVAILLTAFLAGCGT-TTPLDTFNLSTPQPMVTVPKRKNLQLLIPGP 57

Query: 63  ITEKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGI 122
              K L+SE+I+V S+P  I+YL G+QW D+L  ++Q +L+  +EN      + +P  G+
Sbjct: 58  AALKALDSENIVVSSAPGSIEYLKGAQWGDRLTNIVQSRLVQAYENTSAFGGIGRPGDGL 117

Query: 123 YADYQIISAIRSFEIN--IDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHF 180
             +YQ+++ +R F I        A++ M++++++     +   +VF     +   +   +
Sbjct: 118 AINYQVLTDLRMFGIQAYTSPQTAVVEMAVRLLSDKTGEVRATRVFRTAIPVTGTSNAAY 177

Query: 181 IQSLNRAFSRISSEIIDWTLSSL 203
           +++L++AF +  +EI+ WT+S+L
Sbjct: 178 VKALDKAFDQTVNEIVSWTISTL 200


>gi|222148410|ref|YP_002549367.1| hypothetical protein Avi_1896 [Agrobacterium vitis S4]
 gi|221735398|gb|ACM36361.1| conserved hypothetical protein [Agrobacterium vitis S4]
          Length = 204

 Score =  195 bits (497), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 70/202 (34%), Positives = 120/202 (59%), Gaps = 5/202 (2%)

Query: 4   KLNKIIKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQR-HIQLIITEP 62
            + + +     +C+L++L    L+ C    +P + YDL        +      Q+++ +P
Sbjct: 6   AVLRPMAVLRAACALSILG-VMLAGCG--TSPNDTYDLASIRAATTTQSAQKRQVLVADP 62

Query: 63  ITEKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGI 122
              K+L+S+ I+VR S  E+QYL  SQWSDKLPRM+Q KL+  FEN GK+  V KP QG+
Sbjct: 63  TALKVLDSDMIVVRVSGTEMQYLAKSQWSDKLPRMVQSKLVEAFENTGKLGGVGKPGQGL 122

Query: 123 YADYQIISAIRSFEINIDR-HCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFI 181
             DYQ++S IR+FE+       A + +S+K++N  + S++ QKVF         +    +
Sbjct: 123 AIDYQLLSDIRTFEVEAGGIRRANVEISVKLLNDRNGSVISQKVFSASVPARGGDNQALV 182

Query: 182 QSLNRAFSRISSEIIDWTLSSL 203
            +L++AF+++S +I++WTL+++
Sbjct: 183 NALSQAFAKVSGDIVNWTLTTI 204


>gi|148558849|ref|YP_001258963.1| putative lipoprotein [Brucella ovis ATCC 25840]
 gi|148370106|gb|ABQ60085.1| putative lipoprotein [Brucella ovis ATCC 25840]
          Length = 200

 Score =  195 bits (496), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 53/203 (26%), Positives = 113/203 (55%), Gaps = 7/203 (3%)

Query: 4   KLNKIIKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTK-YDESVQRHIQLIITEP 62
           K  ++ + +    S+A+LL   L+ C     P++ ++L+          ++++QL+I  P
Sbjct: 2   KSRRMFRHRG---SVAILLTAFLAGCGT-TTPLDTFNLSTPQPMVTVPKRKNLQLLIPGP 57

Query: 63  ITEKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGI 122
              K L+SE+I+V S+P  I+YL G+QW D+L  ++Q +L+  +EN      + +P  G+
Sbjct: 58  AALKALDSENIVVSSAPGSIEYLKGAQWGDRLTNIVQSRLVQAYENTSAFGGIGRPGDGL 117

Query: 123 YADYQIISAIRSFEIN--IDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHF 180
             +YQ+++ +R F I        A++ M++++++     +   +VF     +   +   +
Sbjct: 118 AINYQVLTDLRMFGIQAYTSPQTAVVEMAVRLLSNKTGEVRATRVFRTAIPVTGTSNAAY 177

Query: 181 IQSLNRAFSRISSEIIDWTLSSL 203
           +++L++AF +  +EI+ WT+S+L
Sbjct: 178 VKALDKAFDQTVNEIVSWTISTL 200


>gi|312958195|ref|ZP_07772718.1| lipoprotein [Pseudomonas fluorescens WH6]
 gi|311287626|gb|EFQ66184.1| lipoprotein [Pseudomonas fluorescens WH6]
          Length = 203

 Score =  195 bits (496), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 35/194 (18%), Positives = 87/194 (44%), Gaps = 2/194 (1%)

Query: 9   IKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIITEPITEKIL 68
           +K+     +   L   S  S     +P ++Y L  +    +       L +T+P T + L
Sbjct: 1   MKRAYQLIAPVALALISACSILPKADPSDVYRLAATQTATQGAPVSWSLRVTKPQTSEFL 60

Query: 69  NSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQI 128
           +S  I V  +   I     S+WSD  P +++ +L+  F+ +G+++ +      + ADY++
Sbjct: 61  DSPRIAVVPNGDLISSYANSRWSDPAPVLLRNRLLDGFQRDGRVTLLSTDETNLQADYEL 120

Query: 129 ISAIRSFEINIDRH--CAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNR 186
              +++F+          +I +  +++   D  ++  + F V + +        + +  +
Sbjct: 121 GGQLQAFQSEYRGSAVEVVIRLDARLVRGSDQRIMASRRFEVRQPVADTKVPAVVAAFGQ 180

Query: 187 AFSRISSEIIDWTL 200
           A  +++ +++DW +
Sbjct: 181 AGDQLNKQVVDWVV 194


>gi|289662619|ref|ZP_06484200.1| putative secreted protein [Xanthomonas campestris pv. vasculorum
           NCPPB702]
 gi|289668436|ref|ZP_06489511.1| putative secreted protein [Xanthomonas campestris pv. musacearum
           NCPPB4381]
          Length = 214

 Score =  195 bits (496), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 49/201 (24%), Positives = 99/201 (49%), Gaps = 6/201 (2%)

Query: 6   NKIIKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTE-STKYDESVQRHIQLIITEPIT 64
            ++++  +    LA+  C+ L+       P  IY  T   T      Q   QL++ +P  
Sbjct: 4   MRLLRPMLCVSLLALGGCSVLTGG--DQKPATIYSPTVRVTPNPAWPQVTWQLVVAKPSA 61

Query: 65  EKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYA 124
            +I++S  I VR +P E+Q   G+ W+     M++  ++  FE++GKI+ V     GI +
Sbjct: 62  ARIIDSPRINVRPTPGELQVYQGAGWAQPATDMLEDSVVRAFEDSGKIAAVAHIGTGIRS 121

Query: 125 DYQIISAIRSFEINIDR---HCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFI 181
           DY++   +R FE +        A I ++ K++++ D  +V  + F V       +     
Sbjct: 122 DYKLAIDLRRFESDYAGQSLPSATIELNAKLLHSADQRVVASRTFLVARPSTGTDTAAVA 181

Query: 182 QSLNRAFSRISSEIIDWTLSS 202
            +  +A +++++E++ WTL++
Sbjct: 182 VAFEQALNQVTTELVGWTLTT 202


>gi|163843290|ref|YP_001627694.1| hypothetical protein BSUIS_A1065 [Brucella suis ATCC 23445]
 gi|163674013|gb|ABY38124.1| Hypothetical protein BSUIS_A1065 [Brucella suis ATCC 23445]
          Length = 200

 Score =  194 bits (494), Expect = 5e-48,   Method: Composition-based stats.
 Identities = 54/203 (26%), Positives = 113/203 (55%), Gaps = 7/203 (3%)

Query: 4   KLNKIIKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDL-TESTKYDESVQRHIQLIITEP 62
           K  ++ + +    S+A+LL   L+ C     P++ ++L T         ++++QL+I  P
Sbjct: 2   KSRRMFRHRG---SVAILLTAFLAGCGT-TTPLDTFNLSTPHPMVTVPKRKNLQLLIPGP 57

Query: 63  ITEKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGI 122
              K L+SE+I+V S+P  I+YL G+QW D+L  ++Q +L+  +EN      + +P  G+
Sbjct: 58  AALKALDSENIVVSSAPGSIEYLKGAQWGDRLTNIVQSRLVQAYENTSAFGGIGRPGDGL 117

Query: 123 YADYQIISAIRSFEIN--IDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHF 180
             +YQ+++ +R F I        A++ M++++++     +   +VF     +   +   +
Sbjct: 118 AINYQVLTDLRMFGIQAYTSPQTAVVEMAVRLLSDKTGEVRVTRVFRTAIPVTGTSNAAY 177

Query: 181 IQSLNRAFSRISSEIIDWTLSSL 203
           +++L++AF +  +EI+ WT+S+L
Sbjct: 178 VKALDKAFDQTVNEIVSWTISTL 200


>gi|294663969|ref|ZP_06729389.1| conserved hypothetical protein [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 10535]
 gi|292606264|gb|EFF49495.1| conserved hypothetical protein [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 10535]
          Length = 211

 Score =  194 bits (493), Expect = 6e-48,   Method: Composition-based stats.
 Identities = 49/201 (24%), Positives = 99/201 (49%), Gaps = 6/201 (2%)

Query: 6   NKIIKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTE-STKYDESVQRHIQLIITEPIT 64
            ++++  +    LA+  C+ L+       P  IY  T   T      Q   QL++ +P  
Sbjct: 1   MRLLRPLLCVSLLALGGCSVLTGG--DQKPATIYAPTVRVTPNPAWPQVTWQLVVAKPSA 58

Query: 65  EKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYA 124
            ++++S  I VR SP E+Q   G+ W+     M++  ++  FE++GKI+ V     GI +
Sbjct: 59  ARVIDSPRINVRPSPGELQVYHGAGWAQPATDMLEDSVVRAFEDSGKIAAVAHIGTGIRS 118

Query: 125 DYQIISAIRSFEINIDR---HCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFI 181
           DY++   +R FE +        A I ++ K++++ D  +V  + F V       +     
Sbjct: 119 DYKLAIDLRRFESDYAGQSLPSATIELNAKLLHSADQRVVASRTFLVARPSTGTDTAAVA 178

Query: 182 QSLNRAFSRISSEIIDWTLSS 202
            +  +A +++++E++ WTL++
Sbjct: 179 VAFEQALTQLTTELVGWTLTT 199


>gi|294624130|ref|ZP_06702868.1| conserved hypothetical protein [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 11122]
 gi|292601575|gb|EFF45574.1| conserved hypothetical protein [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 11122]
          Length = 211

 Score =  194 bits (493), Expect = 6e-48,   Method: Composition-based stats.
 Identities = 49/201 (24%), Positives = 99/201 (49%), Gaps = 6/201 (2%)

Query: 6   NKIIKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTE-STKYDESVQRHIQLIITEPIT 64
            ++++  +    LA+  C+ L+       P  IY  T   T      Q   QL++ +P  
Sbjct: 1   MRLLRPLLCVSLLALGGCSVLTGG--DQKPATIYAPTVRVTPKPAWPQVTWQLVVAKPSA 58

Query: 65  EKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYA 124
            ++++S  I VR SP E+Q   G+ W+     M++  ++  FE++GKI+ V     GI +
Sbjct: 59  ARVIDSPRINVRPSPGELQVYHGAGWAQPATDMLEDSVVRAFEDSGKIAAVAHIGTGIRS 118

Query: 125 DYQIISAIRSFEINIDR---HCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFI 181
           DY++   +R FE +        A I ++ K++++ D  +V  + F V       +     
Sbjct: 119 DYKLAIDLRRFESDYAGQSLPSATIELNAKLLHSADQRVVASRTFLVARPSTGTDTAAVA 178

Query: 182 QSLNRAFSRISSEIIDWTLSS 202
            +  +A +++++E++ WTL++
Sbjct: 179 VAFEQALTQLTTELVGWTLTT 199


>gi|150396761|ref|YP_001327228.1| hypothetical protein Smed_1551 [Sinorhizobium medicae WSM419]
 gi|150028276|gb|ABR60393.1| protein of unknown function DUF330 [Sinorhizobium medicae WSM419]
          Length = 204

 Score =  193 bits (491), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 61/195 (31%), Positives = 109/195 (55%), Gaps = 2/195 (1%)

Query: 10  KKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIITEPITEKILN 69
           +   +  ++ + L   L+ C       + + L      D +   + QL++ EP   K L 
Sbjct: 11  RAGAVRSAVVLTLGMVLAGCGSGKAVNDTFSLASVPTVDRASATNRQLLVPEPTALKTLG 70

Query: 70  SEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQII 129
           S+ I+VR S  E+QYL  +QW D LPRM+Q +L+  F+N G+I  V KP QG+  DYQ+I
Sbjct: 71  SDQILVRLSSSELQYLAKAQWGDSLPRMVQDRLVQTFDNTGRIR-VGKPGQGLAIDYQLI 129

Query: 130 SAIRSFEINIDRHC-AIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAF 188
           + +R+FEI+ D    A++ +  KI++  + ++  Q+ F     +       F+ +L+ AF
Sbjct: 130 AELRAFEISTDGPARAVVEIFAKILDDRNGTVRKQQAFRAVVPVRGAGNPAFVAALDAAF 189

Query: 189 SRISSEIIDWTLSSL 203
           ++++++I+ WTL S+
Sbjct: 190 AQVAADIVGWTLRSI 204


>gi|148545414|ref|YP_001265516.1| ABC transporter auxiliary component-like protein [Pseudomonas
           putida F1]
 gi|148509472|gb|ABQ76332.1| ABC-type uncharacterized transport system auxiliary component-like
           protein [Pseudomonas putida F1]
          Length = 211

 Score =  192 bits (489), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 34/182 (18%), Positives = 80/182 (43%), Gaps = 3/182 (1%)

Query: 24  TSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIITEPITEKILNSEDIIVRSSPIEIQ 83
            S  S    + PV++Y L  +     +      L + +P+  ++L    I V      I 
Sbjct: 17  VSACSILPKSEPVDLYRLPVNQPSRTAPPLEWSLRLNKPLASEVLAGPRIAVIPQGDVIS 76

Query: 84  YLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFEINIDRHC 143
              G++WSD  P +++ +L+  F+ +G++  +   +  + ADY++   +++F+       
Sbjct: 77  SYKGARWSDAAPVLLRNRLLDGFQRDGQVQRLSADDSNLQADYELAGELQAFQSEYRPGG 136

Query: 144 A---IITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEIIDWTL 200
           A   +I    +++N  D  +   K F + + L        +    +A  ++  +++ WT+
Sbjct: 137 AVEVVIRYDARLVNGRDQRIQASKRFEIRQPLADKQVSAVVAGFGQASDQLVGQVVSWTI 196

Query: 201 SS 202
           + 
Sbjct: 197 AQ 198


>gi|78049254|ref|YP_365429.1| putative secreted protein [Xanthomonas campestris pv. vesicatoria
           str. 85-10]
 gi|78037684|emb|CAJ25429.1| putative secreted protein [Xanthomonas campestris pv. vesicatoria
           str. 85-10]
          Length = 214

 Score =  192 bits (488), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 49/201 (24%), Positives = 99/201 (49%), Gaps = 6/201 (2%)

Query: 6   NKIIKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTE-STKYDESVQRHIQLIITEPIT 64
            ++++  +    LA+  C+ L+       P  IY  T   T      Q   QL++ +P  
Sbjct: 4   MRVLRPLLCVSLLALGGCSVLAGG--DKKPATIYAPTVRVTPNPTWPQVTWQLVVAKPSA 61

Query: 65  EKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYA 124
            ++++S  I VR +P E+Q   G+ W+     M++  ++  FE++GKI+ V     GI +
Sbjct: 62  ARVIDSPRINVRPTPGELQVYHGAGWAQPATDMLEDSVVRAFEDSGKIAAVAHIGTGIRS 121

Query: 125 DYQIISAIRSFEINIDR---HCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFI 181
           DY++   +R FE +        A I ++ K++++ D  +V  + F V       +     
Sbjct: 122 DYKLAIDLRRFESDYAGQSLPSATIELNAKLLHSTDQRVVASRTFLVARPSTGTDTAAVA 181

Query: 182 QSLNRAFSRISSEIIDWTLSS 202
            +  +A ++I++E++ WTL++
Sbjct: 182 VAFEQALTQITTELVGWTLTA 202


>gi|325919795|ref|ZP_08181788.1| ABC-type uncharacterized transport system, auxiliary component
           [Xanthomonas gardneri ATCC 19865]
 gi|325920776|ref|ZP_08182681.1| ABC-type uncharacterized transport system, auxiliary component
           [Xanthomonas gardneri ATCC 19865]
 gi|325921243|ref|ZP_08183103.1| ABC-type uncharacterized transport system, auxiliary component
           [Xanthomonas gardneri ATCC 19865]
 gi|325921531|ref|ZP_08183383.1| ABC-type uncharacterized transport system, auxiliary component
           [Xanthomonas gardneri ATCC 19865]
 gi|325921654|ref|ZP_08183489.1| ABC-type uncharacterized transport system, auxiliary component
           [Xanthomonas gardneri ATCC 19865]
 gi|325922542|ref|ZP_08184302.1| ABC-type uncharacterized transport system, auxiliary component
           [Xanthomonas gardneri ATCC 19865]
 gi|325923181|ref|ZP_08184866.1| ABC-type uncharacterized transport system, auxiliary component
           [Xanthomonas gardneri ATCC 19865]
 gi|325923305|ref|ZP_08184978.1| ABC-type uncharacterized transport system, auxiliary component
           [Xanthomonas gardneri ATCC 19865]
 gi|325924093|ref|ZP_08185660.1| ABC-type uncharacterized transport system, auxiliary component
           [Xanthomonas gardneri ATCC 19865]
 gi|325545425|gb|EGD16712.1| ABC-type uncharacterized transport system, auxiliary component
           [Xanthomonas gardneri ATCC 19865]
 gi|325546232|gb|EGD17413.1| ABC-type uncharacterized transport system, auxiliary component
           [Xanthomonas gardneri ATCC 19865]
 gi|325546326|gb|EGD17495.1| ABC-type uncharacterized transport system, auxiliary component
           [Xanthomonas gardneri ATCC 19865]
 gi|325546981|gb|EGD18075.1| ABC-type uncharacterized transport system, auxiliary component
           [Xanthomonas gardneri ATCC 19865]
 gi|325547843|gb|EGD18862.1| ABC-type uncharacterized transport system, auxiliary component
           [Xanthomonas gardneri ATCC 19865]
 gi|325547979|gb|EGD18981.1| ABC-type uncharacterized transport system, auxiliary component
           [Xanthomonas gardneri ATCC 19865]
 gi|325548210|gb|EGD19204.1| ABC-type uncharacterized transport system, auxiliary component
           [Xanthomonas gardneri ATCC 19865]
 gi|325548750|gb|EGD19699.1| ABC-type uncharacterized transport system, auxiliary component
           [Xanthomonas gardneri ATCC 19865]
 gi|325549709|gb|EGD20570.1| ABC-type uncharacterized transport system, auxiliary component
           [Xanthomonas gardneri ATCC 19865]
          Length = 214

 Score =  192 bits (487), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 48/199 (24%), Positives = 97/199 (48%), Gaps = 6/199 (3%)

Query: 6   NKIIKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTES-TKYDESVQRHIQLIITEPIT 64
            ++++  +    L +  C+ L+       P  IY  T   T      Q   QL + +P  
Sbjct: 4   MRLLRPLLCVSLLTLGGCSLLTGG--DQKPATIYAPTVRITPNPSWPQVSWQLSVAKPSA 61

Query: 65  EKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYA 124
            ++++S  I VR +P E+Q   G+ W+     M++  ++  FE++GKI+ V +   GI +
Sbjct: 62  ARVIDSPRINVRPTPGELQVYHGAGWAQPATDMLEDSVVRAFEDSGKIAAVARIGTGIRS 121

Query: 125 DYQIISAIRSFEINIDR---HCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFI 181
           DY+++  +R FE +        A I ++ K+++A D  +V  + F V       +     
Sbjct: 122 DYKLVIDLRRFESDYAGQSLPSATIELNAKLLHAADQRVVASRTFLVARPSTGTDTATVA 181

Query: 182 QSLNRAFSRISSEIIDWTL 200
            +  +A +++++E++ WTL
Sbjct: 182 AAFEQAMTQVTTELVGWTL 200


>gi|260463971|ref|ZP_05812167.1| protein of unknown function DUF330 [Mesorhizobium opportunistum
           WSM2075]
 gi|259030346|gb|EEW31626.1| protein of unknown function DUF330 [Mesorhizobium opportunistum
           WSM2075]
          Length = 235

 Score =  192 bits (487), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 49/180 (27%), Positives = 99/180 (55%), Gaps = 2/180 (1%)

Query: 25  SLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIITEPITEKILNSEDIIVRSSPIEIQY 84
             ++      P++ ++L+  +  D       Q++I +P   K L+S++I+++ S   IQY
Sbjct: 57  GCAALGGKPAPLDTFELSAPS-VDAHGHSSKQILIAQPSALKALDSQNIVIKPSDRSIQY 115

Query: 85  LIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFEINIDRHC- 143
           L G+QW+D+LP ++Q +L   F+ +G  + V KP +G+  DYQ+I  +RSFE+ +D    
Sbjct: 116 LKGAQWADRLPLIVQARLAETFQRSGSFAGVGKPGEGLAIDYQVIVEVRSFEVRVDGGEH 175

Query: 144 AIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEIIDWTLSSL 203
           A + + ++++N  +  +   K F+    +       ++ +L+ AF   + +I+ WT S +
Sbjct: 176 AEVDLFVRLLNDRNGEVRASKSFNASAPVSGKGNSAYVGALDNAFGDAARQIVRWTDSVI 235


>gi|188578637|ref|YP_001915566.1| lipoprotein, putative [Xanthomonas oryzae pv. oryzae PXO99A]
 gi|188523089|gb|ACD61034.1| lipoprotein, putative [Xanthomonas oryzae pv. oryzae PXO99A]
          Length = 211

 Score =  191 bits (486), Expect = 5e-47,   Method: Composition-based stats.
 Identities = 48/201 (23%), Positives = 97/201 (48%), Gaps = 6/201 (2%)

Query: 6   NKIIKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTE-STKYDESVQRHIQLIITEPIT 64
            ++++  +    LA+  C+ L+       P  IY  T   +      Q   QL++ +P  
Sbjct: 1   MRLLRPLLCVSLLALGGCSVLTGG--DQKPATIYSPTVRVSPNPAWPQVAWQLVVAKPSA 58

Query: 65  EKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYA 124
            +I++S  I VR +P E+Q   G  W+     M++  ++  FE++GKI+ V     GI +
Sbjct: 59  ARIIDSPRINVRPTPGELQVYQGVGWAQPATDMLEDNVVRAFEDSGKIAAVAHIGTGIRS 118

Query: 125 DYQIISAIRSFEINIDR---HCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFI 181
           DY++   +R FE +        A I  + K++++ D  +V  + F V       +     
Sbjct: 119 DYKLAIDLRRFESDYASQSLPSATIEFNAKLLHSTDQRVVASRTFLVARPSTSTDTAAVA 178

Query: 182 QSLNRAFSRISSEIIDWTLSS 202
            +  +A +++++E++ WTL++
Sbjct: 179 VAFEQALTQVTTELVGWTLTT 199


>gi|166713442|ref|ZP_02244649.1| hypothetical protein Xoryp_18885 [Xanthomonas oryzae pv. oryzicola
           BLS256]
          Length = 214

 Score =  191 bits (485), Expect = 5e-47,   Method: Composition-based stats.
 Identities = 48/201 (23%), Positives = 97/201 (48%), Gaps = 6/201 (2%)

Query: 6   NKIIKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTE-STKYDESVQRHIQLIITEPIT 64
            ++++  +    LA+  C+ L+       P  IY  T   +      Q   QL++ +P  
Sbjct: 4   MRLLRPLLCVSLLALGGCSVLTGG--DQKPATIYSPTVRVSPNPAWPQVAWQLVVAKPSA 61

Query: 65  EKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYA 124
            +I++S  I VR +P E+Q   G  W+     M++  ++  FE++GKI+ V     GI +
Sbjct: 62  ARIIDSPRINVRPTPGELQVYQGVGWAQPATDMLEDSVVRAFEDSGKIAAVAHIGTGIRS 121

Query: 125 DYQIISAIRSFEINIDR---HCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFI 181
           DY++   +R FE +        A I ++ K++++ D  +V  + F V             
Sbjct: 122 DYKLAIDLRRFESDYAGQPLPSATIELNAKLLHSSDQRVVASRTFLVARPSTSTETAAVA 181

Query: 182 QSLNRAFSRISSEIIDWTLSS 202
            +  +A +++++E++ WTL++
Sbjct: 182 VAFEQALTQVTTELVGWTLTT 202


>gi|17987245|ref|NP_539879.1| membrane lipoprotein lipid attachment site containing protein
           [Brucella melitensis bv. 1 str. 16M]
 gi|17982919|gb|AAL52143.1| membrane lipoprotein lipid attachment site containing protein
           [Brucella melitensis bv. 1 str. 16M]
          Length = 185

 Score =  191 bits (485), Expect = 6e-47,   Method: Composition-based stats.
 Identities = 49/186 (26%), Positives = 104/186 (55%), Gaps = 4/186 (2%)

Query: 21  LLCTSLSSCFFHNNPVNIYDLTESTK-YDESVQRHIQLIITEPITEKILNSEDIIVRSSP 79
           +L   L+ C     P++ ++L+          ++++QL+I  P   K L+SE+I+V S+P
Sbjct: 1   MLTAFLAGCGT-TTPLDTFNLSTPQPMVTVPKRKNLQLLIPGPAALKALDSENIVVSSAP 59

Query: 80  IEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFEIN- 138
             I+YL G+QW D+L  ++Q +L+  +EN      + +P  G+  +YQ+++ +R F I  
Sbjct: 60  GSIEYLKGAQWGDRLTNIVQSRLVQAYENTSAFGGIGRPGDGLAINYQVLTDLRMFGIQA 119

Query: 139 -IDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEIID 197
                 A++ M++++++     +   +VF     +   +   ++++L++AF +  +EI+ 
Sbjct: 120 YTSPQTAVVEMAVRLLSDKTGEVRATRVFRTAIPVTGTSNAAYVKALDKAFDQTVNEIVS 179

Query: 198 WTLSSL 203
           WT+S+L
Sbjct: 180 WTISTL 185


>gi|104779405|ref|YP_605903.1| lipoprotein [Pseudomonas entomophila L48]
 gi|95108392|emb|CAK13086.1| putative lipoprotein [Pseudomonas entomophila L48]
          Length = 204

 Score =  191 bits (485), Expect = 6e-47,   Method: Composition-based stats.
 Identities = 35/180 (19%), Positives = 78/180 (43%), Gaps = 3/180 (1%)

Query: 27  SSCFFHNNPVNIYDLTESTKYDESVQRHIQLIITEPITEKILNSEDIIVRSSPIEIQYLI 86
            S      PV+IY L        +      L + +P+  + L    I V      I    
Sbjct: 20  CSILPQGEPVDIYRLPVGQTARGASPLDWSLRLNKPLASEALAGPRIAVIPQGDVISSYK 79

Query: 87  GSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFEINIDRH---C 143
           G++WSD +P +++ +L+  F+ +G++  +   +  + ADY++   +++F+          
Sbjct: 80  GARWSDPVPMLVRNRLLDGFQRDGRVQRLSADDSNLQADYELGGELQAFQAEYRPGGSVE 139

Query: 144 AIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEIIDWTLSSL 203
            +I    +++      ++  K F V + L +      +     A  +++ ++IDWT+S +
Sbjct: 140 VVIRYDARLVQGRSQRILASKRFEVRQPLGQLQVPAVVAGFGTASDQLARQVIDWTVSQV 199


>gi|58580426|ref|YP_199442.1| hypothetical protein XOO0803 [Xanthomonas oryzae pv. oryzae
           KACC10331]
 gi|84622388|ref|YP_449760.1| hypothetical protein XOO_0731 [Xanthomonas oryzae pv. oryzae MAFF
           311018]
 gi|58425020|gb|AAW74057.1| conserved hypothetical protein [Xanthomonas oryzae pv. oryzae
           KACC10331]
 gi|84366328|dbj|BAE67486.1| conserved hypothetical protein [Xanthomonas oryzae pv. oryzae MAFF
           311018]
          Length = 214

 Score =  191 bits (485), Expect = 6e-47,   Method: Composition-based stats.
 Identities = 48/201 (23%), Positives = 97/201 (48%), Gaps = 6/201 (2%)

Query: 6   NKIIKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTE-STKYDESVQRHIQLIITEPIT 64
            ++++  +    LA+  C+ L+       P  IY  T   +      Q   QL++ +P  
Sbjct: 4   MRLLRPLLCVSLLALGGCSVLTGG--DQKPATIYSPTVRVSPNPAWPQVAWQLVVAKPSA 61

Query: 65  EKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYA 124
            +I++S  I VR +P E+Q   G  W+     M++  ++  FE++GKI+ V     GI +
Sbjct: 62  ARIIDSPRINVRPTPGELQVYQGVGWAQPATDMLEDNVVRAFEDSGKIAAVAHIGTGIRS 121

Query: 125 DYQIISAIRSFEINIDR---HCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFI 181
           DY++   +R FE +        A I  + K++++ D  +V  + F V       +     
Sbjct: 122 DYKLAIDLRRFESDYASQSLPSATIEFNAKLLHSTDQRVVASRTFLVARPSTSTDTAAVA 181

Query: 182 QSLNRAFSRISSEIIDWTLSS 202
            +  +A +++++E++ WTL++
Sbjct: 182 VAFEQALTQVTTELVGWTLTT 202


>gi|304391805|ref|ZP_07373747.1| lipoprotein [Ahrensia sp. R2A130]
 gi|303296034|gb|EFL90392.1| lipoprotein [Ahrensia sp. R2A130]
          Length = 195

 Score =  190 bits (484), Expect = 7e-47,   Method: Composition-based stats.
 Identities = 56/197 (28%), Positives = 101/197 (51%), Gaps = 3/197 (1%)

Query: 8   IIKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTEST-KYDESVQRHIQLIITEPITEK 66
           +I K I +  LA  + +          P   Y+ +  +     +   + QL++  P + K
Sbjct: 1   MIFKAITTTLLAAFVLSGCQLLKAPEKPRETYEFSAPSFDGGVAGGTNAQLLVKLPTSLK 60

Query: 67  ILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADY 126
            ++SE +I+R +P  I Y+ G+QWSD +PR++Q KL+  FEN G      KP  G+  D+
Sbjct: 61  AIDSERMILRPTPKIITYVAGAQWSDSVPRLVQAKLVEAFENTGSAGATAKPGDGLVIDF 120

Query: 127 QIISAIRSFEINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNR 186
           Q+I  IR FEI      A+I +S+K+++     +V  ++F        +   +++ + +R
Sbjct: 121 QLIPDIRRFEI--IGGEAVIEVSIKLLSDKSGRVVASRIFTTSAATGGNQPENYVAAFDR 178

Query: 187 AFSRISSEIIDWTLSSL 203
           AFS  + ++I WT   +
Sbjct: 179 AFSSFAEDVIAWTFRQV 195


>gi|227822228|ref|YP_002826199.1| putative ABC transporter protein [Sinorhizobium fredii NGR234]
 gi|227341228|gb|ACP25446.1| putative ABC transporter protein [Sinorhizobium fredii NGR234]
          Length = 205

 Score =  190 bits (484), Expect = 8e-47,   Method: Composition-based stats.
 Identities = 55/194 (28%), Positives = 108/194 (55%), Gaps = 1/194 (0%)

Query: 11  KKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIITEPITEKILNS 70
                 ++ + L   L+ C       + + L  +   +     + Q+++ EP   K L S
Sbjct: 12  AGAARFAMVLSLTALLAGCGTRQAANDTFSLASTPVVERPAATNRQILVPEPTALKTLGS 71

Query: 71  EDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIIS 130
           + I+VR S  E+Q+L  +QW D LPR++Q +L+  F+N G++  V KP QG+  DYQ+++
Sbjct: 72  DQIVVRLSKSELQFLAQAQWGDSLPRLVQDRLVQTFDNTGRVRGVGKPGQGLAIDYQLVT 131

Query: 131 AIRSFEINIDRH-CAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFS 189
            +R+FEI+ D    A++ +  KI++  + ++  Q+ F     ++      F+ +L+ AF+
Sbjct: 132 ELRAFEISTDGPDTAVVEIFAKILDDRNGTVRRQQAFRAVAPVQGAGNPAFVAALDAAFA 191

Query: 190 RISSEIIDWTLSSL 203
           +++++I+ WTL S+
Sbjct: 192 QVAADIVSWTLRSI 205


>gi|13470956|ref|NP_102525.1| hypothetical protein mll0797 [Mesorhizobium loti MAFF303099]
 gi|14021699|dbj|BAB48311.1| mll0797 [Mesorhizobium loti MAFF303099]
          Length = 197

 Score =  190 bits (483), Expect = 9e-47,   Method: Composition-based stats.
 Identities = 51/180 (28%), Positives = 99/180 (55%), Gaps = 2/180 (1%)

Query: 25  SLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIITEPITEKILNSEDIIVRSSPIEIQY 84
             +       P++ ++L+  +  D       Q++I +P   K L+S++I+++ S   IQY
Sbjct: 19  GCAVLGGKPAPLDTFELSAPS-VDAHGHSRKQILIAQPSALKALDSQNIVIKPSDRSIQY 77

Query: 85  LIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFEINIDRHC- 143
           L G+QW+D+LP ++Q +L   F+ +G  + V KP +G+  DYQ+I  IRSFE+++D    
Sbjct: 78  LKGAQWADRLPLIVQARLAETFQRSGSFAGVGKPGEGLAIDYQVIVEIRSFEVSVDGGEH 137

Query: 144 AIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEIIDWTLSSL 203
           A + + ++++N  +  +   K F     +       +I++L+ AF   + +I+ WT S +
Sbjct: 138 AEVDLFVRLLNDRNGEVRASKSFTASAPVSGSGNPAYIKALDSAFGDAAKQIVRWTDSVI 197


>gi|28198461|ref|NP_778775.1| hypothetical protein PD0551 [Xylella fastidiosa Temecula1]
 gi|182681134|ref|YP_001829294.1| putative secreted protein [Xylella fastidiosa M23]
 gi|28056545|gb|AAO28424.1| conserved hypothetical protein [Xylella fastidiosa Temecula1]
 gi|182631244|gb|ACB92020.1| putative secreted protein [Xylella fastidiosa M23]
 gi|307579582|gb|ADN63551.1| putative secreted protein [Xylella fastidiosa subsp. fastidiosa
           GB514]
          Length = 213

 Score =  190 bits (483), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 50/200 (25%), Positives = 91/200 (45%), Gaps = 6/200 (3%)

Query: 6   NKIIKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQR-HIQLIITEPIT 64
            K+I   +    L +  C+S  +      P  IY        D S  R    L +  P  
Sbjct: 1   MKLIHPLVCLSVLTLASCSS--TLLGEKKPTTIYSPQIHVTTDPSWPRVTWHLTVLHPKA 58

Query: 65  EKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYA 124
            +++++  I V+ +P EIQ      W+     M++  LI  FE++GKI+ V +   GI  
Sbjct: 59  PRMIDTPRINVQPTPGEIQVYHNVSWAQPTTDMLEDALIRVFEDSGKIAGVTRAGTGIRT 118

Query: 125 DYQIISAIRSFEINIDR---HCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFI 181
           DY +   +R FE +        A I ++ K+I AH+  L+  + F V +     +     
Sbjct: 119 DYSLSLDLRRFESDYAGTPMPTATIEVNAKLIGAHNKRLIASRTFIVTQPATNTDTSTVA 178

Query: 182 QSLNRAFSRISSEIIDWTLS 201
            +  +A +++++E++ WTL+
Sbjct: 179 NAFGQALTQLTNELVGWTLT 198


>gi|71274910|ref|ZP_00651198.1| conserved hypothetical protein [Xylella fastidiosa Dixon]
 gi|71898798|ref|ZP_00680966.1| conserved hypothetical protein [Xylella fastidiosa Ann-1]
 gi|170729826|ref|YP_001775259.1| hypothetical protein Xfasm12_0625 [Xylella fastidiosa M12]
 gi|71164642|gb|EAO14356.1| conserved hypothetical protein [Xylella fastidiosa Dixon]
 gi|71731384|gb|EAO33447.1| conserved hypothetical protein [Xylella fastidiosa Ann-1]
 gi|167964619|gb|ACA11629.1| conserved hypothetical protein [Xylella fastidiosa M12]
          Length = 213

 Score =  190 bits (482), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 50/200 (25%), Positives = 91/200 (45%), Gaps = 6/200 (3%)

Query: 6   NKIIKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQR-HIQLIITEPIT 64
            K+I   +    L +  C+S  +      P  IY        D S  R    L +  P  
Sbjct: 1   MKLIHPLVCLSVLTLASCSS--TLLGEKKPTTIYSPQIHVTTDPSWPRVTWHLTVLHPKA 58

Query: 65  EKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYA 124
            +++++  I V+ +P EIQ      W+     M++  LI  FE++GKI+ V +   GI  
Sbjct: 59  PRMIDTPRINVQPTPGEIQVYHNVSWAQPTTDMLEDALIRVFEDSGKIAGVTRAGTGIRT 118

Query: 125 DYQIISAIRSFEINIDR---HCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFI 181
           DY +   +R FE +        A I ++ K+I AH+  L+  + F V +     +     
Sbjct: 119 DYSLSLDLRRFESDYAGTPMPTATIEVNAKLIGAHNKRLIASRTFIVTQPATNTDTSTVA 178

Query: 182 QSLNRAFSRISSEIIDWTLS 201
            +  +A +++++E++ WTL+
Sbjct: 179 NAFGQALTQLTNELVGWTLT 198


>gi|71901852|ref|ZP_00683915.1| conserved hypothetical protein [Xylella fastidiosa Ann-1]
 gi|71728380|gb|EAO30548.1| conserved hypothetical protein [Xylella fastidiosa Ann-1]
          Length = 213

 Score =  189 bits (481), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 51/200 (25%), Positives = 92/200 (46%), Gaps = 6/200 (3%)

Query: 6   NKIIKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQR-HIQLIITEPIT 64
            K+I   +    L +  C+S  +      P  IY        D S  R    L I  P  
Sbjct: 1   MKLIHPLVCLSVLTLASCSS--TLLGEKKPTTIYSPQIHVTTDPSWPRVTWHLTILHPKA 58

Query: 65  EKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYA 124
            +++++  I V+ +P EIQ      W+     M++  LI  FE++GKI+ V +   GI  
Sbjct: 59  PRMIDTPRINVQPTPGEIQVYHNVSWAQPTTDMLEDALIRVFEDSGKIAGVTRAGTGIRT 118

Query: 125 DYQIISAIRSFEINIDR---HCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFI 181
           DY +   +R FE +        A I ++ K+I+AH+  L+  + F V +     +     
Sbjct: 119 DYSLSLDLRRFESDYAGTPMPTATIEVNAKLISAHNKRLIASRTFIVTQPATNTDTSTVA 178

Query: 182 QSLNRAFSRISSEIIDWTLS 201
            +  +A +++++E++ WTL+
Sbjct: 179 NAFGQALTQLTNELVGWTLT 198


>gi|325928561|ref|ZP_08189749.1| ABC-type uncharacterized transport system, auxiliary component
           [Xanthomonas perforans 91-118]
 gi|325541100|gb|EGD12654.1| ABC-type uncharacterized transport system, auxiliary component
           [Xanthomonas perforans 91-118]
          Length = 214

 Score =  189 bits (480), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 48/201 (23%), Positives = 100/201 (49%), Gaps = 6/201 (2%)

Query: 6   NKIIKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTE-STKYDESVQRHIQLIITEPIT 64
            ++++  + +  LA+  C+ L+       P  IY  T   T      Q   QL++ +P  
Sbjct: 4   MRVLRPLLCASLLALGGCSVLTGG--DQKPATIYAPTVRVTPNPNWPQVTWQLVVAKPSA 61

Query: 65  EKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYA 124
            ++++S  I VR +P E+Q   G+ W+     M++  ++  FE++GKI+ V     GI +
Sbjct: 62  ARVIDSPRINVRPTPGELQVYHGAGWAQPATDMLEDSVVRAFEDSGKIAAVAHIGTGIRS 121

Query: 125 DYQIISAIRSFEINIDR---HCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFI 181
           DY++   +R FE +        A I ++ K++++ D  +V  + F V       +     
Sbjct: 122 DYKLAIDLRRFESDYAGQSLPSATIELNAKLLHSTDQRVVASRTFLVARLSTGTDTAAVA 181

Query: 182 QSLNRAFSRISSEIIDWTLSS 202
            +  +A +++++E++ WTL++
Sbjct: 182 VAFEQALTQVTTELVGWTLTA 202


>gi|167031176|ref|YP_001666407.1| lipoprotein [Pseudomonas putida GB-1]
 gi|166857664|gb|ABY96071.1| lipoprotein [Pseudomonas putida GB-1]
          Length = 211

 Score =  189 bits (479), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 30/179 (16%), Positives = 79/179 (44%), Gaps = 3/179 (1%)

Query: 27  SSCFFHNNPVNIYDLTESTKYDESVQRHIQLIITEPITEKILNSEDIIVRSSPIEIQYLI 86
            S    + PV++Y L  +     +      L + +P+  ++L    I V      +    
Sbjct: 20  CSILPKSEPVDLYRLPVNQPSRTAPALDWSLRLNKPLASEVLAGPRIAVIPQGDMVSSYK 79

Query: 87  GSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFEINIDRHCA-- 144
           G++WSD  P +++ +L+  F+ +G++  +   +  + ADY++   +++F+       A  
Sbjct: 80  GARWSDAAPVLLRNRLLDGFQRDGQVQRLSADDSNLQADYELAGELQAFQSEYRPGGAVE 139

Query: 145 -IITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEIIDWTLSS 202
            +I    +++   +  ++  K F + + L        +    +A  ++  +++ WT++ 
Sbjct: 140 VVIRYDARLVQGRNQRILASKRFEIRQPLTDKQVSAVVIGFGQASDQLVGQVVSWTIAQ 198


>gi|114707112|ref|ZP_01440010.1| hypothetical protein FP2506_04376 [Fulvimarina pelagi HTCC2506]
 gi|114537308|gb|EAU40434.1| hypothetical protein FP2506_04376 [Fulvimarina pelagi HTCC2506]
          Length = 193

 Score =  189 bits (479), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 62/191 (32%), Positives = 110/191 (57%), Gaps = 2/191 (1%)

Query: 13  IISCSLAVLLCTSLSSCFFHNNPVNIYDLTEST-KYDESVQRHIQLIITEPITEKILNSE 71
           ++  S  ++L  +L        P+  ++++              QL+I EP   K ++SE
Sbjct: 1   MMRVSRLIVLAATLLGIGACTPPLETFEISAPPLGRPAPGATRAQLLIPEPTAIKTIDSE 60

Query: 72  DIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISA 131
            I+V+ +P  ++YL  SQWSD+LPRM+QL+L+  FEN G++  V  P QG+  DYQII  
Sbjct: 61  RIVVKPTPYSVEYLADSQWSDRLPRMVQLRLLQAFENTGQVGAVGVPGQGLAIDYQIILE 120

Query: 132 IRSFEIN-IDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSR 190
           IR FE++ ++   A+I +S+K ++  + ++   ++F     +       F+ +++RAF +
Sbjct: 121 IRRFEVDVVNERQAVIEISVKALDDRNGTVRRTQIFTGRAPVAGSGNSAFVAAIDRAFDQ 180

Query: 191 ISSEIIDWTLS 201
           +SSEI+ WTL+
Sbjct: 181 VSSEIVAWTLA 191


>gi|319783792|ref|YP_004143268.1| hypothetical protein Mesci_4105 [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317169680|gb|ADV13218.1| protein of unknown function DUF330 [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 235

 Score =  188 bits (478), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 51/175 (29%), Positives = 97/175 (55%), Gaps = 2/175 (1%)

Query: 30  FFHNNPVNIYDLTESTKYDESVQRHIQLIITEPITEKILNSEDIIVRSSPIEIQYLIGSQ 89
                P++ ++L+  +  D       Q++I +P   K L+S++I+++ S   IQYL G+Q
Sbjct: 62  GGKPAPLDTFELSAPS-VDAHGHSRRQILIAQPSALKALDSQNIVIKPSDRSIQYLKGAQ 120

Query: 90  WSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFEINIDRHC-AIITM 148
           W+D+LP ++Q +L   F+ +G  + V KP +G+  DYQ+I  IRSFE+ +D    A + +
Sbjct: 121 WADRLPLIVQARLAETFQRSGSFAGVGKPGEGLAIDYQVIVEIRSFEVRVDGGEHAEVDL 180

Query: 149 SLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEIIDWTLSSL 203
            ++I+N  +  +   K F     +       ++ +L++AF   + +I+ WT S +
Sbjct: 181 FVRILNDRNGEVRASKSFTAAAPVSGSGNPAYVSALDKAFGDAAGQIVRWTDSVI 235


>gi|15837901|ref|NP_298589.1| hypothetical protein XF1300 [Xylella fastidiosa 9a5c]
 gi|9106291|gb|AAF84109.1|AE003963_6 conserved hypothetical protein [Xylella fastidiosa 9a5c]
          Length = 213

 Score =  188 bits (477), Expect = 5e-46,   Method: Composition-based stats.
 Identities = 50/200 (25%), Positives = 91/200 (45%), Gaps = 6/200 (3%)

Query: 6   NKIIKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQR-HIQLIITEPIT 64
            K+I   +    L +  C+S  +      P  IY        D S  R    L +  P  
Sbjct: 1   MKLIHPLVCLSVLTLASCSS--TLLGEKKPTTIYSPQIHVTTDPSWPRVTWHLTVLHPKA 58

Query: 65  EKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYA 124
            +++++  I V+ +P EIQ      W+     M++  LI  FE++GKI+ V +   GI  
Sbjct: 59  PRMIDTPRINVQPTPGEIQVYRNVSWAQPTTDMLEDALIRVFEDSGKIAGVTRAGTGIRT 118

Query: 125 DYQIISAIRSFEINIDR---HCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFI 181
           DY +   +R FE +        A I ++ K+I AH+  L+  + F V +     +     
Sbjct: 119 DYSLSLDLRRFESDYAGTPMPTATIEVNAKLIGAHNKRLIASRTFIVTQPATNTDTSTVA 178

Query: 182 QSLNRAFSRISSEIIDWTLS 201
            +  +A +++++E++ WTL+
Sbjct: 179 NAFGQALTQLTNELVGWTLT 198


>gi|21230107|ref|NP_636024.1| hypothetical protein XCC0632 [Xanthomonas campestris pv. campestris
           str. ATCC 33913]
 gi|66769902|ref|YP_244664.1| hypothetical protein XC_3602 [Xanthomonas campestris pv. campestris
           str. 8004]
 gi|21111635|gb|AAM39948.1| conserved hypothetical protein [Xanthomonas campestris pv.
           campestris str. ATCC 33913]
 gi|66575234|gb|AAY50644.1| conserved hypothetical protein [Xanthomonas campestris pv.
           campestris str. 8004]
          Length = 214

 Score =  187 bits (475), Expect = 8e-46,   Method: Composition-based stats.
 Identities = 49/199 (24%), Positives = 98/199 (49%), Gaps = 6/199 (3%)

Query: 6   NKIIKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTE-STKYDESVQRHIQLIITEPIT 64
            ++++  +    LA+  C+ L+       P  IY  T   T      Q   QL++ +P  
Sbjct: 4   MRLLRPLLCVSLLALGGCSVLTGG--DQKPATIYAPTVRVTPNPAWPQVSWQLLVAKPSA 61

Query: 65  EKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYA 124
            +I++S  I VR +P E+Q   G+ W+     M++  ++  FE++GKI+ V +   GI +
Sbjct: 62  ARIIDSPRINVRPTPGELQVYHGAGWAQPATDMLEDSVVRAFEDSGKIAAVARIGAGIRS 121

Query: 125 DYQIISAIRSFEINIDR---HCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFI 181
           DY++   +R FE +        A I ++ K++++ D  +V  + F V       +     
Sbjct: 122 DYKLAIDVRRFESDYAGQSLPAATIELNAKLLHSSDQRVVASRTFTVARPSSSTDTAAVA 181

Query: 182 QSLNRAFSRISSEIIDWTL 200
            +  +A +++++E++ WTL
Sbjct: 182 AAFEQALTQVTTELVGWTL 200


>gi|152984731|ref|YP_001347293.1| putative lipoprotein [Pseudomonas aeruginosa PA7]
 gi|150959889|gb|ABR81914.1| lipoprotein, putative [Pseudomonas aeruginosa PA7]
          Length = 214

 Score =  187 bits (474), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 39/203 (19%), Positives = 89/203 (43%), Gaps = 4/203 (1%)

Query: 7   KIIKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTE--STKYDESVQRHIQLIITEPIT 64
           + +++  ++  L V       S       + +Y L          +      L I  P T
Sbjct: 6   RPLRRLSLAAGLVVFATLGACSILPEAQVLQVYLLPVHNPPASAVARPVDWSLRIARPRT 65

Query: 65  EKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYA 124
             +L S  I VR    EI    G++WSD  P +++ +L+  F+ +G++  +   +  + A
Sbjct: 66  SLVLESPRIAVRPQGDEISVYQGARWSDPAPALLRDRLMQAFQADGRVRGLSSDDSNLQA 125

Query: 125 DYQIISAIRSFEINI--DRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQ 182
           D+++   +R+F+      +  A+I    +++ + D  ++  + F V + ++       + 
Sbjct: 126 DFELGGDLRAFQTEYPNGQATALIRYDARLVRSDDKRVIASRRFEVRQPVDGRKVPEVVS 185

Query: 183 SLNRAFSRISSEIIDWTLSSLPL 205
           +  +A   +S++++DWTL     
Sbjct: 186 AFGKAADTLSAQVLDWTLRQAAA 208


>gi|15965583|ref|NP_385936.1| hypothetical protein SMc00177 [Sinorhizobium meliloti 1021]
 gi|307302703|ref|ZP_07582459.1| protein of unknown function DUF330 [Sinorhizobium meliloti BL225C]
 gi|307318551|ref|ZP_07597985.1| protein of unknown function DUF330 [Sinorhizobium meliloti AK83]
 gi|15074764|emb|CAC46409.1| Hypothetical protein SMc00177 [Sinorhizobium meliloti 1021]
 gi|306895891|gb|EFN26643.1| protein of unknown function DUF330 [Sinorhizobium meliloti AK83]
 gi|306903067|gb|EFN33658.1| protein of unknown function DUF330 [Sinorhizobium meliloti BL225C]
          Length = 204

 Score =  186 bits (473), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 62/194 (31%), Positives = 107/194 (55%), Gaps = 2/194 (1%)

Query: 11  KKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIITEPITEKILNS 70
                 ++ + L   L+ C       + + L      +     + QL++ EP   K L S
Sbjct: 12  AAASRSAVVLALAAILAGCGSRQAANDTFSLASVPAVERPGATNRQLLVPEPTALKTLGS 71

Query: 71  EDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIIS 130
           + I+VR S  E+QYL  +QW D LPRM+Q +L+  F+N G+I  V KP QG+  DYQ+I+
Sbjct: 72  DQIVVRLSRSELQYLARAQWGDSLPRMVQDRLVQTFDNTGRIR-VGKPGQGLAIDYQLIT 130

Query: 131 AIRSFEINIDR-HCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFS 189
            +R+FEI+ D    A++ +  KI++  + ++  Q+ F     +       F+ +L+ AF+
Sbjct: 131 ELRAFEISTDGAATAVVEIFAKILDDRNGTVRKQQAFRAVVPVRGAGNPAFVAALDAAFA 190

Query: 190 RISSEIIDWTLSSL 203
           R++++I+ WTLSS+
Sbjct: 191 RVAADIVGWTLSSI 204


>gi|238789960|ref|ZP_04633739.1| hypothetical protein yfred0001_37270 [Yersinia frederiksenii ATCC
           33641]
 gi|238721908|gb|EEQ13569.1| hypothetical protein yfred0001_37270 [Yersinia frederiksenii ATCC
           33641]
          Length = 205

 Score =  186 bits (473), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 37/197 (18%), Positives = 93/197 (47%), Gaps = 5/197 (2%)

Query: 12  KIISCSLAVLLCTSLSSCFFHNNPVNIYDLT--ESTKYDESVQRHIQLIITEPITEKILN 69
           ++++ S+ V+L ++  +         +Y L    +T    +   +  L +++P T + +N
Sbjct: 9   RLLTASMLVMLLSA-CTILPTAPVAQVYLLPVPPATNTPRTQTVNWSLRVSQPATNQFIN 67

Query: 70  SEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQII 129
           S  I V+    EI     S+W+D  P +++ +LI  F  +G+IS V   +  + AD ++ 
Sbjct: 68  SSRIAVQPEGQEIAVYKNSRWTDPAPILLRNRLIHEFRTDGRISAVSSDDDSLQADVELS 127

Query: 130 SAIRSFE--INIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRA 187
             + +F+          +I    +++   D  ++  + F + + ++       + +   A
Sbjct: 128 GDLSAFQGVYQAGNSEVLIRFDARLVRISDRRIIATRHFEIRQPIKGSQMNEVVDAFGLA 187

Query: 188 FSRISSEIIDWTLSSLP 204
            +++++++++WTL   P
Sbjct: 188 SNQLATQVLNWTLQQSP 204


>gi|325273985|ref|ZP_08140144.1| ABC transporter auxiliary component-like protein [Pseudomonas sp.
           TJI-51]
 gi|324100874|gb|EGB98561.1| ABC transporter auxiliary component-like protein [Pseudomonas sp.
           TJI-51]
          Length = 205

 Score =  186 bits (473), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 33/202 (16%), Positives = 83/202 (41%), Gaps = 3/202 (1%)

Query: 8   IIKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIITEPITEKI 67
           +     +      +  TS  S    + PV++Y L  +     +      L + +P+  ++
Sbjct: 1   MKSSLRLVALAVTIGLTSACSILPTSEPVDLYRLPVNQVSRSAPPLDWSLRLNKPLASEV 60

Query: 68  LNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQ 127
           L    I V      +    G++WSD  P +++ +L+  F+ +G++  +   +  + ADY+
Sbjct: 61  LAGPRIAVIPQGNVVSSYKGARWSDPAPMLLRNRLLDGFQRDGQVQRLSADDSNLQADYE 120

Query: 128 IISAIRSFEINI---DRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSL 184
           +   +++F+           +I    +++      ++  K F V + L        +   
Sbjct: 121 LAGELQAFQSEYRADGTVEVVIRYDARLVQGRTQRILASKRFEVRQPLADKQVAGVVAGF 180

Query: 185 NRAFSRISSEIIDWTLSSLPLS 206
            +A   ++ +++DW ++    S
Sbjct: 181 GQACDLLTGQVVDWAIAQAGSS 202


>gi|325915747|ref|ZP_08178049.1| ABC-type uncharacterized transport system, auxiliary component
           [Xanthomonas vesicatoria ATCC 35937]
 gi|325538011|gb|EGD09705.1| ABC-type uncharacterized transport system, auxiliary component
           [Xanthomonas vesicatoria ATCC 35937]
          Length = 214

 Score =  186 bits (473), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 48/201 (23%), Positives = 98/201 (48%), Gaps = 6/201 (2%)

Query: 6   NKIIKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTE-STKYDESVQRHIQLIITEPIT 64
            ++++  +    LA+  C+ L+       P  IY  T   T      Q   QL + +P  
Sbjct: 4   MRLLRPLLCVSLLALGGCSVLTGG--DKKPATIYAPTVRVTPNPTWPQVTWQLAVAKPSA 61

Query: 65  EKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYA 124
            +I++S  I VR +P E+Q   G+ W+     M++  ++  FE++GKI+ V +   GI +
Sbjct: 62  ARIIDSPRINVRPTPGELQVYHGAGWAQPATDMLEDSVVRAFEDSGKIAAVARIGAGIRS 121

Query: 125 DYQIISAIRSFEINIDR---HCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFI 181
           DY++   +R FE +        A I ++ K++++ D  +   + F V       +     
Sbjct: 122 DYKLAIDVRRFEADYAGQSVPSATIELNAKLLHSSDQRVAASRTFLVARPSTSTDIAAVA 181

Query: 182 QSLNRAFSRISSEIIDWTLSS 202
            +  +A +++++E++ WTL++
Sbjct: 182 AAFEQALTQVTTELVGWTLTT 202


>gi|313496510|gb|ADR57876.1| Putative lipoprotein [Pseudomonas putida BIRD-1]
          Length = 211

 Score =  186 bits (472), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 29/177 (16%), Positives = 79/177 (44%), Gaps = 3/177 (1%)

Query: 29  CFFHNNPVNIYDLTESTKYDESVQRHIQLIITEPITEKILNSEDIIVRSSPIEIQYLIGS 88
               + PV++Y L  +     +      L + +P+  ++L    I V      +    G+
Sbjct: 22  ILPQSEPVDLYRLPVNQPSRTAPPLDWSLRLNKPLASEVLAGPRIAVVPQGNVVSSYKGA 81

Query: 89  QWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFEINIDRHCA---I 145
           +WSD  P +++ +L+  F+  G++  +   +  + ADY++   +++F+       A   +
Sbjct: 82  RWSDAAPVLLRNRLLDGFQREGQVQRLSADDSNLQADYELAGELQAFQSEYRTDGAVEVV 141

Query: 146 ITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEIIDWTLSS 202
           I    +++   +  ++  K F + + L+       +    +A  ++  ++++WT++ 
Sbjct: 142 IRYDARLVQGRNQRILASKRFEIRQPLDDKQVSAVVAGFGQASDQLVGQVVNWTITQ 198


>gi|158423840|ref|YP_001525132.1| ABC-type uncharacterized transport system protein [Azorhizobium
           caulinodans ORS 571]
 gi|158330729|dbj|BAF88214.1| ABC-type uncharacterized transport system protein [Azorhizobium
           caulinodans ORS 571]
          Length = 208

 Score =  185 bits (471), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 51/190 (26%), Positives = 97/190 (51%), Gaps = 4/190 (2%)

Query: 15  SCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIITEPITEKILNSEDII 74
              L V L  +L+ C   + P+  YDL+  T +      + QL++  P    +L+SE I+
Sbjct: 19  RAVLGVFLTLALAGC--ASAPIPTYDLSAPTGFAARGGGNGQLVVVTPTALAVLDSEKIV 76

Query: 75  VRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRS 134
           V  +P ++ YL  +QWSD+L  ++Q + I  FEN+ +   V +P  G+  DYQ+   +RS
Sbjct: 77  VEPTPGQVTYLPEAQWSDRLTSLLQARTIQAFENSSRQRRVARPGDGVTGDYQLNMDVRS 136

Query: 135 FEINI--DRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRIS 192
           F I +  +   A++ +S K+I      +V  ++F     +   +      +L++A +++ 
Sbjct: 137 FGIKVLPEGTFAVVEISAKLIATQTGRIVSARIFSARVPVASVSGTSATTALDQASNQVL 196

Query: 193 SEIIDWTLSS 202
            E++ W   +
Sbjct: 197 MELVRWANGA 206


>gi|123441587|ref|YP_001005573.1| hypothetical protein YE1250 [Yersinia enterocolitica subsp.
           enterocolitica 8081]
 gi|122088548|emb|CAL11342.1| putative exported protein [Yersinia enterocolitica subsp.
           enterocolitica 8081]
          Length = 211

 Score =  185 bits (471), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 37/206 (17%), Positives = 89/206 (43%), Gaps = 4/206 (1%)

Query: 3   KKLNKIIKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTEST--KYDESVQRHIQLIIT 60
           K ++   ++  +     + +     +         +Y L          +   +  L ++
Sbjct: 5   KIMHSSSRRMGLLMLSVLTMLLPACTILPTAPVSQVYLLPVPPAANAPRAQTVNWSLRVS 64

Query: 61  EPITEKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQ 120
           +P T + +NS  I V+    EI     S+W+D  P +++ +LI  F  NG+I  V   + 
Sbjct: 65  QPATNQFINSSRIAVQPEGQEIAVYKNSRWTDPAPILVRNRLIQEFRANGRIPAVSSDDD 124

Query: 121 GIYADYQIISAIRSFE--INIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKL 178
            + AD ++   + +F+   + D    +I    +++   D  ++  + F V + ++     
Sbjct: 125 SLQADVELSGDLSAFQGVYHADSSEVLIRFDARLVRISDRRIMATRHFEVRQPIKGAQMN 184

Query: 179 HFIQSLNRAFSRISSEIIDWTLSSLP 204
             + +   A ++++S++++WTL   P
Sbjct: 185 EVVDAFGLASNQLASQVLNWTLQQSP 210


>gi|188993117|ref|YP_001905127.1| Putative secreted protein [Xanthomonas campestris pv. campestris
           str. B100]
 gi|167734877|emb|CAP53089.1| Putative secreted protein [Xanthomonas campestris pv. campestris]
          Length = 214

 Score =  185 bits (470), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 49/199 (24%), Positives = 97/199 (48%), Gaps = 6/199 (3%)

Query: 6   NKIIKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTE-STKYDESVQRHIQLIITEPIT 64
            ++++  +    LA+  C+ L+       P  IY  T   T      Q   QL + +P  
Sbjct: 4   MRLLRPLLCVSLLALGGCSVLTGG--DQKPATIYAPTVRVTPNPAWPQVSWQLSVAKPSA 61

Query: 65  EKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYA 124
            +I++S  I VR +P E+Q   G+ W+     M++  ++  FE++GKI+ V +   GI +
Sbjct: 62  ARIIDSPRINVRPTPGELQVYHGAGWAQPATDMLEDSVVRAFEDSGKIAAVARIGAGIRS 121

Query: 125 DYQIISAIRSFEINIDR---HCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFI 181
           DY++   +R FE +        A I ++ K++++ D  +V  + F V       +     
Sbjct: 122 DYKLAIDVRRFESDYAGQSLPAATIELNAKLLHSSDQRVVASRTFTVARPSSSTDTAAVA 181

Query: 182 QSLNRAFSRISSEIIDWTL 200
            +  +A +++++E++ WTL
Sbjct: 182 AAFEQAMTQVTTELVGWTL 200


>gi|146305410|ref|YP_001185875.1| hypothetical protein Pmen_0370 [Pseudomonas mendocina ymp]
 gi|145573611|gb|ABP83143.1| protein of unknown function DUF330 [Pseudomonas mendocina ymp]
          Length = 199

 Score =  185 bits (470), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 42/180 (23%), Positives = 93/180 (51%), Gaps = 2/180 (1%)

Query: 25  SLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIITEPITEKILNSEDIIVRSSPIEIQY 84
              S    + P++IY L  +    +S +    L I  P + ++L+   I+V   P  +  
Sbjct: 14  GACSILPQSEPLDIYLLPAAQLPAQSQRVDWALRINSPSSSQLLDGTRIVVLPEPDRVNT 73

Query: 85  LIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSF--EINIDRH 142
             G +WS++ P++++ +L+  F+++G+I  +    Q + AD +++S +RSF  E      
Sbjct: 74  YQGVRWSERTPQLLRNRLLDAFQDDGRIQALSNEEQRLQADLELVSDLRSFHSEYRDGIP 133

Query: 143 CAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEIIDWTLSS 202
            A+I + + +++A D  ++  + F + ++    +    I +  +A  ++S E++DWTL+ 
Sbjct: 134 YALIRLEVNLVDARDQRILASRRFSISQQASDTSVPAVIAAFGQAGDQLSRELVDWTLNQ 193


>gi|26986884|ref|NP_742309.1| putative lipoprotein [Pseudomonas putida KT2440]
 gi|24981487|gb|AAN65773.1|AE016203_6 lipoprotein, putative [Pseudomonas putida KT2440]
          Length = 211

 Score =  185 bits (470), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 29/177 (16%), Positives = 78/177 (44%), Gaps = 3/177 (1%)

Query: 29  CFFHNNPVNIYDLTESTKYDESVQRHIQLIITEPITEKILNSEDIIVRSSPIEIQYLIGS 88
               + PV+ Y L  +     +      L + +P+  ++L    I V      +    G+
Sbjct: 22  ILPQSEPVDHYRLPVNQPSRTAPPLDWSLRLNKPLASEVLAGPRIAVVPQGNVVSSYKGA 81

Query: 89  QWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFEINIDRHCA---I 145
           +WSD  P +++ +L+  F+  G++  +   +  + ADY++   +++F+       A   +
Sbjct: 82  RWSDAAPVLLRNRLLDGFQREGQVQRLSADDSNLQADYELAGELQAFQSEYRTDGAVEVV 141

Query: 146 ITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEIIDWTLSS 202
           I    +++   +  ++  K F + + L+       +    +A  ++  ++++WT++ 
Sbjct: 142 IRYDARLVQGRNQRILASKRFEIRQPLDDKQVSAVVAGFGQASDQLVGQVVNWTITQ 198


>gi|238791987|ref|ZP_04635623.1| hypothetical protein yinte0001_8870 [Yersinia intermedia ATCC
           29909]
 gi|238728618|gb|EEQ20136.1| hypothetical protein yinte0001_8870 [Yersinia intermedia ATCC
           29909]
          Length = 207

 Score =  185 bits (470), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 35/200 (17%), Positives = 87/200 (43%), Gaps = 4/200 (2%)

Query: 10  KKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQ--RHIQLIITEPITEKI 67
           ++  +       +  S  +         +Y L              +  L +++P T + 
Sbjct: 6   RRVWLLMISGGAILLSACTILPSAPVSQVYLLPVPPAVSAPHAQTVNWSLRVSQPATNQF 65

Query: 68  LNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQ 127
           LNS  I V+    EI     S+WSD  P +++ +LI  F ++G+I  V   +  + AD +
Sbjct: 66  LNSSRIAVQPQGQEIAVYKNSRWSDSAPILVRNRLIQAFRSDGRIRAVSSDDDSLQADVE 125

Query: 128 IISAIRSFE--INIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLN 185
           +   + +F+   ++     +I    +++   D  ++  + F + + ++ +     +Q+  
Sbjct: 126 LSGDLSAFQGVYHVGSSEVLIRFDARLVRISDRRIIATRQFEIRQPIKGNEMNEVVQAFG 185

Query: 186 RAFSRISSEIIDWTLSSLPL 205
            A  ++++++++WT+   P 
Sbjct: 186 LASDQLATQVLNWTMQQSPA 205


>gi|170724245|ref|YP_001751933.1| hypothetical protein PputW619_5088 [Pseudomonas putida W619]
 gi|169762248|gb|ACA75564.1| protein of unknown function DUF330 [Pseudomonas putida W619]
          Length = 207

 Score =  184 bits (468), Expect = 5e-45,   Method: Composition-based stats.
 Identities = 31/179 (17%), Positives = 80/179 (44%), Gaps = 3/179 (1%)

Query: 27  SSCFFHNNPVNIYDLTESTKYDESVQRHIQLIITEPITEKILNSEDIIVRSSPIEIQYLI 86
            S    + PV+IY L  +     +      L + +P+  ++L    I V      +    
Sbjct: 20  CSILPQSEPVDIYRLPVNQASHSATPVPWSLRLNKPLASEVLAGPRIAVIPKGDVVSSYK 79

Query: 87  GSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFEINIDRH---C 143
           G++WSD +P +++ +L+  F+ +G++  +   +  + ADY++   +++F+          
Sbjct: 80  GARWSDPVPLLLRNRLLDGFQRDGRVQRLSADDSNLQADYELAGELQAFQSEYRPTGTVE 139

Query: 144 AIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEIIDWTLSS 202
            +I    +++      ++  K F V + L        +     A  ++++++++WT++ 
Sbjct: 140 VVIRYDARLVQGRSQRILASKRFEVRQPLVDTQVSAVVAGFGVANDQLAAQVVNWTVAQ 198


>gi|298292074|ref|YP_003694013.1| hypothetical protein Snov_2098 [Starkeya novella DSM 506]
 gi|296928585|gb|ADH89394.1| protein of unknown function DUF330 [Starkeya novella DSM 506]
          Length = 223

 Score =  184 bits (468), Expect = 6e-45,   Method: Composition-based stats.
 Identities = 52/193 (26%), Positives = 97/193 (50%), Gaps = 6/193 (3%)

Query: 16  CSLAVLLCTSLSSCFF----HNNPVNIYDLTESTKYDESVQRHIQLIITEPITEKILNSE 71
           C+  + +  +L  C       +  V  +DLT  + ++   +    L++  P    +L++E
Sbjct: 30  CAGTLAVALTLGGCGAILAGGDKSVPTFDLTAPSDFNAPRRGTGLLVVGPPTALAVLDTE 89

Query: 72  DIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISA 131
            I+V  +P +I YL G+QWSD+LP + Q +LI +FEN  +  +V +   G+ ADY +++ 
Sbjct: 90  RIVVEPAPGQITYLSGAQWSDRLPALFQARLIESFENGNRARSVGRAGDGLTADYTLLTD 149

Query: 132 IRSF--EINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFS 189
           +RSF  + +     A++ +S KI+ A    +   +VF         +     Q+L+ A  
Sbjct: 150 LRSFGLQTSDGGPVAVVEVSAKIVGATSGRIAAAQVFKASAPAASTSGPQATQALDAASD 209

Query: 190 RISSEIIDWTLSS 202
           ++  EI+ W  S 
Sbjct: 210 QVFIEIVRWASSR 222


>gi|300917990|ref|ZP_07134616.1| lipofamily protein [Escherichia coli MS 115-1]
 gi|300414816|gb|EFJ98126.1| lipofamily protein [Escherichia coli MS 115-1]
          Length = 213

 Score =  184 bits (467), Expect = 6e-45,   Method: Composition-based stats.
 Identities = 35/200 (17%), Positives = 89/200 (44%), Gaps = 4/200 (2%)

Query: 10  KKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLT--ESTKYDESVQRHIQLIITEPITEKI 67
           ++  +       +  S  +         +Y L    +     +   +  L +++P T + 
Sbjct: 12  RRVWLLMISGGAILLSACTILPSAPVSQVYLLPVPPAVSVPHAQTVNWSLRVSQPATNQF 71

Query: 68  LNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQ 127
           LNS  I V+    EI     S+WSD  P +++ +LI  F ++G+I  V   +  + AD +
Sbjct: 72  LNSSRIAVQPQGQEIAVYKNSRWSDSAPILVRNRLIQAFRSDGRIRAVSSDDDSLQADVE 131

Query: 128 IISAIRSFE--INIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLN 185
           +   + +F+   ++     +I    +++   D  ++  + F + + ++ +     +Q+  
Sbjct: 132 LSGDLSAFQGVYHVGSSEVLIRFDARLVRISDRRIIATRQFDIRQPIKGNEMNEVVQAFG 191

Query: 186 RAFSRISSEIIDWTLSSLPL 205
            A  ++++++++WT+   P 
Sbjct: 192 LASDQLATQVLNWTMQQSPA 211


>gi|332162487|ref|YP_004299064.1| hypothetical protein YE105_C2865 [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|318606567|emb|CBY28065.1| membrane lipoprotein lipid attachment site containing protein
           USSDB6D [Yersinia enterocolitica subsp. palearctica Y11]
 gi|325666717|gb|ADZ43361.1| hypothetical protein YE105_C2865 [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|330861185|emb|CBX71442.1| hypothetical protein YEW_CA08670 [Yersinia enterocolitica W22703]
          Length = 211

 Score =  184 bits (467), Expect = 7e-45,   Method: Composition-based stats.
 Identities = 35/206 (16%), Positives = 86/206 (41%), Gaps = 4/206 (1%)

Query: 3   KKLNKIIKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTEST--KYDESVQRHIQLIIT 60
           K ++   +   +     + +  S  +         +Y L          +   +  L ++
Sbjct: 5   KIMHSTGRGTRLLMLSGLAMLLSACTILPSAPVSQVYLLPVPPAANAPRAQAVNWSLRVS 64

Query: 61  EPITEKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQ 120
           +P T + +NS  I V+    EI     S+W+D  P +++ +LI  F  +G+I  V   + 
Sbjct: 65  QPATNQFINSSRIAVQPEGQEIAVYKNSRWTDPAPILVRNRLIQEFRTDGRIPAVSSDDD 124

Query: 121 GIYADYQIISAIRSFE--INIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKL 178
            + AD ++   + +F+          +I    +++   D  ++  + F V + ++     
Sbjct: 125 SLQADVELSGDLSAFQGVYQAGNSEVLIRFDARLVRISDRRIMATRHFEVRQPIKGAQMN 184

Query: 179 HFIQSLNRAFSRISSEIIDWTLSSLP 204
             + +   A ++++S++++W L   P
Sbjct: 185 EVVDAFGLASNQLASQVLNWALQQSP 210


>gi|110633896|ref|YP_674104.1| ABC-type uncharacterized transport system auxiliary component-like
           [Mesorhizobium sp. BNC1]
 gi|110284880|gb|ABG62939.1| ABC-type uncharacterized transport system auxiliary component-like
           protein [Chelativorans sp. BNC1]
          Length = 228

 Score =  184 bits (466), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 55/192 (28%), Positives = 107/192 (55%), Gaps = 3/192 (1%)

Query: 11  KKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTEST-KYDESVQRHIQLIITEPITEKILN 69
             ++  SL +  C ++        PV++YDLT    +   + +   Q+++ EP   KIL+
Sbjct: 37  SGLVILSLMLGGCAAIPGFGPA--PVDVYDLTAPALQLAAARRARTQVLVPEPEALKILD 94

Query: 70  SEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQII 129
            EDI +R+S   +Q L G++WSD+LPR++Q  L+  ++ +G  + V +P +G+  DYQ+I
Sbjct: 95  GEDIAIRTSTGALQLLGGARWSDRLPRLVQSGLVEAYQKSGSFAGVGRPGEGLAIDYQVI 154

Query: 130 SAIRSFEINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFS 189
             IR+FE+ +    A + + +++++     +   + F     +     + F+ +LN+AF+
Sbjct: 155 VDIRTFEVQVGNGLAQVQLFVRVLDDRTGQVRASRDFTTSAPVVGSGDVAFVAALNQAFN 214

Query: 190 RISSEIIDWTLS 201
             + EI+DW+ S
Sbjct: 215 AATREIVDWSRS 226


>gi|313108531|ref|ZP_07794532.1| putative ABC-type uncharacterized transport system [Pseudomonas
           aeruginosa 39016]
 gi|310881034|gb|EFQ39628.1| putative ABC-type uncharacterized transport system [Pseudomonas
           aeruginosa 39016]
          Length = 210

 Score =  183 bits (464), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 39/190 (20%), Positives = 81/190 (42%), Gaps = 4/190 (2%)

Query: 20  VLLCTSLSSCFFHNNPVNIYDLTE--STKYDESVQRHIQLIITEPITEKILNSEDIIVRS 77
            L      S       + +Y L          +      L I  P T  +L S  I VR 
Sbjct: 15  ALATLGACSILPEAQVLQVYLLPVHNPPASAAARPVDWSLRIARPRTSLVLESPRIAVRP 74

Query: 78  SPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFEI 137
              EI    G++WSD  P +++ +L+  F+ +G++  +   +  + AD+++   +R+F+ 
Sbjct: 75  HGDEISVYQGARWSDPAPSLLRDRLMQAFQADGRVRGLSSDDSNLQADFELGGDLRAFQT 134

Query: 138 NI--DRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEI 195
                +  A+I    +++   D  +V  + F V + ++       + +  +A   +S+++
Sbjct: 135 EYPNGQASALIRYDARLVRTDDKRVVASRRFEVSQPVDGKKVAAVVSAFGKAGDTLSAQV 194

Query: 196 IDWTLSSLPL 205
           +DWTL     
Sbjct: 195 LDWTLRQASA 204


>gi|21244298|ref|NP_643880.1| hypothetical protein XAC3573 [Xanthomonas axonopodis pv. citri str.
           306]
 gi|21109948|gb|AAM38416.1| conserved hypothetical protein [Xanthomonas axonopodis pv. citri
           str. 306]
          Length = 211

 Score =  182 bits (462), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 46/185 (24%), Positives = 91/185 (49%), Gaps = 6/185 (3%)

Query: 22  LCTSLSSCFFHNNPVNIYDLTES-TKYDESVQRHIQLIITEPITEKILNSEDIIVRSSPI 80
            C+ L+       P  IY  T   T      Q   QL++ +P   ++++S  I VR +P 
Sbjct: 17  GCSVLTGG--DQKPATIYAPTVRMTPNPAWPQVTWQLVVAKPSAARVIDSPRINVRPTPG 74

Query: 81  EIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFEINID 140
           E+Q   G+ W+     M++  ++  FE++GKI+ V     GI +DY++   +R FE +  
Sbjct: 75  ELQVYHGAGWAQPATDMLEDSVVRAFEDSGKIAAVAHIGTGIRSDYKLAIDLRRFESDYA 134

Query: 141 R---HCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEIID 197
                 A I ++ K++++ D  +V  + F V       +      +  +A +++++E++ 
Sbjct: 135 GQSLPSATIELNAKLLHSADQRVVASRTFLVARPSTGTDTAAVAMAFEQALTQLTTELVG 194

Query: 198 WTLSS 202
           WTL++
Sbjct: 195 WTLTT 199


>gi|330501343|ref|YP_004378212.1| hypothetical protein MDS_0429 [Pseudomonas mendocina NK-01]
 gi|328915629|gb|AEB56460.1| hypothetical protein MDS_0429 [Pseudomonas mendocina NK-01]
          Length = 199

 Score =  182 bits (461), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 39/177 (22%), Positives = 93/177 (52%), Gaps = 2/177 (1%)

Query: 27  SSCFFHNNPVNIYDLTESTKYDESVQRHIQLIITEPITEKILNSEDIIVRSSPIEIQYLI 86
            S    + P++IY L  +T   ++ +    L +  P++ ++L+   I+V   P  +    
Sbjct: 16  CSILPQSEPLDIYLLPATTLPAQTQRVDWSLRVNSPVSNQLLDGTRIVVLPEPGRVNTYQ 75

Query: 87  GSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSF--EINIDRHCA 144
           G +WS++ P++++ +L+  F+++G+I  +   +Q + AD +++S +RSF  E       A
Sbjct: 76  GVRWSERTPQLLRARLLDAFQDDGRIQALSNEDQRLQADLELVSDLRSFHSEYRDGIPSA 135

Query: 145 IITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEIIDWTLS 201
           +I + + +++     ++  + F V +     +    + +  +A  ++S E++DWTL+
Sbjct: 136 LIRLEVNLVDTRSQKIIASRRFSVSQAAGDTSITAVVTAFGKAADQLSRELVDWTLA 192


>gi|49079164|gb|AAT49861.1| PA3214 [synthetic construct]
          Length = 215

 Score =  182 bits (461), Expect = 4e-44,   Method: Composition-based stats.
 Identities = 38/183 (20%), Positives = 80/183 (43%), Gaps = 4/183 (2%)

Query: 27  SSCFFHNNPVNIYDLTE--STKYDESVQRHIQLIITEPITEKILNSEDIIVRSSPIEIQY 84
            S       + +Y L          +      L I  P T  +L S  I VR    EI  
Sbjct: 26  CSILPEAQVLQVYLLPVHNPPASAAARPVDWSLRIARPRTSLVLESPRIAVRPHGDEISV 85

Query: 85  LIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFEINI--DRH 142
             G++WSD  P +++ +L+  F+ +G++  +   +  + AD+++   +R+F+      + 
Sbjct: 86  YQGARWSDPAPSLLRDRLMQAFQADGRVRGLSSDDSNLQADFELGGDLRAFQTEYPNGQA 145

Query: 143 CAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEIIDWTLSS 202
            A+I    +++   D  +V  + F V + ++       + +  +A   +S++++DWTL  
Sbjct: 146 SALIRYDARLVRTDDKRVVASRRFEVSQPVDGKKVAAVVSAFGKAGDTLSAQVLDWTLRQ 205

Query: 203 LPL 205
              
Sbjct: 206 ASA 208


>gi|15598410|ref|NP_251904.1| hypothetical protein PA3214 [Pseudomonas aeruginosa PAO1]
 gi|107102744|ref|ZP_01366662.1| hypothetical protein PaerPA_01003811 [Pseudomonas aeruginosa PACS2]
 gi|116051204|ref|YP_789965.1| putative ABC-type uncharacterized transport system [Pseudomonas
           aeruginosa UCBPP-PA14]
 gi|218890593|ref|YP_002439457.1| putative ABC-type uncharacterized transport system [Pseudomonas
           aeruginosa LESB58]
 gi|254236176|ref|ZP_04929499.1| hypothetical protein PACG_02141 [Pseudomonas aeruginosa C3719]
 gi|254241902|ref|ZP_04935224.1| hypothetical protein PA2G_02623 [Pseudomonas aeruginosa 2192]
 gi|296388299|ref|ZP_06877774.1| putative ABC-type uncharacterized transport system [Pseudomonas
           aeruginosa PAb1]
 gi|9949334|gb|AAG06602.1|AE004744_17 hypothetical protein PA3214 [Pseudomonas aeruginosa PAO1]
 gi|115586425|gb|ABJ12440.1| putative ABC-type uncharacterized transport system [Pseudomonas
           aeruginosa UCBPP-PA14]
 gi|126168107|gb|EAZ53618.1| hypothetical protein PACG_02141 [Pseudomonas aeruginosa C3719]
 gi|126195280|gb|EAZ59343.1| hypothetical protein PA2G_02623 [Pseudomonas aeruginosa 2192]
 gi|218770816|emb|CAW26581.1| putative ABC-type uncharacterized transport system [Pseudomonas
           aeruginosa LESB58]
          Length = 214

 Score =  181 bits (459), Expect = 6e-44,   Method: Composition-based stats.
 Identities = 38/183 (20%), Positives = 80/183 (43%), Gaps = 4/183 (2%)

Query: 27  SSCFFHNNPVNIYDLTE--STKYDESVQRHIQLIITEPITEKILNSEDIIVRSSPIEIQY 84
            S       + +Y L          +      L I  P T  +L S  I VR    EI  
Sbjct: 26  CSILPEAQVLQVYLLPVHNPPASAAARPVDWSLRIARPRTSLVLESPRIAVRPHGDEISV 85

Query: 85  LIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFEINI--DRH 142
             G++WSD  P +++ +L+  F+ +G++  +   +  + AD+++   +R+F+      + 
Sbjct: 86  YQGARWSDPAPSLLRDRLMQAFQADGRVRGLSSDDSNLQADFELGGDLRAFQTEYPNGQA 145

Query: 143 CAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEIIDWTLSS 202
            A+I    +++   D  +V  + F V + ++       + +  +A   +S++++DWTL  
Sbjct: 146 SALIRYDARLVRTDDKRVVASRRFEVSQPVDGKKVAAVVSAFGKAGDTLSAQVLDWTLRQ 205

Query: 203 LPL 205
              
Sbjct: 206 ASA 208


>gi|238784665|ref|ZP_04628670.1| hypothetical protein yberc0001_28090 [Yersinia bercovieri ATCC
           43970]
 gi|238714437|gb|EEQ06444.1| hypothetical protein yberc0001_28090 [Yersinia bercovieri ATCC
           43970]
          Length = 207

 Score =  180 bits (458), Expect = 7e-44,   Method: Composition-based stats.
 Identities = 35/179 (19%), Positives = 81/179 (45%), Gaps = 4/179 (2%)

Query: 27  SSCFFHNNPVNIYDLT--ESTKYDESVQRHIQLIITEPITEKILNSEDIIVRSSPIEIQY 84
            +         +Y L    +T    +   +  L +++P T + LNS  I V+    EI  
Sbjct: 23  CTILPTAPVSQVYLLPVPPATNAPRAQSVNWSLRVSQPATSQFLNSSRIAVQPQGQEIAV 82

Query: 85  LIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFEINI--DRH 142
              S+WSD  P +++ +LI  F  +G+I  V   +  + AD ++   + +F+     D+ 
Sbjct: 83  YQNSRWSDPAPILVRNRLIQEFRADGRIRAVSSDDDSLQADVELSGDLSAFQGVYLTDKS 142

Query: 143 CAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEIIDWTLS 201
             +I    +++   D  ++  + F + + ++       +Q+   A  ++++++++W L 
Sbjct: 143 EVLIRFDARLVRISDRRIIATRHFEIRQPIKGTEMNEVVQAFGLASDQLATQVLNWMLQ 201


>gi|237808110|ref|YP_002892550.1| hypothetical protein Tola_1349 [Tolumonas auensis DSM 9187]
 gi|237500371|gb|ACQ92964.1| protein of unknown function DUF330 [Tolumonas auensis DSM 9187]
          Length = 207

 Score =  180 bits (457), Expect = 9e-44,   Method: Composition-based stats.
 Identities = 42/179 (23%), Positives = 85/179 (47%), Gaps = 3/179 (1%)

Query: 25  SLSSCFFHNNPVNIYDLTESTKY-DESVQRHIQLIITEPITEKILNSEDIIVRSSPIEIQ 83
           S  S F    PVN+Y L EST    +S      L I  P   + L+S  I V     +I 
Sbjct: 18  SACSLFPETRPVNVYMLPESTPVQTQSSSVDWSLRINTPYANQTLDSTRIAVIPDGNQIN 77

Query: 84  YLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFEINI--DR 141
               ++W+D++P +++ +LI  F ++G+I T+   N  I  D ++IS +R+F+      +
Sbjct: 78  SYKSARWNDRVPVLLRERLIDTFRSDGRIKTITNDNGLINTDAELISELRAFQSEYIHGK 137

Query: 142 HCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEIIDWTL 200
               + +   ++  ++  ++    F   +  +  +    +Q+  +A  ++S E++ W +
Sbjct: 138 PEVRVQLDTHLVQRNNQQVLASYRFEARQASKDASVASVVQAFGQATDQLSREVVAWAI 196


>gi|70733609|ref|YP_257249.1| putative lipoprotein [Pseudomonas fluorescens Pf-5]
 gi|68347908|gb|AAY95514.1| lipoprotein, putative [Pseudomonas fluorescens Pf-5]
          Length = 209

 Score =  180 bits (457), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 39/204 (19%), Positives = 88/204 (43%), Gaps = 7/204 (3%)

Query: 3   KKLNKIIKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESV--QRHIQLIIT 60
           K+  +++    +S +LA+   T   S      P++IY L  S     +        L + 
Sbjct: 2   KRAYRLLAPLGLSAALAL---TGACSILPKGEPLDIYRLPVSQAGATAPNQALPWSLQLL 58

Query: 61  EPITEKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQ 120
           +P     LNS  I V      I     S+WSD  P +++ +L+  F+ +G++  +   + 
Sbjct: 59  KPQAGDALNSARIAVIPQGNLISSYKASRWSDPAPILLRNRLLDGFQRDGRVQLLSTDDS 118

Query: 121 GIYADYQIISAIRSFEINIDRHCA--IITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKL 178
            +  D  +   +++F+     + A  +I +  ++I  +D  ++  + F V + L +    
Sbjct: 119 NLQTDLALGGDLQAFQTEYQGNAAQVVIRLDARLIRGYDQKILASRRFEVRQALAETGVP 178

Query: 179 HFIQSLNRAFSRISSEIIDWTLSS 202
             +    +A   ++ +++DW +  
Sbjct: 179 AVVTGFGQAGDALTRQVVDWAVGQ 202


>gi|238751980|ref|ZP_04613465.1| hypothetical protein yrohd0001_23850 [Yersinia rohdei ATCC 43380]
 gi|238709814|gb|EEQ02047.1| hypothetical protein yrohd0001_23850 [Yersinia rohdei ATCC 43380]
          Length = 205

 Score =  180 bits (457), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 35/184 (19%), Positives = 81/184 (44%), Gaps = 4/184 (2%)

Query: 25  SLSSCFFHNNPVNIYDLT--ESTKYDESVQRHIQLIITEPITEKILNSEDIIVRSSPIEI 82
           S  +         +Y L    +T        +  L +++P T + +NS  I V+    EI
Sbjct: 21  SACTILPSAPVSQVYLLPVPAATTAPHGQSVNWSLRVSQPATNQFINSSRIAVQPEGQEI 80

Query: 83  QYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFEINI--D 140
                S+W+D  P +++ +LI  F  +G+I  V   +  + AD ++   + +F+      
Sbjct: 81  AVYKNSRWTDPTPILVRNRLIQEFRTDGRIPAVSSDDDSLQADVELSGDLSAFQGVYLAG 140

Query: 141 RHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEIIDWTL 200
               +I    +++   D  ++  + F + + ++       I +   A +++++++++WTL
Sbjct: 141 NSEVLIRFDARLVRISDRRIIATRHFEIRQPIKGSQMDEVIDAFGLASNQLATQVLNWTL 200

Query: 201 SSLP 204
              P
Sbjct: 201 QQSP 204


>gi|330806716|ref|YP_004351178.1| Putative lipoprotein [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
 gi|327374824|gb|AEA66174.1| Putative lipoprotein [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
          Length = 211

 Score =  180 bits (457), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 40/203 (19%), Positives = 83/203 (40%), Gaps = 6/203 (2%)

Query: 3   KKLNKIIKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTEST-KYDESVQRHIQLIITE 61
           K  N+ I+  ++   LA  +     S      P ++Y L  +             L +  
Sbjct: 2   KPSNRFIRPLLL---LAGFVLVGGCSILPKAEPSDVYRLPVTQAPASAGAAVSWSLRLAN 58

Query: 62  PITEKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQG 121
           P   ++LNS  I V            S+WSD  P +++ +L+  F  +G++  +   +  
Sbjct: 59  PQASEVLNSPKIAVIPQGNLFSSYAASRWSDPAPVLLRNRLLDGFAQDGRVRLLSVADSN 118

Query: 122 IYADYQIISAIRSFEINIDRHCA--IITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLH 179
           + AD ++   +++F+       A  +I +   ++   D  ++  + F V + L       
Sbjct: 119 LQADLELGGQLQAFQTEYQGTAASVVIRLDALLVRGFDQRILASRRFEVRQPLSDVKVPA 178

Query: 180 FIQSLNRAFSRISSEIIDWTLSS 202
            +    RA  R+++E++ WTL  
Sbjct: 179 VVDGFGRAGDRLTAEVVAWTLEQ 201


>gi|238764192|ref|ZP_04625145.1| hypothetical protein ykris0001_6580 [Yersinia kristensenii ATCC
           33638]
 gi|238697605|gb|EEP90369.1| hypothetical protein ykris0001_6580 [Yersinia kristensenii ATCC
           33638]
          Length = 194

 Score =  180 bits (456), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 35/190 (18%), Positives = 81/190 (42%), Gaps = 4/190 (2%)

Query: 19  AVLLCTSLSSCFFHNNPVNIYDLTEST--KYDESVQRHIQLIITEPITEKILNSEDIIVR 76
            +++  S  +         +Y L          +   +  L +++P T + +NS  I V+
Sbjct: 4   MLVILLSACTILPTAPISQVYLLPVPPAANAPRAQTVNWSLRVSQPATNQFINSSRIAVQ 63

Query: 77  SSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFE 136
               EI     S+W+D  P +++ +LI  F  +G+I  V   +  + AD ++   + +F+
Sbjct: 64  PDGQEIAVYKNSRWTDPAPILVRNRLIQEFRTDGRIPAVSSDDDSLQADVELSGDLSAFQ 123

Query: 137 --INIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSE 194
                     +I    +++   D  ++  + F V + ++       + +   A  ++ S+
Sbjct: 124 GVYQAGNSEVLIRFDARLVRISDRRIMATRHFEVRQPIKGAQMNEVVAAFGLASDQLVSQ 183

Query: 195 IIDWTLSSLP 204
           +++WTL   P
Sbjct: 184 VLNWTLQQSP 193


>gi|238796787|ref|ZP_04640292.1| hypothetical protein ymoll0001_25890 [Yersinia mollaretii ATCC
           43969]
 gi|238719275|gb|EEQ11086.1| hypothetical protein ymoll0001_25890 [Yersinia mollaretii ATCC
           43969]
          Length = 207

 Score =  179 bits (454), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 40/202 (19%), Positives = 90/202 (44%), Gaps = 5/202 (2%)

Query: 10  KKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLT--ESTKYDESVQRHIQLIITEPITEKI 67
           ++  +     +++  S  +         +Y L    +T    +   +  L +++P T + 
Sbjct: 6   RRTWLLMLSMLVMLLSACTILPTAPVSQVYLLPVPPATNTARAQTVNWSLRVSQPTTSQF 65

Query: 68  LNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQ 127
           LNS  I V+    EI     S+WSD  P +++ +LI  F  +G+I  V   +  + AD +
Sbjct: 66  LNSSRIAVQPQGQEIAVYQNSRWSDPAPILLRNRLIQEFRADGRIRAVSSDDDSLQADVE 125

Query: 128 IISAIRSFEINI--DRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLN 185
           +   + +F+     D+   +I    +++   D  ++    F + + +        +Q+  
Sbjct: 126 LSGDLSAFQGVYLTDKSEVLIRFDARLVRISDRRIIATHHFEIRQPISGTKMDEVVQAFG 185

Query: 186 RAFSRISSEIIDWTL-SSLPLS 206
            A  ++++++++W L  SLP S
Sbjct: 186 LASDQLAAQVLNWMLQQSLPSS 207


>gi|194364299|ref|YP_002026909.1| hypothetical protein Smal_0521 [Stenotrophomonas maltophilia
           R551-3]
 gi|194347103|gb|ACF50226.1| protein of unknown function DUF330 [Stenotrophomonas maltophilia
           R551-3]
          Length = 213

 Score =  179 bits (453), Expect = 3e-43,   Method: Composition-based stats.
 Identities = 44/199 (22%), Positives = 93/199 (46%), Gaps = 4/199 (2%)

Query: 8   IIKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKY-DESVQRHIQLIITEPITEK 66
            + + +++ S+  LL             V +Y  +   K      Q   QL++ +P   +
Sbjct: 5   TLPRLLLATSMLALLGGCSILGSSEKTAVTLYSPSVQVKADPAWPQASWQLVLAKPSAAR 64

Query: 67  ILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADY 126
           +++S  I VR +P +++   G+ W+     MI+  L+  FE++G+I  V +   GI ADY
Sbjct: 65  MVDSPRINVRPTPSQLEIYKGASWAQPATDMIEDTLLRGFEDSGRIRGVARSTAGIRADY 124

Query: 127 QIISAIRSFEINIDR---HCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQS 183
           ++ + +R FE +         +I ++ K+I+  D  +V  + F   + +   +      +
Sbjct: 125 KLSTDVRRFESDYQGQATPTVVIEVNAKLIHVADQRVVADRTFRQSQPVGSTDVPAVTAA 184

Query: 184 LNRAFSRISSEIIDWTLSS 202
             R   +++ +++ WTL S
Sbjct: 185 FERGLQQLAQDVVGWTLQS 203


>gi|254470354|ref|ZP_05083758.1| membrane lipoprotein lipid attachment site containing protein
           [Pseudovibrio sp. JE062]
 gi|211960665|gb|EEA95861.1| membrane lipoprotein lipid attachment site containing protein
           [Pseudovibrio sp. JE062]
          Length = 261

 Score =  177 bits (449), Expect = 9e-43,   Method: Composition-based stats.
 Identities = 53/204 (25%), Positives = 96/204 (47%), Gaps = 8/204 (3%)

Query: 3   KKLNKIIKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYD-ESVQRHIQLIITE 61
                 +KK ++   L       L+ C   + P  +Y LT       +      Q+++  
Sbjct: 24  GVFGSTLKKLVVGAVL----LGGLAGCG-ASGPEALYGLTAPRDVPVKVRASDYQVLVAT 78

Query: 62  PITEKILNSEDIIVRSSPIEI-QYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQ 120
           P+  + L++ +I V      I  Y     W+D LPR+ Q KL+   EN GK+  V +P Q
Sbjct: 79  PVALQALDTSNIAVTQGGGPIYSYFPKVAWTDTLPRVFQAKLVETLENTGKLRGVSQPGQ 138

Query: 121 GIYADYQIISAIRSFEINIDRH-CAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLH 179
           G+  DYQ+ + +R+FE+ +D    A + ++ +I++  D   +G +VF        D    
Sbjct: 139 GLLIDYQLQTTLRAFELQVDGGDKAYVEVAARIVDDRDGRSIGMRVFAASVPTTGDTVTD 198

Query: 180 FIQSLNRAFSRISSEIIDWTLSSL 203
            I +LN A   + S+I  W+++++
Sbjct: 199 AIPALNAASDNVLSQIASWSVNTV 222


>gi|182680398|ref|YP_001834544.1| hypothetical protein Bind_3498 [Beijerinckia indica subsp. indica
           ATCC 9039]
 gi|182636281|gb|ACB97055.1| Mammalian cell entry related domain protein [Beijerinckia indica
           subsp. indica ATCC 9039]
          Length = 378

 Score =  177 bits (449), Expect = 9e-43,   Method: Composition-based stats.
 Identities = 51/205 (24%), Positives = 104/205 (50%), Gaps = 5/205 (2%)

Query: 3   KKLNKIIKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRH---IQLII 59
           K    ++ +        +     L+       P  +YDLT +        +     Q++I
Sbjct: 173 KTFTDVLARNTGDFDKIIAGLVKLAGGGPEAKPKPVYDLTVTQATPAPAPKGKKLGQIVI 232

Query: 60  TEPITEKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPN 119
            EP T  + +++ ++ RS   E       QW+D +P+++Q K++ +FEN G I +V  P 
Sbjct: 233 AEPTTTVVFDTQRLLARSKDGEFTPQGEMQWADSIPKLVQEKMVQSFENEGLIGSVTAPV 292

Query: 120 QGIYADYQIISAIRSFEINID-RHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKL 178
           +G+   YQ+++ IR+F +  D R  A + +S+K++N     ++  K+FHV   +E ++  
Sbjct: 293 EGVTRQYQLLTDIRNFAVTSDSRPSADVELSVKLMNEE-GHVIAGKIFHVTVPVESEDTS 351

Query: 179 HFIQSLNRAFSRISSEIIDWTLSSL 203
             + + ++AF++  +E+I WT  ++
Sbjct: 352 KVVAAFSQAFNQAMTELISWTRQTI 376


>gi|254513148|ref|ZP_05125214.1| conserved hypothetical protein [Rhodobacteraceae bacterium KLH11]
 gi|221533147|gb|EEE36142.1| conserved hypothetical protein [Rhodobacteraceae bacterium KLH11]
          Length = 212

 Score =  177 bits (448), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 43/195 (22%), Positives = 100/195 (51%), Gaps = 8/195 (4%)

Query: 17  SLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQR-HIQLIITEPITEKILNSEDIIV 75
             A+  CT L +    + P ++Y LT  + +  ++ R   Q+++ EP     +N++ I V
Sbjct: 5   LAALAGCTGLGTLRQASKPNDLYLLTPKSTFSSALPRIQKQIVVEEPTATAAVNTDQIAV 64

Query: 76  RSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSF 135
           + +P+++QYL  ++W D+ P ++Q  ++ ++EN+GK++ V +   G+ ADY I   +R F
Sbjct: 65  QPTPLQVQYLPQARWVDRAPLIVQALMVESYENSGKVAAVGRSTVGLRADYVIAPDLREF 124

Query: 136 EINIDRHC-------AIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAF 188
           +  +             + +++KII+ +D+ ++    F        D     +++ + A 
Sbjct: 125 QGVVISQTEDATTVRVEVRINIKIIDEYDDKIIASSSFQETVLATSDQTSDLVEAFDIAL 184

Query: 189 SRISSEIIDWTLSSL 203
            +   + ++W++  +
Sbjct: 185 GKAMRDCVEWSIRKI 199


>gi|190572711|ref|YP_001970556.1| hypothetical protein Smlt0659 [Stenotrophomonas maltophilia K279a]
 gi|190010633|emb|CAQ44242.1| conserved hypothetical protein [Stenotrophomonas maltophilia K279a]
          Length = 213

 Score =  176 bits (446), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 47/198 (23%), Positives = 90/198 (45%), Gaps = 8/198 (4%)

Query: 13  IISCSLAVLLCTSLSSCF----FHNNPVNIYDLTESTKY-DESVQRHIQLIITEPITEKI 67
           +    LA  L T L  C          V +Y      K      Q   QL++ +P   ++
Sbjct: 6   LPRLLLAASLVTLLGGCSILGSSEKTAVTLYSPAVQVKADPAWPQASWQLVLAKPSAARM 65

Query: 68  LNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQ 127
           ++S  I VR +P +++   G+ W+     MI+  L+  FE++G+I  V +   GI ADY+
Sbjct: 66  VDSPRINVRPTPSQLEIYKGASWAQPATDMIEDTLLRGFEDSGRIHGVARSTAGIRADYK 125

Query: 128 IISAIRSFEINIDR---HCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSL 184
           + + +R FE +         +I ++ K+I+  D  +V  + F   + +   +      + 
Sbjct: 126 LSTDVRRFESDYQGQATPTVVIEVNAKLIHVADQRVVADRTFRQAQPVGSTDVPAVTAAF 185

Query: 185 NRAFSRISSEIIDWTLSS 202
            R   +++ +++ WTL S
Sbjct: 186 ERGLQQLAQDVVGWTLVS 203


>gi|328543115|ref|YP_004303224.1| Putative ABC transporter protein [Polymorphum gilvum SL003B-26A1]
 gi|326412861|gb|ADZ69924.1| Putative ABC transporter protein [Polymorphum gilvum SL003B-26A1]
          Length = 200

 Score =  175 bits (445), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 48/173 (27%), Positives = 84/173 (48%), Gaps = 1/173 (0%)

Query: 32  HNNPVNIYDLTESTKYDESVQRHIQLIITEPITEKILNSEDIIVRSSPIEIQYLIGSQWS 91
              P  +Y LT      +   R +Q+++  P   K L++ +I V        Y   + W+
Sbjct: 28  STAPSALYGLTAPDDIADGRSRPVQVLVPAPRALKALDTGNIAVVDKGPAYSYFPQAAWA 87

Query: 92  DKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFEINIDRH-CAIITMSL 150
           D LP ++Q KL+   EN G++  V  P +G+  D+Q+ + +RSFE+NID    A++ ++ 
Sbjct: 88  DTLPNVVQAKLVQTLENTGRLRGVGLPGEGLLIDFQLQTDLRSFELNIDGPDRAVVEIAA 147

Query: 151 KIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEIIDWTLSSL 203
           K+IN  +   V  +VF              + ++NRA  ++  EI  W L  +
Sbjct: 148 KLINDRNGRTVASRVFTAVVPAGGTTVDRAVAAMNRAADQVFREIAVWVLDKV 200


>gi|226942631|ref|YP_002797704.1| hypothetical protein Avin_04750 [Azotobacter vinelandii DJ]
 gi|226717558|gb|ACO76729.1| conserved hypothetical protein [Azotobacter vinelandii DJ]
          Length = 205

 Score =  175 bits (444), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 40/188 (21%), Positives = 85/188 (45%), Gaps = 4/188 (2%)

Query: 19  AVLLCTSLSSCFFHNNPVNIYDLT--ESTKYDESVQRHIQLIITEPITEKILNSEDIIVR 76
           A+L   +  S      P++IY L          + +    L I  P  +++L S  I V 
Sbjct: 10  ALLGSLTACSVLPEAEPIHIYRLPGTPLQAQPATARLDQALRIATPKADRMLGSARIAVM 69

Query: 77  SSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFE 136
                I    G++WSD  P +++ +LI  F  +G+ ++V   +  +YAD +++  +RSF 
Sbjct: 70  PEGNRISNYQGARWSDDAPTLLRDRLIEAFREDGRTASVSSDDNHLYADLELLGDLRSFH 129

Query: 137 INI--DRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSE 194
                 +    + + + ++++    ++  + F V + +        + +   A  R+S +
Sbjct: 130 SEYVDGQPQVRLGLDVSLVHSASQRILASRRFEVRQSVSDGRLDSVVAAFGAASDRLSRQ 189

Query: 195 IIDWTLSS 202
           ++DWTL+ 
Sbjct: 190 LVDWTLAQ 197


>gi|254522526|ref|ZP_05134581.1| lipoprotein [Stenotrophomonas sp. SKA14]
 gi|219720117|gb|EED38642.1| lipoprotein [Stenotrophomonas sp. SKA14]
          Length = 213

 Score =  175 bits (444), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 46/203 (22%), Positives = 92/203 (45%), Gaps = 8/203 (3%)

Query: 8   IIKKKIISCSLAVLLCTSLSSCF----FHNNPVNIYDLTESTKY-DESVQRHIQLIITEP 62
           +    +    LA  + T L  C          V +Y      K      Q   QL++ +P
Sbjct: 1   MSTTTLPRLLLAASMVTLLGGCSILGSSEKTAVTLYSPAVQVKADPAWPQASWQLVLAKP 60

Query: 63  ITEKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGI 122
              ++++S  I VR +P +++   G+ W+     MI+  L+  FE++G+I  V + + GI
Sbjct: 61  SAARMVDSPRINVRPTPSQMEIYKGASWAQPATDMIEDTLLRGFEDSGRIRGVARSSAGI 120

Query: 123 YADYQIISAIRSFEINIDR---HCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLH 179
            ADY++ + +R FE +         +I ++ K+I+  D  +V  + F   + +   +   
Sbjct: 121 RADYKLSTDVRRFESDYQGQATPTVVIEVNAKLIHVADQRVVADRTFRQAQPVGSTDVPA 180

Query: 180 FIQSLNRAFSRISSEIIDWTLSS 202
              +  R   +++ +++ WTL S
Sbjct: 181 VTAAFERGLQQLAQDVVGWTLVS 203


>gi|260430757|ref|ZP_05784729.1| conserved hypothetical protein [Silicibacter lacuscaerulensis
           ITI-1157]
 gi|260418198|gb|EEX11456.1| conserved hypothetical protein [Silicibacter lacuscaerulensis
           ITI-1157]
          Length = 214

 Score =  174 bits (441), Expect = 7e-42,   Method: Composition-based stats.
 Identities = 41/200 (20%), Positives = 97/200 (48%), Gaps = 8/200 (4%)

Query: 16  CSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQR-HIQLIITEPITEKILNSEDII 74
               +  CT L +    + P ++Y LT  + +  S+ R   Q+++ EP     ++++ I 
Sbjct: 6   LLAGLTGCTGLGTLKQASQPNDLYLLTPKSTFSSSLPRVSKQIVVQEPTATAAVDTDQIA 65

Query: 75  VRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRS 134
           V+ +P+++QYL  ++W D+ P ++Q  L+ +FEN+ +++ V +   G+ ADY I+  +R 
Sbjct: 66  VQPTPLQVQYLPRARWVDRAPLIVQALLVESFENSNRVAAVGRSTVGLRADYVIVPDLRE 125

Query: 135 FEINIDRHCA-------IITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRA 187
           F+  +             + +++KII+  ++ ++    F  +     D     + + ++A
Sbjct: 126 FQGIVVGETQDSKTVKIDVRINIKIIDEFEDKIIASNSFQRDVIAASDQTPDLVAAFDQA 185

Query: 188 FSRISSEIIDWTLSSLPLSD 207
                   ++W++  +    
Sbjct: 186 LGSTMRNAVEWSIRKIHAHA 205


>gi|163759627|ref|ZP_02166712.1| putative ABC transporter protein [Hoeflea phototrophica DFL-43]
 gi|162283224|gb|EDQ33510.1| putative ABC transporter protein [Hoeflea phototrophica DFL-43]
          Length = 199

 Score =  174 bits (441), Expect = 8e-42,   Method: Composition-based stats.
 Identities = 64/199 (32%), Positives = 115/199 (57%), Gaps = 1/199 (0%)

Query: 6   NKIIKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIITEPITE 65
            ++   ++I     +L+          + P + Y L+ +        R+ Q++I+EP   
Sbjct: 1   MRLKPARLIVAITLLLVLAGCGGGLGGSTPPDTYGLSPAPAVTGDSARNRQILISEPTAL 60

Query: 66  KILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYAD 125
           K L+SE I++R SP  IQYL  SQWSD+LP+++Q KL+  FEN+G++  V +P +G+  D
Sbjct: 61  KALDSEQIVIRPSPSAIQYLADSQWSDRLPKIVQDKLVQAFENSGRVGGVGRPGEGLAID 120

Query: 126 YQIISAIRSFEINID-RHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSL 184
           ++II+AIRSFEI  D    A++ +S K++N  +  +   +VF     +       ++++L
Sbjct: 121 FKIITAIRSFEIRADAGEQAVVEISAKVLNDRNGVVAATRVFRGNSSVTGTGNAAYVRAL 180

Query: 185 NRAFSRISSEIIDWTLSSL 203
           +RAF  + ++++ WTLS +
Sbjct: 181 DRAFETVVADLVTWTLSRI 199


>gi|119390266|pdb|2IQI|A Chain A, Crystal Structure Of Protein Xcc0632 From Xanthomonas
           Campestris, Pfam Duf330
 gi|119390267|pdb|2IQI|B Chain B, Crystal Structure Of Protein Xcc0632 From Xanthomonas
           Campestris, Pfam Duf330
 gi|119390268|pdb|2IQI|C Chain C, Crystal Structure Of Protein Xcc0632 From Xanthomonas
           Campestris, Pfam Duf330
 gi|119390269|pdb|2IQI|D Chain D, Crystal Structure Of Protein Xcc0632 From Xanthomonas
           Campestris, Pfam Duf330
 gi|119390270|pdb|2IQI|E Chain E, Crystal Structure Of Protein Xcc0632 From Xanthomonas
           Campestris, Pfam Duf330
 gi|119390271|pdb|2IQI|F Chain F, Crystal Structure Of Protein Xcc0632 From Xanthomonas
           Campestris, Pfam Duf330
 gi|119390272|pdb|2IQI|G Chain G, Crystal Structure Of Protein Xcc0632 From Xanthomonas
           Campestris, Pfam Duf330
 gi|119390273|pdb|2IQI|H Chain H, Crystal Structure Of Protein Xcc0632 From Xanthomonas
           Campestris, Pfam Duf330
          Length = 192

 Score =  173 bits (440), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 45/175 (25%), Positives = 86/175 (49%), Gaps = 4/175 (2%)

Query: 30  FFHNNPVNIYDLTE-STKYDESVQRHIQLIITEPITEKILNSEDIIVRSSPIEIQYLIGS 88
                P  IY  T   T      Q   QL++ +P   +I++S  I VR +P E+Q   G+
Sbjct: 4   LGDQKPATIYAPTVRVTPNPAWPQVSWQLLVAKPSAARIIDSPRINVRPTPGELQVYHGA 63

Query: 89  QWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFEINIDR---HCAI 145
            W+     M++  ++  FE++GKI+ V +   GI +DY++   +R FE +        A 
Sbjct: 64  GWAQPATDMLEDSVVRAFEDSGKIAAVARIGAGIRSDYKLAIDVRRFESDYAGQSLPAAT 123

Query: 146 ITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEIIDWTL 200
           I ++ K++++ D  +V  + F V       +      +  +A +++++E++ WTL
Sbjct: 124 IELNAKLLHSSDQRVVASRTFTVARPSSSTDTAAVAAAFEQALTQVTTELVGWTL 178


>gi|285019446|ref|YP_003377157.1| secreted protein [Xanthomonas albilineans GPE PC73]
 gi|283474664|emb|CBA17163.1| putative secreted protein [Xanthomonas albilineans]
          Length = 215

 Score =  172 bits (437), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 46/187 (24%), Positives = 82/187 (43%), Gaps = 4/187 (2%)

Query: 25  SLSSCFFHNNPVNIYDLTE-STKYDESVQRHIQLIITEPITEKILNSEDIIVRSSPIEIQ 83
             S    +     IY      T      Q   QL +T+P   ++++S  I VR +P E+Q
Sbjct: 19  GCSLAGGNKESATIYAPDARVTPDPAWPQVTWQLALTKPSATRMIDSPRIAVRPTPDELQ 78

Query: 84  YLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFEINIDR-- 141
              G  W+     M +  L+  FE++G+I  V +   GI ADY+++  +R FE +     
Sbjct: 79  VYSGVSWAQPATDMFEDTLLRAFEDSGRIPGVARLGTGIGADYKLLLDLRRFESDYAGHD 138

Query: 142 -HCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEIIDWTL 200
              A I ++ K+++  D  +V    F V +      +   + +  +A S++S  ++ WTL
Sbjct: 139 VPAATIELNAKLLHTVDQRVVSSHTFLVTQTAGGTTEAQVVDAFGQALSQLSRAVVGWTL 198

Query: 201 SSLPLSD 207
                  
Sbjct: 199 QQGQADA 205


>gi|206575545|ref|YP_002235752.1| hypothetical protein KPK_A0104 [Klebsiella pneumoniae 342]
 gi|206570389|gb|ACI12035.1| conserved hypothetical protein [Klebsiella pneumoniae 342]
          Length = 214

 Score =  172 bits (437), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 39/187 (20%), Positives = 84/187 (44%), Gaps = 5/187 (2%)

Query: 17  SLAVLLCTSLSSC-FFHNNPVN-IYDLTESTKYDESVQR-HIQLIITEPITEKILNSEDI 73
            L VL+C  L++C      PV+ ++ L        S    +  L + +P T + +NS  I
Sbjct: 18  LLIVLVCLPLAACTVLPQRPVSQVWLLPAQPGVPASGPTINRSLRVMQPSTSQFINSSRI 77

Query: 74  IVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIR 133
            V+    EI    GS+WSD +P + + +L      +G+  +V      + AD+++   + 
Sbjct: 78  AVQPQGAEITVYSGSRWSDSVPVLFRNRLTQELRTDGRFISVSSDEDNLQADFELGGDLS 137

Query: 134 SFEINIDR--HCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRI 191
           SF+          +I    +++   D  ++  + F + + +   +    +++   A  R+
Sbjct: 138 SFQGVYRGKKGEVLIQFDARLVQTSDRRVIASQRFVIHQPISGSSMNEVVEAFGLASDRL 197

Query: 192 SSEIIDW 198
           +++I+ W
Sbjct: 198 AADILRW 204


>gi|118588761|ref|ZP_01546169.1| putative ABC transporter protein [Stappia aggregata IAM 12614]
 gi|118438747|gb|EAV45380.1| putative ABC transporter protein [Stappia aggregata IAM 12614]
          Length = 201

 Score =  172 bits (435), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 46/205 (22%), Positives = 95/205 (46%), Gaps = 6/205 (2%)

Query: 1   MDKKLNKIIKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTES-TKYDESVQRHIQLII 59
           M K    + ++ +++     +L +  +S    + P   Y +  +     +     +Q+++
Sbjct: 1   MTKATTDMTRRGVLTALGLGVLVSGCAS----STPSAYYSIGAADVGGLQGRSSRVQVLV 56

Query: 60  TEPITEKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPN 119
             P   K L++  I V        Y   S W+D LP ++Q KL+   +N  ++  V  P 
Sbjct: 57  AAPRALKALDTSYIAVVDKGPVYSYFPDSAWADSLPNVVQSKLVETLQNTNRLRGVGLPG 116

Query: 120 QGIYADYQIISAIRSFEIN-IDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKL 178
            G+  DYQ+ + IR+FE+     +  ++ +S +I+N  +   V  KVF  E      +  
Sbjct: 117 DGLLIDYQLQTEIRAFELQLAGANRGVVEISARIVNDRNGQTVANKVFRAETSAGSTSVN 176

Query: 179 HFIQSLNRAFSRISSEIIDWTLSSL 203
             ++++N +  R+ +E+  WTL ++
Sbjct: 177 KAVEAMNASADRVFAEMAAWTLQNV 201


>gi|307945710|ref|ZP_07661046.1| lipoprotein [Roseibium sp. TrichSKD4]
 gi|307771583|gb|EFO30808.1| lipoprotein [Roseibium sp. TrichSKD4]
          Length = 194

 Score =  171 bits (434), Expect = 5e-41,   Method: Composition-based stats.
 Identities = 50/195 (25%), Positives = 95/195 (48%), Gaps = 5/195 (2%)

Query: 10  KKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIITEPITEKILN 69
           ++ ++    A LL    ++    + P  +Y L  +T   E  ++  Q+++  P   K L+
Sbjct: 4   RRNVLIWLGASLLVAGCAA----SGPAALYGLNAATSQVEGRRKSRQVLVPRPRALKALD 59

Query: 70  SEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQII 129
           +E I V +      Y     W+D LP ++Q K++   +N   +  V  P  G+  DYQ+ 
Sbjct: 60  TEYIAVVNQGPVYSYYPKVSWADALPSLVQTKVVETLQNTNLLRGVGLPGDGLLIDYQLQ 119

Query: 130 SAIRSFEIN-IDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAF 188
             IRSFEI   +   A++ ++ K++N  +   V  +VF  E      +    +++LNRA 
Sbjct: 120 LEIRSFEIQLANADKAVVAIAAKLVNDRNGRTVSNRVFRAEIPASATSADKAVEALNRAA 179

Query: 189 SRISSEIIDWTLSSL 203
            ++ S+I  WT+ ++
Sbjct: 180 DQVFSDIALWTVQNV 194


>gi|170748373|ref|YP_001754633.1| hypothetical protein Mrad2831_1955 [Methylobacterium radiotolerans
           JCM 2831]
 gi|170654895|gb|ACB23950.1| protein of unknown function DUF330 [Methylobacterium radiotolerans
           JCM 2831]
          Length = 192

 Score =  170 bits (430), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 47/176 (26%), Positives = 97/176 (55%), Gaps = 2/176 (1%)

Query: 26  LSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIITEPITEKILNSEDIIVRSSPIEIQYL 85
           L  C     P+  +DL         +     ++++EP++ +   ++ IIVR +   + +L
Sbjct: 17  LGGCGGAA-PL-TFDLAALPAAGRPIAAGRSIVVSEPVSIQPFEADRIIVRENGGALSFL 74

Query: 86  IGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFEINIDRHCAI 145
            G QW+D+LPR+IQ +LI + EN+G++ +V +P   + ADYQ+IS IR+F++      A+
Sbjct: 75  GGGQWADRLPRLIQTRLIQSLENSGRLRSVSRPGDKVVADYQLISEIRAFDVQSGTGEAV 134

Query: 146 ITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEIIDWTLS 201
           + +SLK++      +   ++F     + K +     ++L++A + + ++++ W  S
Sbjct: 135 VDLSLKLVADGTGKVAAARIFTARVPVSKIDAGSGARALDQALTVVLADVVRWVNS 190


>gi|154248037|ref|YP_001418995.1| hypothetical protein Xaut_4116 [Xanthobacter autotrophicus Py2]
 gi|154162122|gb|ABS69338.1| protein of unknown function DUF330 [Xanthobacter autotrophicus Py2]
          Length = 213

 Score =  168 bits (427), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 46/191 (24%), Positives = 92/191 (48%), Gaps = 4/191 (2%)

Query: 11  KKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIITEPITEKILNS 70
            ++ +     +L  +L+ C   + P   Y+L+  + +      + Q+++  P    +LN+
Sbjct: 21  PRLAALLSGAVLTLALAGCG--STPTPTYNLSAPSGFTAGGSGNGQMVVVAPTALAVLNT 78

Query: 71  EDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIIS 130
           + ++V   P ++ YL  +QWSD LP ++Q + I  FEN  K+  V +P  G+ ADYQ++ 
Sbjct: 79  DKVMVEPGPGQVAYLSDAQWSDTLPALLQARTIQAFENASKLRRVARPGDGVNADYQLVI 138

Query: 131 AIRSF--EINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAF 188
            IR+F   I      A++ +S K+I      ++  +VF                +L+ A 
Sbjct: 139 DIRTFALRITDQGPVAVVELSAKLIGTQSGRILAAQVFKAAVPAASTAGPVATAALDSAQ 198

Query: 189 SRISSEIIDWT 199
            ++  +++ W 
Sbjct: 199 EQVLVQMVRWA 209


>gi|192293076|ref|YP_001993681.1| mammalian cell entry related domain protein [Rhodopseudomonas
           palustris TIE-1]
 gi|192286825|gb|ACF03206.1| Mammalian cell entry related domain protein [Rhodopseudomonas
           palustris TIE-1]
          Length = 398

 Score =  168 bits (427), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 54/171 (31%), Positives = 91/171 (53%), Gaps = 5/171 (2%)

Query: 38  IYDLTESTKYDES-VQRHIQLIITEPITEKILNSEDIIVRSSPIEIQYLIGSQWSDKLPR 96
           +YDL+ +T +  S      QL I E  T  + +S+ +++    +E+    G+QWSD LP+
Sbjct: 203 VYDLSAATGFPPSSPPLKGQLTIPESNTVVLFDSQKMLLAP-GLEVPAFAGAQWSDSLPK 261

Query: 97  MIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFEI--NIDRHCAIITMSLKIIN 154
           M+Q KLI +FEN       ++PN  +  DYQ+++ IRSF++    D   A I  S KII+
Sbjct: 262 MLQEKLIQSFENYDIAHAPMRPNDAVQPDYQLLTDIRSFQVIGEGDALRAEIAFSAKIID 321

Query: 155 AHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEIIDWTLSSLPL 205
             D  LV  ++F     L+K      + + +++F  I+ E++ W   +L  
Sbjct: 322 -KDGKLVAARLFQQASPLDKPEPAAAVSAFDKSFDTIAKELVPWAAQALAS 371


>gi|163793378|ref|ZP_02187353.1| hypothetical protein BAL199_02684 [alpha proteobacterium BAL199]
 gi|159181180|gb|EDP65695.1| hypothetical protein BAL199_02684 [alpha proteobacterium BAL199]
          Length = 211

 Score =  168 bits (425), Expect = 5e-40,   Method: Composition-based stats.
 Identities = 37/202 (18%), Positives = 83/202 (41%), Gaps = 6/202 (2%)

Query: 7   KIIKKKIISCSLAVLLCTSLSSCFFHNNPVN-IYDLTESTKYDESVQ-RHIQLIITEPIT 64
           ++++  +    +A L+  +  S      P   +Y LT  + +  ++     QL +  P +
Sbjct: 5   RLVRNAVGGALIAALVMVAGCSGLSLGGPSQQLYTLTPKSTFPANLPTVDWQLAVDRPSS 64

Query: 65  EKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYA 124
              L +  I V      I Y  G+QW D  P M+Q  LI +FEN+  I  V + +  + +
Sbjct: 65  PAGLATTRIAVIRGAHRIDYYAGAQWIDDAPNMVQRLLIESFENSKAIIGVGRESVSLRS 124

Query: 125 DYQIISAIRSFEINIDR----HCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHF 180
           D+ +   +R F+             + ++ K++      ++             +     
Sbjct: 125 DFVLRVELREFQAEYQEGVEAPKVNVRINAKLVRMPQRRIIASTTVERVIASPDNKIHSI 184

Query: 181 IQSLNRAFSRISSEIIDWTLSS 202
           + + ++A  ++  +I+ WT++ 
Sbjct: 185 VDTFDQALGKVLRDIVVWTVTR 206


>gi|77456268|ref|YP_345773.1| putative lipoprotein [Pseudomonas fluorescens Pf0-1]
 gi|77380271|gb|ABA71784.1| putative lipoprotein [Pseudomonas fluorescens Pf0-1]
          Length = 208

 Score =  168 bits (425), Expect = 5e-40,   Method: Composition-based stats.
 Identities = 33/192 (17%), Positives = 80/192 (41%), Gaps = 5/192 (2%)

Query: 16  CSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQR---HIQLIITEPITEKILNSED 72
             LA     S  S    + P+++Y L  +     +      H  L + +    + LN   
Sbjct: 7   ALLAGFTLISACSILPKSEPLDVYRLPAAQAPASAGSSATQHWSLRLNKLQASEALNRPS 66

Query: 73  IIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAI 132
           I V      I     S+WSD  P +++ +L+  F+ +G++S +   +    AD ++  ++
Sbjct: 67  IAVIPQGDVISSYKASRWSDPAPVLVRNRLLDGFQRDGRVSLLSTDDSNFQADLELGGSL 126

Query: 133 RSFEINIDRHCA--IITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSR 190
           ++F+       A  ++ +   ++  +D  ++  + F   + L        +    +A  R
Sbjct: 127 QAFQTEYQGTQASVVVRVDALLVRGYDQRILASRRFEERQPLSDVQVPAVVAGFGQASDR 186

Query: 191 ISSEIIDWTLSS 202
           ++++++ W +  
Sbjct: 187 LTAKVVAWAVEQ 198


>gi|39937296|ref|NP_949572.1| hypothetical protein RPA4236 [Rhodopseudomonas palustris CGA009]
 gi|39651154|emb|CAE29677.1| Mce4/Rv3499c/MTV023.06c protein [Rhodopseudomonas palustris CGA009]
          Length = 398

 Score =  167 bits (423), Expect = 8e-40,   Method: Composition-based stats.
 Identities = 53/171 (30%), Positives = 90/171 (52%), Gaps = 5/171 (2%)

Query: 38  IYDLTESTKYDES-VQRHIQLIITEPITEKILNSEDIIVRSSPIEIQYLIGSQWSDKLPR 96
           +YDL+ +T +         QL I E  T  + +S+ +++    +E+    G+QWSD LP+
Sbjct: 203 VYDLSAATGFPPPSPPLKGQLTIPESNTVVLFDSQKMLLAP-GLEVPAFAGAQWSDSLPK 261

Query: 97  MIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFEI--NIDRHCAIITMSLKIIN 154
           M+Q KLI +FEN       ++PN  +  DYQ+++ IRSF++    D   A I  S KII+
Sbjct: 262 MLQEKLIQSFENYDIAHAPMRPNDAVQPDYQLLTDIRSFQVIGEGDALRAEIAFSAKIID 321

Query: 155 AHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEIIDWTLSSLPL 205
             D  LV  ++F     L+K      + + +++F  I+ E++ W   +L  
Sbjct: 322 -KDGKLVAARLFQQASPLDKPEPAAAVSAFDKSFDTIAKELVPWAAQALAS 371


>gi|85714926|ref|ZP_01045911.1| ABC transporter substrate-binding protein [Nitrobacter sp. Nb-311A]
 gi|85698123|gb|EAQ35995.1| ABC transporter substrate-binding protein [Nitrobacter sp. Nb-311A]
          Length = 236

 Score =  167 bits (422), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 50/204 (24%), Positives = 92/204 (45%), Gaps = 5/204 (2%)

Query: 3   KKLNKIIKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHI--QLIIT 60
           +  ++ + +        V     L+           YDL  ++ +     R +   L I 
Sbjct: 35  QVFSEGLARNTDKLDGIVAGLERLTGGGTTPAKKITYDLRAASGFPNPPDRPLKKSLAIP 94

Query: 61  EPITEKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQ 120
           EP     L+++  +   +  E      + W+D +P ++Q KL+ +FEN       ++   
Sbjct: 95  EPTAVIKLDTQRFLFSPA-KEYPDFAEAMWADSIPNLLQAKLLESFENYDIAHAPLRSMD 153

Query: 121 GIYADYQIISAIRSFEINIDR-HCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLH 179
           G+ ADYQ++  IR F+I  D    A I +S +I+N  +  +V  ++F    KL+K     
Sbjct: 154 GVKADYQLLIDIRRFQITTDPEPVADIGLSARILN-KNGKVVAARLFQDARKLDKIEPGA 212

Query: 180 FIQSLNRAFSRISSEIIDWTLSSL 203
              + N AF RI+ ++I WT+ +L
Sbjct: 213 ASAAFNDAFERIAKDMIAWTVKAL 236


>gi|209964742|ref|YP_002297657.1| lipoprotein, putative [Rhodospirillum centenum SW]
 gi|209958208|gb|ACI98844.1| lipoprotein, putative [Rhodospirillum centenum SW]
          Length = 224

 Score =  165 bits (419), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 38/202 (18%), Positives = 91/202 (45%), Gaps = 9/202 (4%)

Query: 10  KKKIISCSLAVLLCTSLS-SCFFHNNPVNIYDLTESTKYDESVQR-HIQLIITEPITEKI 67
           +++++  +  + L    S +      P  +Y L+ + ++   + R   QL++  P+    
Sbjct: 7   RRRLLGLTATLPLLGGCSVADVLTPPPPRLYVLSPAREFTAGLPRVDWQLLVETPLANTG 66

Query: 68  LNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQ 127
           +++  I +  +   + Y  G+ W D+ P M QL LI +FEN+ +I  V +   G+ AD+ 
Sbjct: 67  IDTARIALGETQSRLTYFAGANWVDRAPSMAQLLLIESFENSNRIVAVGREATGLRADFI 126

Query: 128 IISAIRSFEINIDR-------HCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHF 180
           + + +R F+   +            + M+ K++      +V  + F  +   +       
Sbjct: 127 LKTDLRDFQAEYNGGTPGESRPVGRVRMTAKLVRMPRRIIVASESFEAQVPAKGSAFSDM 186

Query: 181 IQSLNRAFSRISSEIIDWTLSS 202
           I++++ A   +   +++WT+  
Sbjct: 187 IEAMDDALEAVMRRMVEWTIRQ 208


>gi|288962792|ref|YP_003453086.1| hypothetical protein AZL_e01970 [Azospirillum sp. B510]
 gi|288915058|dbj|BAI76542.1| hypothetical protein AZL_e01970 [Azospirillum sp. B510]
          Length = 213

 Score =  165 bits (418), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 36/182 (19%), Positives = 81/182 (44%), Gaps = 7/182 (3%)

Query: 27  SSCFFHNNPVNIYDLTESTKYDESVQRHIQLIITEPITEKILNSEDIIVRSSPIEIQYLI 86
            S      P ++Y LT         +   QL++  P     +++  I +  +P  + Y  
Sbjct: 26  CSTLNPTAP-HLYTLTPRAGVAPGPKADWQLLVETPAAAAGIDTPRIALARTPTSLDYFA 84

Query: 87  GSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFEINIDRHCAI- 145
              W+D+ P M+Q  ++  FE++G+I +V +   G+ +DY + S +R F+       A  
Sbjct: 85  DVSWADRAPNMVQGLVVQTFEDSGRIVSVGRDTVGLRSDYVLKSELRDFQAEYSTPGAAM 144

Query: 146 -----ITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEIIDWTL 200
                + +S K++     S+   + F     +   +    + + + A  +++ ++++W+L
Sbjct: 145 PDRVHVRLSAKLVAMPRRSIEAGETFEASVPVRGRSFTDVVAAFDEALGKVTGDLVNWSL 204

Query: 201 SS 202
           S 
Sbjct: 205 SQ 206


>gi|300114236|ref|YP_003760811.1| hypothetical protein Nwat_1603 [Nitrosococcus watsonii C-113]
 gi|299540173|gb|ADJ28490.1| protein of unknown function DUF330 [Nitrosococcus watsonii C-113]
          Length = 217

 Score =  165 bits (418), Expect = 4e-39,   Method: Composition-based stats.
 Identities = 41/205 (20%), Positives = 101/205 (49%), Gaps = 8/205 (3%)

Query: 3   KKLNKIIKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQ--LIIT 60
           + +++++     S S+ +  CT L      + P+  + L  S   D S    ++  L I 
Sbjct: 11  RVISRMMFLAFASLSMTLPACTLL----PSSAPLQTFILPPSKPVDASNAAPLKAILRIA 66

Query: 61  EPITEKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQ 120
            P   +IL    I+V  +  ++    G++WS   P +++  L+  F  NG+++ V+  N 
Sbjct: 67  TPQANEILKGRRILVMPTSNQLNVYQGARWSLDAPSLLRDHLMDVFRRNGRLAGVIGENN 126

Query: 121 GIYADYQIISAIRSF--EINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKL 178
            + +D+ ++S + +F  E    +  A+I + +++I++    L+  + F V  + + +   
Sbjct: 127 PVDSDFLLLSELHAFHSEYRGKKPWAVIRLDVQLIDSTSRDLLASRRFSVPVESQDERLE 186

Query: 179 HFIQSLNRAFSRISSEIIDWTLSSL 203
             +++  +A   +S ++++W+L ++
Sbjct: 187 SVVEAFGQAVDELSRQLVEWSLINI 211


>gi|316935756|ref|YP_004110738.1| mammalian cell entry related domain-containing protein
           [Rhodopseudomonas palustris DX-1]
 gi|315603470|gb|ADU46005.1| Mammalian cell entry related domain protein [Rhodopseudomonas
           palustris DX-1]
          Length = 399

 Score =  165 bits (417), Expect = 4e-39,   Method: Composition-based stats.
 Identities = 54/171 (31%), Positives = 91/171 (53%), Gaps = 5/171 (2%)

Query: 38  IYDLTESTKYDES-VQRHIQLIITEPITEKILNSEDIIVRSSPIEIQYLIGSQWSDKLPR 96
           +YDL  +  +         QL I E  T  + +S+ +++    +EIQ   G+QWSD +P+
Sbjct: 203 VYDLAAAAGFPPPSPPLKGQLTIPESNTVILFDSQKMLLAP-GLEIQAFAGAQWSDSIPK 261

Query: 97  MIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFEINIDRH--CAIITMSLKIIN 154
           M+Q KLI +FEN       ++PN  +  DYQ+++ IRSF++  +R    A I  S KII+
Sbjct: 262 MLQEKLIQSFENYDIAHAPMRPNDAVQPDYQLLTDIRSFQVVGERDNLKAEIAFSGKIID 321

Query: 155 AHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEIIDWTLSSLPL 205
             D  LV  +VF     L K   +  + + +++F  I+ +++ WT  +L  
Sbjct: 322 -KDGKLVAARVFQQATTLAKPEPMAAVAAFDKSFDAIAKDLVPWTAQALAA 371


>gi|159044591|ref|YP_001533385.1| hypothetical protein Dshi_2047 [Dinoroseobacter shibae DFL 12]
 gi|157912351|gb|ABV93784.1| conserved hypothetical protein [Dinoroseobacter shibae DFL 12]
          Length = 208

 Score =  164 bits (416), Expect = 5e-39,   Method: Composition-based stats.
 Identities = 50/199 (25%), Positives = 99/199 (49%), Gaps = 10/199 (5%)

Query: 13  IISCSLAVLLCTSLSSC------FFHNNPVNIYDLTESTKYDESVQRHIQLIITEPITEK 66
           + +CS+A+L  +SLS C         +  +++Y+L       E   R   ++I  P T  
Sbjct: 7   LKACSVALLTLSSLSGCAAVSALGSASEVLDVYELQAPRTLPEGPVRARDVVIELPTTTG 66

Query: 67  ILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADY 126
            L ++ I++R  P++ QYL G +W D  P M+Q  ++   E +G++  V +   GI  DY
Sbjct: 67  ALQTDRIMIRPDPLQAQYLPGVRWGDATPVMVQTLMLRTLEASGRLGYVGRRPLGINGDY 126

Query: 127 QIISAIRSFEINI--DRHCAIITMSL--KIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQ 182
            +++ I  F+     +   A++ +SL  +++   D  ++G + F V+  +   ++   I 
Sbjct: 127 AVLTEIVDFQAEAVPEGPGAVVVLSLIGRVVRESDLRIMGTRRFAVQVPVASVSEAEVIA 186

Query: 183 SLNRAFSRISSEIIDWTLS 201
             ++A  ++ +E   W LS
Sbjct: 187 GFDQAAQQLFAEHGAWVLS 205


>gi|86748500|ref|YP_484996.1| hypothetical protein RPB_1375 [Rhodopseudomonas palustris HaA2]
 gi|86571528|gb|ABD06085.1| Mammalian cell entry related [Rhodopseudomonas palustris HaA2]
          Length = 390

 Score =  164 bits (415), Expect = 8e-39,   Method: Composition-based stats.
 Identities = 51/170 (30%), Positives = 91/170 (53%), Gaps = 4/170 (2%)

Query: 38  IYDLTESTKYDESVQR-HIQLIITEPITEKILNSEDIIVRSSPIEIQYLIGSQWSDKLPR 96
           +YDL  ++ +   V+    QL I EP T  + +S+ ++V    +++    G+QWSD +P+
Sbjct: 203 VYDLQPASGFSPPVRSMKGQLTIPEPTTVVLYDSQKMLVAP-GLDLPAFAGAQWSDSIPK 261

Query: 97  MIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFEINIDR-HCAIITMSLKIINA 155
           M+Q KLI +FEN       ++PN  +  DYQ++  IRSF++  +    A ++   KII+ 
Sbjct: 262 MLQEKLIQSFENYDIARPPLRPNDAVTPDYQLLIDIRSFQVAGEGAPSADVSFGAKIID- 320

Query: 156 HDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEIIDWTLSSLPL 205
            +  LV  ++F    +L++      + +   AF   + E+I WT+ SL  
Sbjct: 321 KNGRLVSARLFRQSARLDRPEPAAAVTAFETAFGAAAKELIPWTVDSLSS 370


>gi|149374949|ref|ZP_01892722.1| putative ABC-type uncharacterized transport system [Marinobacter
           algicola DG893]
 gi|149360838|gb|EDM49289.1| putative ABC-type uncharacterized transport system [Marinobacter
           algicola DG893]
          Length = 203

 Score =  163 bits (414), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 43/197 (21%), Positives = 88/197 (44%), Gaps = 7/197 (3%)

Query: 15  SCSLAVLLCTSLSSC-FFHNNPVN-IYDLTEST---KYDESVQRHIQLIITEPITEKILN 69
              L V + T LS+C  F + P N ++ L  ST       +      L    P+ E  ++
Sbjct: 7   RALLCVTVATMLSACTLFPDRPANRLFQLPASTVETSITGNKPFSTTLRFVTPLAEGPVD 66

Query: 70  SEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQII 129
           S  I+V+    EI+   G++WS+K P +++ +LI  F  +G+ + ++       +D  + 
Sbjct: 67  SSRILVKPEGNEIKAYQGARWSNKSPILVRDQLIDAFRRDGRFAGIITGTSPARSDLTMA 126

Query: 130 SAIRSFEINI--DRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRA 187
             + +F+         A+I + L +I+    + +  K F  +     +     +++   A
Sbjct: 127 GELSAFQSEYQDGMPVALIRLDLHLIDERTRNTLANKRFEYQHPATGEQVEAIVEAFGEA 186

Query: 188 FSRISSEIIDWTLSSLP 204
            + ++ E+I WT+   P
Sbjct: 187 SNALAREVIHWTVEQRP 203


>gi|182680566|ref|YP_001834712.1| hypothetical protein Bind_3671 [Beijerinckia indica subsp. indica
           ATCC 9039]
 gi|182636449|gb|ACB97223.1| protein of unknown function DUF330 [Beijerinckia indica subsp.
           indica ATCC 9039]
          Length = 198

 Score =  163 bits (413), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 52/200 (26%), Positives = 105/200 (52%), Gaps = 5/200 (2%)

Query: 1   MDKKLNKIIKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIIT 60
           M  +   ++  +     L + L  +L+ C   + P   +DL+ S        +  QL I 
Sbjct: 1   MKSEPASLLLSRGSWPGLLLGLSVTLAGC--ASGPPPTFDLSPSAGPFSVRAQRGQLAIA 58

Query: 61  EPITEKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQ 120
           EP+ +  ++S+ I+VR     + +L G+QW+D+LP ++Q +LI  FEN   +  V +P  
Sbjct: 59  EPVADVPIDSQRIVVRVQDDSVAFLRGAQWADRLPSLVQTRLIETFENAHLLREVGRP-- 116

Query: 121 GIYADYQIISAIRSFEINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHF 180
           G+ A+Y + + IR FE+ + ++ A++ ++ +++NA    +V  +VF  +     D+    
Sbjct: 117 GMAANYTLSTEIRRFELAVGQNQAVVVIAAQLVNA-TGKIVHGRVFSAKAPAVHDDGASA 175

Query: 181 IQSLNRAFSRISSEIIDWTL 200
             +L++A S++  +I+ W  
Sbjct: 176 TAALDQALSQVMQQIVVWAA 195


>gi|90425516|ref|YP_533886.1| hypothetical protein RPC_4041 [Rhodopseudomonas palustris BisB18]
 gi|90107530|gb|ABD89567.1| Mammalian cell entry related [Rhodopseudomonas palustris BisB18]
          Length = 367

 Score =  163 bits (412), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 49/167 (29%), Positives = 85/167 (50%), Gaps = 3/167 (1%)

Query: 38  IYDLTESTKYDESVQRHIQLIITEPITEKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRM 97
           +YDL  +T          QL I EP    + +++ +++    ++     G QWSD +P++
Sbjct: 203 VYDLRAATDLPPGKPIKGQLAIAEPTYVVMFDTQRLLLAP-GLDYPAFAGFQWSDSIPKL 261

Query: 98  IQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFEINIDRH-CAIITMSLKIINAH 156
           +Q KLI +FEN       ++ +  + AD+Q++  IRSF++       A +  S KI+ + 
Sbjct: 262 VQAKLIQSFENYDIAHAPLRASDALQADHQLLIDIRSFQVGGSPDLAAEVAFSAKIV-SK 320

Query: 157 DNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEIIDWTLSSL 203
           D   V  K+F     L+K   L  + + N AF  ++ E+I WT S+L
Sbjct: 321 DGKQVAAKLFRASAPLDKPEPLAALAAFNEAFGSVAKELIQWTASAL 367


>gi|92117462|ref|YP_577191.1| hypothetical protein Nham_1923 [Nitrobacter hamburgensis X14]
 gi|91800356|gb|ABE62731.1| Mammalian cell entry related protein [Nitrobacter hamburgensis X14]
          Length = 369

 Score =  162 bits (411), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 48/204 (23%), Positives = 96/204 (47%), Gaps = 5/204 (2%)

Query: 3   KKLNKIIKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQ--LIIT 60
           +  +  + +        V     ++     +     YDL  +  +    +R ++  L+I 
Sbjct: 168 QVFSDGLARNTDKLDGIVAGLERMTGGGVSSGQKVTYDLRAAHGFSSPPERTLKSKLVIP 227

Query: 61  EPITEKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQ 120
           EP     L+++  +   +  E      + W+D +P+++Q KL+ +FEN       ++   
Sbjct: 228 EPTAVIKLDTQRFLFSPA-KEYPGFAEAIWADSIPKLLQAKLLESFENYDIAHAPLRSMD 286

Query: 121 GIYADYQIISAIRSFEINIDRHCAI-ITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLH 179
           G+  DYQ++  IR F+I  D   A+ I +S +I+N  D  +V  ++F   +KL+K     
Sbjct: 287 GVQGDYQLLIDIRRFQIATDPEPAVDIGLSARILN-KDGKVVAARLFQDTQKLDKIEPAA 345

Query: 180 FIQSLNRAFSRISSEIIDWTLSSL 203
              + N AF RI+ ++I WT+ ++
Sbjct: 346 ASAAFNDAFGRIAKDMIAWTVKAI 369


>gi|217969578|ref|YP_002354812.1| hypothetical protein Tmz1t_1157 [Thauera sp. MZ1T]
 gi|217506905|gb|ACK53916.1| protein of unknown function DUF330 [Thauera sp. MZ1T]
          Length = 247

 Score =  162 bits (409), Expect = 4e-38,   Method: Composition-based stats.
 Identities = 37/216 (17%), Positives = 83/216 (38%), Gaps = 32/216 (14%)

Query: 18  LAVLLCTSLSSCFFHNNPVNIYDLTESTKYDES--------------------------- 50
           L V+      S      P+++Y L  ST    +                           
Sbjct: 26  LCVIALLPACSVLPEAAPLDVYVLPVSTGAPGASANMSPGNPIASPAATSTPAGGAPSAS 85

Query: 51  ---VQRHIQLIITEPITEKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFE 107
                    L +  P     L  + I+V      +    G+ WSD  P +++ +L+  F 
Sbjct: 86  AAARALPWSLRVVRPAAGVHLAGQRIVVMPEGNRVSVYQGAGWSDPAPALLRDRLLEAFR 145

Query: 108 NNGKISTVVKPNQGIYADYQIISAIRSFEINI--DRHCAIITMSLKIINAHDNSLVGQKV 165
            +G++  +    + ++AD+++ S +R+F+      R  A++ +  ++++     +V  + 
Sbjct: 146 ADGRVGALSSDERQLHADFELDSDLRAFQSEYRGGRPEAVLRLDARLVHTASRRIVASRT 205

Query: 166 FHVEEKLEKDNKLHFIQSLNRAFSRISSEIIDWTLS 201
           F   +          +Q+   A  R+S+E+++WT+ 
Sbjct: 206 FEQRQPTADPAVPAVVQAFGAAADRLSAEVVEWTVR 241


>gi|91975835|ref|YP_568494.1| hypothetical protein RPD_1355 [Rhodopseudomonas palustris BisB5]
 gi|91682291|gb|ABE38593.1| Mammalian cell entry related [Rhodopseudomonas palustris BisB5]
          Length = 390

 Score =  162 bits (409), Expect = 4e-38,   Method: Composition-based stats.
 Identities = 50/173 (28%), Positives = 84/173 (48%), Gaps = 5/173 (2%)

Query: 38  IYDLTESTKYDES-VQRHIQLIITEPITEKILNSEDIIVRSSPIEIQYLIGSQWSDKLPR 96
           +YDL  +  +         QL I EP T  + +S+ +++    +E+    G+QWSD +P+
Sbjct: 203 VYDLQPAKGFPPPTKSIRGQLTIPEPTTVVLYDSQKMLLAP-GLELPAFAGAQWSDSIPK 261

Query: 97  MIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFEINIDRHC--AIITMSLKIIN 154
           M+Q KLI +FEN       ++PN  +  DYQ++  +RSF+I        A +    KII+
Sbjct: 262 MLQEKLIQSFENYDIAHPPLRPNDAVQPDYQLLIDLRSFQIAGREAELVAEVAFGAKIID 321

Query: 155 AHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEIIDWTLSSLPLSD 207
                LV  ++F    KL+  +    + +   AF   +  +I WT+ SL    
Sbjct: 322 -KGGKLVAARLFQQSAKLDNPHPAAAVTAFETAFDATAKALIPWTVDSLATGA 373


>gi|119897562|ref|YP_932775.1| hypothetical protein azo1271 [Azoarcus sp. BH72]
 gi|119669975|emb|CAL93888.1| conserved hypothetical secreted protein [Azoarcus sp. BH72]
          Length = 214

 Score =  160 bits (406), Expect = 8e-38,   Method: Composition-based stats.
 Identities = 41/205 (20%), Positives = 93/205 (45%), Gaps = 3/205 (1%)

Query: 6   NKIIKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTES-TKYDESVQRHIQLIITEPIT 64
            ++ + + ++ +L V    S  S      PV++Y L  + T    S    + L + +P T
Sbjct: 8   RRLHRLRPLATALLVAALASACSILPKPEPVDVYLLPATRTPPAASPALALALRVAKPET 67

Query: 65  EKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYA 124
              L  + I+V      +    G+ WSD  P +++ +L+  F  +G+I+ +   ++ ++A
Sbjct: 68  SLHLAGQRIVVLPEGDRVSVYKGASWSDPAPLLVRNRLLDAFHGDGRIAALSSDDRSLHA 127

Query: 125 DYQIISAIRSF--EINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQ 182
           D ++ S +R+F  E    R  A++ +  +++      ++  + F V       +    ++
Sbjct: 128 DLELDSDLRAFHSEYRDGRPEAVVRLDARLVAPASLRILASRRFEVRHPAASADVKDVVR 187

Query: 183 SLNRAFSRISSEIIDWTLSSLPLSD 207
           +   A   +S+E++ WTL +     
Sbjct: 188 AFGAAADALSAEVVAWTLENAAAPA 212


>gi|254453840|ref|ZP_05067277.1| conserved hypothetical protein [Octadecabacter antarcticus 238]
 gi|198268246|gb|EDY92516.1| conserved hypothetical protein [Octadecabacter antarcticus 238]
          Length = 215

 Score =  160 bits (405), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 43/209 (20%), Positives = 96/209 (45%), Gaps = 7/209 (3%)

Query: 1   MDKKLNKIIKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYD--ESVQRHIQLI 58
           M +     I   +   S+ +  C++L +      P+++YDL   +     +  Q    ++
Sbjct: 1   MIRAATHKIIATLTLLSV-LGGCSALGALGDVTTPLSVYDLRAPSGAPVIQGGQLAQDVV 59

Query: 59  ITEPITEKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKP 118
           +  P T  +LN++ I++R   ++ QYL   +W D++P M+Q  ++ + EN   +  V + 
Sbjct: 60  VEIPTTSGVLNTDRIMIRPDTLQAQYLPDVRWGDEVPVMMQTLMLRSLENTNGLRYVGRR 119

Query: 119 NQGIYADYQIISAIRSFEI----NIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEK 174
                 DY I++ +  F+     +       I M+ +++   D S+V  + F  ++    
Sbjct: 120 PLAGSGDYAIVTELVDFQAELTPDGTGATVSIRMTSRLVRERDASIVASRTFRSQQAAAS 179

Query: 175 DNKLHFIQSLNRAFSRISSEIIDWTLSSL 203
            +    + + +RA   +  +  DWT+++L
Sbjct: 180 TDTSAIVVAFDRASDALLVDFADWTITAL 208


>gi|300312195|ref|YP_003776287.1| ABC transporter auxiliary component protein [Herbaspirillum
           seropedicae SmR1]
 gi|300074980|gb|ADJ64379.1| ABC-type uncharacterized transport system, auxiliary component
           protein [Herbaspirillum seropedicae SmR1]
          Length = 204

 Score =  159 bits (403), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 36/203 (17%), Positives = 86/203 (42%), Gaps = 12/203 (5%)

Query: 8   IIKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQ------RHIQLIITE 61
           +++  +++ SL +  C+ L       +P  +Y L  +T             R   L I  
Sbjct: 5   LLRTSLVAASLMLAACSIL----PKPDPQAVYRLPTATAMPAQASTTAGDIRLRALRIAT 60

Query: 62  PITEKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQG 121
           P   + ++SE I+V      I+   G +WSD  P + + +L+  F  +G+   +      
Sbjct: 61  PYANRSIDSERILVLPEGDVIKSYAGVRWSDAAPLLWRDRLLEAFRADGRYQRLSSDTGN 120

Query: 122 IYADYQIISAIRSFEINI--DRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLH 179
           I AD ++  A+ +F+          +I    ++I+  +   +  + F ++  ++      
Sbjct: 121 IAADIELDGALSAFQTEYRHGVPTVVIVYDARLIDTANRQQLASQRFAIQRAVDGSKVPE 180

Query: 180 FIQSLNRAFSRISSEIIDWTLSS 202
            + +  +A  +++ E+++W  + 
Sbjct: 181 VVSAFGQACDQLAKEVVNWAAAQ 203


>gi|299132340|ref|ZP_07025535.1| protein of unknown function DUF330 [Afipia sp. 1NLS2]
 gi|298592477|gb|EFI52677.1| protein of unknown function DUF330 [Afipia sp. 1NLS2]
          Length = 370

 Score =  159 bits (402), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 40/201 (19%), Positives = 95/201 (47%), Gaps = 3/201 (1%)

Query: 5   LNKIIKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIITEPIT 64
             + + +        +     ++         +IYDL     Y       +QL I EP  
Sbjct: 170 FAEGLARNTGRLDGIIAGLERMTGGGASETKKHIYDLEAVQTYVARSPLALQLAIPEPTV 229

Query: 65  EKILNSEDIIVRSSPIEIQY-LIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIY 123
              L+++ +++      +   ++ +QW+D +P+++Q +LI +F N  +    ++P +G+ 
Sbjct: 230 ILALDTQRLVITPESENLDPSIVQAQWADSIPKLVQARLIESFANYSEERAPIRPTEGVQ 289

Query: 124 ADYQIISAIRSFEIN-IDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQ 182
            D  ++S I+ F+++      A +++++KI+      +V  ++F   + +   +    + 
Sbjct: 290 VDATLLSEIQRFQVDMTSNPTAEVSLAVKIV-GKSGKIVASRIFRASQPVAHLDAKTVVS 348

Query: 183 SLNRAFSRISSEIIDWTLSSL 203
           +LN AFS ++ +I+ WT  +L
Sbjct: 349 ALNWAFSDVTKQIVTWTAGNL 369


>gi|254501713|ref|ZP_05113864.1| hypothetical protein SADFL11_1751 [Labrenzia alexandrii DFL-11]
 gi|222437784|gb|EEE44463.1| hypothetical protein SADFL11_1751 [Labrenzia alexandrii DFL-11]
          Length = 165

 Score =  158 bits (401), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 39/163 (23%), Positives = 80/163 (49%), Gaps = 1/163 (0%)

Query: 42  TESTKYDESVQRHIQLIITEPITEKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLK 101
                        +Q+++  P   K L++  I V  S     Y     W+D LP ++Q K
Sbjct: 3   AADVGGLSGRSSRVQVLVAPPRALKALDTTYIAVVDSGPVYSYFPNVAWADTLPNVVQNK 62

Query: 102 LIANFENNGKISTVVKPNQGIYADYQIISAIRSFEINIDR-HCAIITMSLKIINAHDNSL 160
           L+   +N G++  V  P  G+  DYQ+ + IR+FE+NI+  +  ++ ++ +++N  +   
Sbjct: 63  LLQTLQNTGRLRGVGLPGDGLLIDYQLQTDIRAFELNIEGANRGVVEIAARVVNDRNGRT 122

Query: 161 VGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEIIDWTLSSL 203
           V   VF  E      +    ++++N++  ++ ++I  WTL ++
Sbjct: 123 VANNVFRRETPSGSSDVEKAVEAMNQSAEQVFADIAAWTLRNV 165


>gi|254486952|ref|ZP_05100157.1| conserved hypothetical protein [Roseobacter sp. GAI101]
 gi|214043821|gb|EEB84459.1| conserved hypothetical protein [Roseobacter sp. GAI101]
          Length = 205

 Score =  158 bits (400), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 40/195 (20%), Positives = 91/195 (46%), Gaps = 3/195 (1%)

Query: 10  KKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIITEPITEKILN 69
           +  ++    A+  C+++S+      P++ +DL  +       +    L++  P     + 
Sbjct: 9   RIALLGGISALGGCSAVSALNSAAIPLDTFDLLPAAGTTTGRRTSHSLLVALPQAPAAIA 68

Query: 70  SEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQII 129
           S+ I+V+  P  I YL G++WSD+ P ++Q  LI +  + G+I  V +   G   D  ++
Sbjct: 69  SDRIVVKPDPASITYLPGARWSDEAPVLLQSLLIRSIASTGRIGYVGRSEGGPVPDTALL 128

Query: 130 SAIRSFEINIDRHC---AIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNR 186
             + +FE+NI       A++ ++L ++N  + +++  + F      + D     + +   
Sbjct: 129 VRMDAFEVNITPDGTMLAVVDIALTVLNDSNQNVIANRSFSQSAAADSDAPGAVVAAFQA 188

Query: 187 AFSRISSEIIDWTLS 201
           A + +   + DW + 
Sbjct: 189 ALNGLLPAMADWAMR 203


>gi|146342152|ref|YP_001207200.1| ABC transporter substrate-binding protein [Bradyrhizobium sp.
           ORS278]
 gi|146194958|emb|CAL78983.1| Putative ABC transporter (substrate binding protein)
           [Bradyrhizobium sp. ORS278]
          Length = 366

 Score =  158 bits (399), Expect = 6e-37,   Method: Composition-based stats.
 Identities = 42/203 (20%), Positives = 87/203 (42%), Gaps = 5/203 (2%)

Query: 3   KKLNKIIKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKY-DESVQRHIQLIITE 61
           K  +  + +        V     ++        V  YDLT        +     QL I E
Sbjct: 167 KTFSDGLARNTGKLDGIVSGLEKMTGGGAPAQKV-TYDLTAPRDLGPVNKTIKGQLAIPE 225

Query: 62  PITEKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQG 121
           P    +L ++ ++   +           W+D +P+++Q +LI  FEN       ++ +  
Sbjct: 226 PTAVAMLQTQRMLFSPAKD-YPGFGDVLWADSIPKLLQARLIDTFENYDVAHAPLRASDL 284

Query: 122 IYADYQIISAIRSFEINIDRHC-AIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHF 180
              D Q++  +R F IN+D    A I +S ++++     ++  ++F   + + + N    
Sbjct: 285 GQPDVQLLIDVRRFRINVDATAVADIGLSARLVD-KSGKIIASRLFDESQPVGQINPADA 343

Query: 181 IQSLNRAFSRISSEIIDWTLSSL 203
           + + ++AF R++  I+ WT+ SL
Sbjct: 344 VAAFDQAFGRLAKSILAWTVQSL 366


>gi|327478707|gb|AEA82017.1| putative lipoprotein [Pseudomonas stutzeri DSM 4166]
          Length = 206

 Score =  157 bits (398), Expect = 6e-37,   Method: Composition-based stats.
 Identities = 36/188 (19%), Positives = 81/188 (43%), Gaps = 4/188 (2%)

Query: 16  CSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQ-LIITEPITEKILNSEDII 74
               VL   +  +      P+ +Y L  +    +  +R  Q L I  P   +IL    I 
Sbjct: 11  ALACVLGTLAACTLLPEAEPIRVYLLPTAEATGQQGERLQQALRIHTPHASRILAGPRIA 70

Query: 75  VRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRS 134
           V     +I    G++WSD  P +++ +LI  F  +G +  V   +  ++A+ ++ S +R+
Sbjct: 71  VVPDGNQISSYQGARWSDAAPTLLRDRLIEQFRQSGPV-AVSNEDSNLFAELELFSELRA 129

Query: 135 FEINI--DRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRIS 192
           F+      +   ++ +  ++ +A D  ++  + F + +          + +  +A   +S
Sbjct: 130 FQSEYIDGQPQVLVRLDAQLASATDQRILASRRFEIRQPSAGPQLESVVAAFGQASDELS 189

Query: 193 SEIIDWTL 200
            ++  WT+
Sbjct: 190 RQLQCWTI 197


>gi|114570551|ref|YP_757231.1| hypothetical protein Mmar10_2001 [Maricaulis maris MCS10]
 gi|114341013|gb|ABI66293.1| conserved hypothetical protein [Maricaulis maris MCS10]
          Length = 209

 Score =  157 bits (398), Expect = 7e-37,   Method: Composition-based stats.
 Identities = 41/200 (20%), Positives = 89/200 (44%), Gaps = 7/200 (3%)

Query: 6   NKIIKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIITEPITE 65
           ++ ++  ++  S   L  ++  S    + PV++Y L+     +   +    + I  P   
Sbjct: 4   SRYLRAALVGVS--ALSVSACVSLLPESEPVSVYRLSSPEPVELQGESWTVIEIDVPNAP 61

Query: 66  KILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYAD 125
           + L+ + I +      + Y+ G++W    PR++Q  L+ +F  +G     ++ + GI AD
Sbjct: 62  RGLSGDQIAIMQDGSSLAYIQGARWISPTPRLLQSLLVESFNAHGGRLAPIRSDDGIRAD 121

Query: 126 YQIISAIRSFEINIDRHC-----AIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHF 180
           Y++   ++ FE   DR         + +S++++  H     G +V   E +   +     
Sbjct: 122 YELRLDMQEFEAVYDRGADIAPLVRVRISVRLVAEHGRRFAGARVVTAEVRASANRTSAI 181

Query: 181 IQSLNRAFSRISSEIIDWTL 200
           + + ++A    S EI DWT 
Sbjct: 182 VAAFDQASQTASREIADWTA 201


>gi|146280485|ref|YP_001170638.1| putative lipoprotein [Pseudomonas stutzeri A1501]
 gi|145568690|gb|ABP77796.1| lipoprotein, putative [Pseudomonas stutzeri A1501]
          Length = 206

 Score =  157 bits (398), Expect = 7e-37,   Method: Composition-based stats.
 Identities = 36/188 (19%), Positives = 81/188 (43%), Gaps = 4/188 (2%)

Query: 16  CSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQ-LIITEPITEKILNSEDII 74
               VL   +  +      P+ +Y L  +    +  +R  Q L I  P   +IL    I 
Sbjct: 11  ALACVLGTLAACTLLPEAEPIRVYLLPTAEATGQQGERLQQALRIHTPHASRILAGPRIA 70

Query: 75  VRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRS 134
           V     +I    G++WSD  P +++ +LI  F  +G +  V   +  ++A+ ++ S +R+
Sbjct: 71  VVPDGNQISSYQGARWSDAAPTLLRDRLIEQFRQSGPV-AVSNEDSNLFAELELFSELRA 129

Query: 135 FEINI--DRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRIS 192
           F+      +   ++ +  ++ +A D  ++  + F + +          + +  +A   +S
Sbjct: 130 FQSEYIDGQPQVLVRLDAQLASATDQRILASRRFEIRQPSAGPQLESVVAAFGQASDELS 189

Query: 193 SEIIDWTL 200
            ++  WT+
Sbjct: 190 RQLQRWTI 197


>gi|148257021|ref|YP_001241606.1| ABC transporter substrate-binding protein [Bradyrhizobium sp.
           BTAi1]
 gi|146409194|gb|ABQ37700.1| Putative ABC transporter (substrate binding protein)
           [Bradyrhizobium sp. BTAi1]
          Length = 367

 Score =  156 bits (395), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 37/203 (18%), Positives = 87/203 (42%), Gaps = 5/203 (2%)

Query: 3   KKLNKIIKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDE-SVQRHIQLIITE 61
           +  +  + +        V     ++        V  YDL     +   +     QL I E
Sbjct: 168 RTFSDGLARNTGKLDSIVSGLEKMTGGGAPAQKV-TYDLRAPRDFGPIAKTIKGQLAIPE 226

Query: 62  PITEKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQG 121
           P    +L ++ I+   +         + W+D +P+++Q +LI  FEN       ++    
Sbjct: 227 PTAVAMLQTQRILFSPAKD-YPGFGDALWADSIPKLLQARLIDAFENYDIAHAPLRTADL 285

Query: 122 IYADYQIISAIRSFEINIDRHCAI-ITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHF 180
              D Q++  +R F IN D    + I +S ++++     ++  ++F   + +++ +    
Sbjct: 286 GQPDVQLLVDVRRFRINTDPTAVVEIGLSARLVD-KSGKIIASRLFDESQPVDRLDPAIA 344

Query: 181 IQSLNRAFSRISSEIIDWTLSSL 203
           + + ++AF R++  ++ WT+ +L
Sbjct: 345 VTAFDQAFGRVAKSLLTWTVQAL 367


>gi|52842261|ref|YP_096060.1| hypothetical protein lpg2044 [Legionella pneumophila subsp.
           pneumophila str. Philadelphia 1]
 gi|52629372|gb|AAU28113.1| conserved domain protein [Legionella pneumophila subsp. pneumophila
           str. Philadelphia 1]
          Length = 200

 Score =  156 bits (394), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 42/196 (21%), Positives = 90/196 (45%), Gaps = 4/196 (2%)

Query: 12  KIISCSLAVLLCTSLSSCFFHNNPV-NIYDLTE-STKYDESVQRHIQLIITEPITEKILN 69
           +++S    +L   +L SC     PV N Y LT  STK      R I + +T P       
Sbjct: 2   RVLSSVCFILGILTLMSCSPVKVPVTNEYQLTAYSTKQLTRKPRPITIQVTVPEAVAGYQ 61

Query: 70  SEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQII 129
           +E+++    P +++  + + W+     M+   L+ + +++G    V        ADY++ 
Sbjct: 62  TEEMLYMKKPFKLEPFVKNAWTSPPADMLFPLLVQSLQSSGYFYAVTSSPYSEEADYRLD 121

Query: 130 SAIRSFEINIDRHCAIITMSLKII--NAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRA 187
           + +   E N  +  +++  S KI+  +  DN ++G ++  ++    +D     + + N+A
Sbjct: 122 TQLLKLEQNFIKKPSVLEFSAKIVLTHISDNQIIGSRIVSLQIPCSQDTPYGGVIAANQA 181

Query: 188 FSRISSEIIDWTLSSL 203
             R ++   D+ +S +
Sbjct: 182 TFRFTATATDFVVSHI 197


>gi|319788028|ref|YP_004147503.1| hypothetical protein Psesu_2440 [Pseudoxanthomonas suwonensis 11-1]
 gi|317466540|gb|ADV28272.1| protein of unknown function DUF330 [Pseudoxanthomonas suwonensis
           11-1]
          Length = 219

 Score =  156 bits (394), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 44/182 (24%), Positives = 75/182 (41%), Gaps = 7/182 (3%)

Query: 27  SSCFFHNN---PVNIYDLTE-STKYDESVQRHIQLIITEPITEKILNSEDIIVRSSPIEI 82
           + C         V IY     +           QL I  P   ++L+S  I VR  P E+
Sbjct: 26  AGCSLGGKRRDAVTIYAPEAIAVADPSWPTVDWQLAIARPSAPRLLDSPRIGVRPVPGEL 85

Query: 83  QYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFEINI--- 139
           Q   G+ W+     M++  ++   E++GKI  V +   G+ A Y++   IR FE +    
Sbjct: 86  QVYKGAVWAQTPADMLEASVLRVLEDSGKIEAVGRQAAGLRAHYRLTMDIRRFEADYRGG 145

Query: 140 DRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEIIDWT 199
           D   A + +  K+++  D  +V    F                + ++A + +S EI  WT
Sbjct: 146 DMPVASLEVVAKLVHNIDQRVVASHSFARTLPASSTGIASVAAAFDQALAEVSGEIAGWT 205

Query: 200 LS 201
           L+
Sbjct: 206 LA 207


>gi|209885949|ref|YP_002289806.1| putative ABC transporter [Oligotropha carboxidovorans OM5]
 gi|209874145|gb|ACI93941.1| putative ABC transporter [Oligotropha carboxidovorans OM5]
          Length = 371

 Score =  155 bits (393), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 42/202 (20%), Positives = 94/202 (46%), Gaps = 4/202 (1%)

Query: 5   LNKIIKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESV-QRHIQLIITEPI 63
             + + +        +     ++         ++YDL+    Y  +     +QL I EP 
Sbjct: 170 FAEGLARNTGRLDGILAGLERMTGGGEPQAQKHVYDLSAVQTYAATRTPLTLQLAIPEPT 229

Query: 64  TEKILNSEDIIVRSSPIEI-QYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGI 122
               L+++ +IV      +   +  +QW+D +P+++Q +L+ +FEN  +    V+P  G+
Sbjct: 230 VILALDTQRLIVTPEGDALDASIAQAQWADSIPKLVQARLLESFENYSEEKAPVRPTDGV 289

Query: 123 YADYQIISAIRSFEINIDR-HCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFI 181
             D  ++S IR F ++      A I++S+K++ A    +V  ++F   + +   +    +
Sbjct: 290 QTDATLLSEIRRFGVDTSGSPTAEISLSVKLV-AKSGQIVASRIFRSNQPVAHLDAKTAV 348

Query: 182 QSLNRAFSRISSEIIDWTLSSL 203
            +++RAF+  + +I+ W    L
Sbjct: 349 SAIDRAFTDTAKQIVTWAADKL 370


>gi|54297972|ref|YP_124341.1| hypothetical protein lpp2027 [Legionella pneumophila str. Paris]
 gi|53751757|emb|CAH13179.1| hypothetical protein lpp2027 [Legionella pneumophila str. Paris]
          Length = 200

 Score =  155 bits (393), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 42/196 (21%), Positives = 90/196 (45%), Gaps = 4/196 (2%)

Query: 12  KIISCSLAVLLCTSLSSCFFHNNPV-NIYDLTE-STKYDESVQRHIQLIITEPITEKILN 69
           +++S    +L   +L SC     PV N Y LT  STK      R I + +T P       
Sbjct: 2   RVLSSVCLILGILTLMSCSPVKVPVTNEYQLTAYSTKQLTRKPRPITIQVTVPEAVAGYQ 61

Query: 70  SEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQII 129
           +E+++    P +++  + + W+     M+   L+ + +++G    V        ADY++ 
Sbjct: 62  TEEMLYMKKPFKLEPFVKNAWTSPPADMLFPLLVQSLQSSGYFYAVTSSPYSEEADYRLD 121

Query: 130 SAIRSFEINIDRHCAIITMSLKII--NAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRA 187
           + +   E N  +  +++  S KI+  +  DN ++G ++  ++    +D     + + N+A
Sbjct: 122 TQLLKLEQNFIKKPSVLEFSAKIVLTHISDNQIIGSRIVSLQIPCSQDTPYGGVIAANQA 181

Query: 188 FSRISSEIIDWTLSSL 203
             R ++   D+ +S +
Sbjct: 182 TFRFTATATDFVVSHI 197


>gi|307610775|emb|CBX00387.1| hypothetical protein LPW_21081 [Legionella pneumophila 130b]
          Length = 200

 Score =  155 bits (392), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 42/196 (21%), Positives = 90/196 (45%), Gaps = 4/196 (2%)

Query: 12  KIISCSLAVLLCTSLSSCFFHNNPV-NIYDLTE-STKYDESVQRHIQLIITEPITEKILN 69
           +++S    +L   +L SC     PV N Y LT  STK      R I + +T P       
Sbjct: 2   RVLSSVCFILGILTLMSCSPVKVPVTNEYQLTAYSTKQLTRKPRAITIQVTVPEAVAGYQ 61

Query: 70  SEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQII 129
           +E+++    P +++  + + W+     M+   L+ + +++G    V        ADY++ 
Sbjct: 62  TEEMLYMKKPFKLEPFVKNAWTSPPADMLFPLLVQSLQSSGYFYAVTSSPYSEEADYRLD 121

Query: 130 SAIRSFEINIDRHCAIITMSLKII--NAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRA 187
           + +   E N  +  +++  S KI+  +  DN ++G ++  ++    +D     + + N+A
Sbjct: 122 TQLLKLEQNFIKKPSVLEFSAKIVLTHISDNQIIGSRIVSLQIPCSQDTPYGGVIAANQA 181

Query: 188 FSRISSEIIDWTLSSL 203
             R ++   D+ +S +
Sbjct: 182 TFRFTATATDFVVSHI 197


>gi|312115048|ref|YP_004012644.1| hypothetical protein Rvan_2321 [Rhodomicrobium vannielii ATCC
           17100]
 gi|311220177|gb|ADP71545.1| protein of unknown function DUF330 [Rhodomicrobium vannielii ATCC
           17100]
          Length = 198

 Score =  155 bits (392), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 41/199 (20%), Positives = 90/199 (45%), Gaps = 4/199 (2%)

Query: 6   NKIIKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIITEPITE 65
            ++++K     +  +L   ++      + P   +DL      +    R IQ+ +  P+  
Sbjct: 1   MRLMRKIAAIVAAGMLGGCAVGGLVGESAPA-TFDLEAPQ-VERMRARGIQITVYPPVAV 58

Query: 66  KILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYAD 125
           K +++ +I+V+     + Y  G+ W D+LP + Q +L+    N+G    V+     +  D
Sbjct: 59  KTIDTVEILVKGGNGRVAYFSGAAWGDRLPALFQARLVETLANSGAFRAVLTNQDRVTGD 118

Query: 126 YQIISAIRSFEINI--DRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQS 183
             +   IR F+++       A++ + +K+++   +S++  K FH        +    I +
Sbjct: 119 LSLAIEIRDFQVDATSGAPEAVVDVYVKLVDERTSSIITTKRFHARVAAAAPDPNAGIHA 178

Query: 184 LNRAFSRISSEIIDWTLSS 202
           LN AF ++++EI  W    
Sbjct: 179 LNIAFQQVAAEITTWVARR 197


>gi|319956953|ref|YP_004168216.1| hypothetical protein Nitsa_1214 [Nitratifractor salsuginis DSM
           16511]
 gi|319419357|gb|ADV46467.1| protein of unknown function DUF330 [Nitratifractor salsuginis DSM
           16511]
          Length = 195

 Score =  154 bits (390), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 44/190 (23%), Positives = 79/190 (41%), Gaps = 4/190 (2%)

Query: 11  KKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIITEPITEKILNS 70
           K ++S  +A  L   L  C      +++Y L  +        R   + +  P   +    
Sbjct: 2   KNLLSLLIAGALFFLLGGCS--GKTIHMYTLDAAGNLPRVHPRFSAIRVDYPKGIEDTMG 59

Query: 71  EDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIIS 130
             I    S +   Y   SQWS  L R++   LI   + +G    V+       A Y++  
Sbjct: 60  TRIYFSRSDLTQSYYGYSQWSKSLNRILMANLIEALQRSGIARNVLDYASQADAPYELEC 119

Query: 131 AIRSFE--INIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAF 188
            +  FE  I      A I++ L++I   D  L+  K+F+      + +   F+++ NRA 
Sbjct: 120 TVYRFEHQITPQGSTAEISIGLRLIRTEDKKLIASKIFNYSIPCTQTDARGFVEAANRAI 179

Query: 189 SRISSEIIDW 198
            R+S+++I W
Sbjct: 180 FRLSTDMIRW 189


>gi|54294943|ref|YP_127358.1| hypothetical protein lpl2022 [Legionella pneumophila str. Lens]
 gi|53754775|emb|CAH16262.1| hypothetical protein lpl2022 [Legionella pneumophila str. Lens]
          Length = 200

 Score =  154 bits (390), Expect = 6e-36,   Method: Composition-based stats.
 Identities = 43/196 (21%), Positives = 90/196 (45%), Gaps = 4/196 (2%)

Query: 12  KIISCSLAVLLCTSLSSCFFHNNPV-NIYDLTE-STKYDESVQRHIQLIITEPITEKILN 69
           +++S    +L   +L SC     PV N Y LT  STK      R I + +T P       
Sbjct: 2   RVLSSVCFILGILTLMSCSPVKVPVTNEYQLTAYSTKQLTRKPRPITIQVTVPEAVAGYQ 61

Query: 70  SEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQII 129
           +E+++    P +++  + + W+     M+   L+ + +++G    V        ADY++ 
Sbjct: 62  TEEMLYMKKPFKLEPFVKNAWTSPPADMLFPLLVQSLQSSGYFYAVTSSPYSEEADYRLD 121

Query: 130 SAIRSFEINIDRHCAIITMSLKII--NAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRA 187
           + +   E N  +  +I+  S KI+  +  DN ++G ++  ++    +D     + + N+A
Sbjct: 122 TQVLKLEQNFIKKPSILEFSAKIVLTHISDNQIIGSRIVSLQIPCSQDTPYGGVIAANQA 181

Query: 188 FSRISSEIIDWTLSSL 203
             R ++   D+ +S +
Sbjct: 182 TFRFTATATDFVVSHI 197


>gi|238754550|ref|ZP_04615904.1| hypothetical protein yruck0001_4180 [Yersinia ruckeri ATCC 29473]
 gi|238707181|gb|EEP99544.1| hypothetical protein yruck0001_4180 [Yersinia ruckeri ATCC 29473]
          Length = 145

 Score =  153 bits (386), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 31/143 (21%), Positives = 68/143 (47%), Gaps = 2/143 (1%)

Query: 64  TEKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIY 123
             + +NS  I V+    EI     S+WSD  P +++ +LI  F  +G++  V   +  + 
Sbjct: 2   ANQFINSTRIAVQPQGQEIAVYKASRWSDATPILVRNRLIQEFRADGRVRAVSSDDDSLQ 61

Query: 124 ADYQIISAIRSFE--INIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFI 181
           AD ++   + +F+   N D     I    +++   D  ++  + F + + ++  +    +
Sbjct: 62  ADVELSGDLSAFQGVYNSDGSIVRIRFDARLVRVSDRRIIATRQFDIHQPIKGTDMNDVV 121

Query: 182 QSLNRAFSRISSEIIDWTLSSLP 204
           Q+   A  R++++++ WTL   P
Sbjct: 122 QAFGAAGDRLAAQVLKWTLQQAP 144


>gi|163744192|ref|ZP_02151552.1| hypothetical protein OIHEL45_01375 [Oceanibulbus indolifex HEL-45]
 gi|161381010|gb|EDQ05419.1| hypothetical protein OIHEL45_01375 [Oceanibulbus indolifex HEL-45]
          Length = 206

 Score =  152 bits (385), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 45/204 (22%), Positives = 89/204 (43%), Gaps = 3/204 (1%)

Query: 1   MDKKLNKIIKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIIT 60
           M    N   +   +    ++  C++LS+      PV+ YDL  +    +  +   +L+I 
Sbjct: 1   MMPPANLTRRIAFLGAIASLSGCSALSALNTAAQPVDTYDLRPAPGSQKGPRSAAKLLIA 60

Query: 61  EPITEKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQ 120
            P     L S+ I+VRS    I YL  ++W D+ P ++Q  L+ +   +G+I  V     
Sbjct: 61  RPEASAALASDRIMVRSDGATITYLPDARWVDEAPIVLQGLLVRSIAASGRIGYVGPSEG 120

Query: 121 GIYADYQIISAIRSFEINIDRHCAI---ITMSLKIINAHDNSLVGQKVFHVEEKLEKDNK 177
           G   D  ++  + SFE+ I+    +   + ++L ++N  D  ++G + F    +   D+ 
Sbjct: 121 GPVPDKALLVRMDSFEVTIEPGGTVLVMVDLALTVLNDSDQRVLGIRNFAQSAQAGNDSP 180

Query: 178 LHFIQSLNRAFSRISSEIIDWTLS 201
                +   +   +  +  DW L 
Sbjct: 181 SAIAAAFQASLDVLLPDAADWVLR 204


>gi|114764124|ref|ZP_01443363.1| hypothetical protein 1100011001333_R2601_15737 [Pelagibaca
           bermudensis HTCC2601]
 gi|114543482|gb|EAU46497.1| hypothetical protein R2601_15737 [Roseovarius sp. HTCC2601]
          Length = 201

 Score =  149 bits (377), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 45/199 (22%), Positives = 94/199 (47%), Gaps = 4/199 (2%)

Query: 8   IIKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIITEPITEKI 67
           +++   I  + A+  C +L++    + P+ +Y+L          +R +++I+ EP+    
Sbjct: 1   MLRLIPILFAAALTGCGALTALEEASTPLEVYELRTPEVAQSGARRGVEVIVEEPLASGS 60

Query: 68  LNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQ 127
           L +E I++R SP++ QYL G +W+D  P M+Q  L+ +    G + +V +   G  ADY 
Sbjct: 61  LATERIMIRPSPLQAQYLPGVRWADPAPAMLQTMLVRSLSETGGLGSVSRRPVGPRADYA 120

Query: 128 IISAIRSFEIN----IDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQS 183
           ++  +  F+       +     +   L+++   D  +V  + F   E     +    + +
Sbjct: 121 VLGELTDFQGEAIEGAESGLVRVRFVLRVVREGDARVVATRSFEATELAAATDPDSIVAA 180

Query: 184 LNRAFSRISSEIIDWTLSS 202
            + A SR+  E + W +S 
Sbjct: 181 FDSATSRLLPEAVAWIVSQ 199


>gi|154252957|ref|YP_001413781.1| ABC transporter auxiliary component-like protein [Parvibaculum
           lavamentivorans DS-1]
 gi|154156907|gb|ABS64124.1| ABC-type uncharacterized transport system auxiliary component-like
           protein [Parvibaculum lavamentivorans DS-1]
          Length = 228

 Score =  147 bits (372), Expect = 6e-34,   Method: Composition-based stats.
 Identities = 47/211 (22%), Positives = 83/211 (39%), Gaps = 10/211 (4%)

Query: 1   MDKKLNKIIKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQ--RHIQLI 58
           M   + K+ +   +   LA L   +L+       P ++Y LT  T          + QL 
Sbjct: 6   MKTAIAKLTRLAALVLVLAPLGACALADVASGPAP-SLYVLTAPTPALPGTAMAANTQLS 64

Query: 59  ITEPITEKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKP 118
           + E      +++  I+ + SP EI+Y  G++WSD+ PRMI   L+    N G+   ++ P
Sbjct: 65  VREFQAPSAIDTGRIVFQPSPNEIKYYAGARWSDRAPRMIASLLVETLTNTGRFPAILGP 124

Query: 119 NQGIYADYQIISAIRSFEINIDRHC-------AIITMSLKIINAHDNSLVGQKVFHVEEK 171
                 D  +   IR+F    D            +   ++++ A    ++  + F  E  
Sbjct: 125 ETQARTDLALTGDIRAFSAFRDGAGLGEGATKVRVAFFVRLVRARGGVVLAGREFTAEAA 184

Query: 172 LEKDNKLHFIQSLNRAFSRISSEIIDWTLSS 202
                    + + N A     S+I  WTL  
Sbjct: 185 SASGRMDDIVAAYNAALDTALSDITAWTLEQ 215


>gi|148359618|ref|YP_001250825.1| transport protein [Legionella pneumophila str. Corby]
 gi|296107660|ref|YP_003619361.1| ABC-type uncharacterized transport system, auxiliary component
           [Legionella pneumophila 2300/99 Alcoy]
 gi|148281391|gb|ABQ55479.1| transport system, auxiliary component [Legionella pneumophila str.
           Corby]
 gi|295649562|gb|ADG25409.1| ABC-type uncharacterized transport system, auxiliary component
           [Legionella pneumophila 2300/99 Alcoy]
          Length = 184

 Score =  147 bits (372), Expect = 7e-34,   Method: Composition-based stats.
 Identities = 39/180 (21%), Positives = 82/180 (45%), Gaps = 4/180 (2%)

Query: 28  SCFFHNNPV-NIYDLTE-STKYDESVQRHIQLIITEPITEKILNSEDIIVRSSPIEIQYL 85
           SC     PV N Y LT  STK      R I + +T P       +E+++    P +++  
Sbjct: 2   SCSPVKVPVTNEYQLTAYSTKQLTRKPRPITIQVTVPEAVAGYQTEEMLYMKKPFKLEPF 61

Query: 86  IGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFEINIDRHCAI 145
           + + W+     M+   L+ + +++G    V        ADY++ + +   E N  +  ++
Sbjct: 62  VKNAWTSPPADMLFPLLVQSLQSSGYFYAVTSSPYSEEADYRLDTQLLKLEQNFIKKPSV 121

Query: 146 ITMSLKII--NAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEIIDWTLSSL 203
           +  S KI+  +  DN ++G ++  ++    +D     + + N+A  R ++   D+ +S +
Sbjct: 122 LEFSAKIVLTHISDNQIIGSRIVSLQIPCSQDTPYGGVIAANQATFRFTATATDFVVSHI 181


>gi|292490600|ref|YP_003526039.1| hypothetical protein Nhal_0466 [Nitrosococcus halophilus Nc4]
 gi|291579195|gb|ADE13652.1| protein of unknown function DUF330 [Nitrosococcus halophilus Nc4]
          Length = 208

 Score =  147 bits (372), Expect = 7e-34,   Method: Composition-based stats.
 Identities = 36/199 (18%), Positives = 79/199 (39%), Gaps = 6/199 (3%)

Query: 10  KKKIISCSLAVLLCTSLSSCFFHNN---PVNIYDLTES-TKYDESVQRHIQLIITEPITE 65
           ++++    L +++   LSSC        PV  Y L         +    + L+++ P   
Sbjct: 6   RRQLPYRGLCLIMVVILSSCTLSPKQPGPVRTYLLAPQLPPQTTAAPTPLTLLVSTPQAA 65

Query: 66  KILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYAD 125
               +  I     P E+ Y   +QW D   RM++  L+   E +G   ++   +  I A+
Sbjct: 66  AGYGTSQIAYTRKPYELDYFSRNQWVDTPERMLKPILVNALEASGHFQSIAPDDTRILAE 125

Query: 126 YQIISAIRSFEINIDRHCAI--ITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQS 183
            ++ + I     +     +   + +  ++I+      +  + F   E   ++     + +
Sbjct: 126 LRLDTEILRLVQDFSGQPSQSHLVLRARLIDLAKGEEIASQTFEAREPAPEEGPYGGVIA 185

Query: 184 LNRAFSRISSEIIDWTLSS 202
           LNRA  RI  E++ +   +
Sbjct: 186 LNRALERILRELVTFCARA 204


>gi|84516865|ref|ZP_01004223.1| hypothetical protein SKA53_06797 [Loktanella vestfoldensis SKA53]
 gi|84509333|gb|EAQ05792.1| hypothetical protein SKA53_06797 [Loktanella vestfoldensis SKA53]
          Length = 189

 Score =  147 bits (371), Expect = 9e-34,   Method: Composition-based stats.
 Identities = 39/186 (20%), Positives = 81/186 (43%), Gaps = 3/186 (1%)

Query: 18  LAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIITEPITEKILNSEDIIVRS 77
           +A+  C+++S+       ++ YDL   +      Q    L++  P     ++++ I+VR 
Sbjct: 1   MALGGCSAVSALNAAGTALDTYDLIPPSGGTTGRQTRRTLLVALPDATAAISTDRILVRP 60

Query: 78  SPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFEI 137
               I YL   +W+ +LPR++Q  L+      G+I  V     G   D  +++ + +F++
Sbjct: 61  DAAAITYLPDGRWTSELPRVVQSLLVRAISGTGRIGYVGPAEGGPVPDSALLTRVDAFDV 120

Query: 138 NID---RHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSE 194
            I       A I ++L ++N  D  ++G + F     +  D+    +         +   
Sbjct: 121 TIGADRMPVAAIDITLTVLNDRDQRVIGSRRFSQSVPVAGDSPAAIVAGFQALVDALLPA 180

Query: 195 IIDWTL 200
           + DW L
Sbjct: 181 MADWVL 186


>gi|119385045|ref|YP_916101.1| hypothetical protein Pden_2314 [Paracoccus denitrificans PD1222]
 gi|119374812|gb|ABL70405.1| conserved hypothetical protein [Paracoccus denitrificans PD1222]
          Length = 208

 Score =  146 bits (369), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 39/186 (20%), Positives = 82/186 (44%), Gaps = 5/186 (2%)

Query: 22  LCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHI--QLIITEPITEKILNSEDIIVRSSP 79
            C +L +     +  ++++L   +    S  R    +L+I  P     L+++ I+VR + 
Sbjct: 16  GCAALRALEGEPD-RDVFELRPPSDVPRSCGRGRLAELVIEPPKARGTLDTDRIMVRPNE 74

Query: 80  IEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFEINI 139
           ++ QYL  ++W D +P  +Q  L+  F      + V +   G   DY +IS +  F   +
Sbjct: 75  LQTQYLPDARWGDTVPVTLQTLLVRGFGVYDAFTHVGRAPLGTAGDYALISEVNDFNAEV 134

Query: 140 DRHCAIITM--SLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEIID 197
               AII +    +++   D  +V +  F    +         I + + A  ++ +++ D
Sbjct: 135 AGQGAIIKLTVDAQMVREMDARVVSRGHFTATAQAPTTKTADLIPAFDAAGQQLVAQMTD 194

Query: 198 WTLSSL 203
           W L ++
Sbjct: 195 WGLRAV 200


>gi|254496225|ref|ZP_05109119.1| conserved hypothetical protein [Legionella drancourtii LLAP12]
 gi|254354530|gb|EET13171.1| conserved hypothetical protein [Legionella drancourtii LLAP12]
          Length = 201

 Score =  146 bits (368), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 43/196 (21%), Positives = 88/196 (44%), Gaps = 7/196 (3%)

Query: 12  KIISCSLAVLLCTSLSSCFFHNNPV-NIYDLTE-STKYDESVQRHIQLIITEPITEKILN 69
           K I  S++ L   +L +C     PV N Y LTE S+K      RHI L +T P       
Sbjct: 5   KGIGVSMSAL---TLIACSPVKIPVTNQYQLTEYSSKQLAKHPRHIALWVTAPEAVAGYQ 61

Query: 70  SEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQII 129
           +E ++  + P +    + + W++    M+   ++ + +  G    V+       ADY++ 
Sbjct: 62  TEQMLYVNKPFQRAPFVKNAWTNPPGDMLYPLMVQSLQRTGFFYAVMSSVYSQGADYRLD 121

Query: 130 SAIRSFEINIDRHCAIITMSLKIINAH--DNSLVGQKVFHVEEKLEKDNKLHFIQSLNRA 187
           + + S E N  +  ++I  S K++     DN ++  K+   +     +     + + N+A
Sbjct: 122 TQLLSLEQNFLKKPSVIEFSAKVVLTKVADNKVIASKIISQQIPCPAETPYGGVVAANKA 181

Query: 188 FSRISSEIIDWTLSSL 203
             + ++ + D+ +S +
Sbjct: 182 TRQFTAIMSDFVVSHI 197


>gi|146277756|ref|YP_001167915.1| ABC-type uncharacterized transport system auxiliary component-like
           protein [Rhodobacter sphaeroides ATCC 17025]
 gi|145555997|gb|ABP70610.1| ABC-type uncharacterized transport system auxiliary component-like
           protein [Rhodobacter sphaeroides ATCC 17025]
          Length = 201

 Score =  145 bits (367), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 36/201 (17%), Positives = 85/201 (42%), Gaps = 5/201 (2%)

Query: 5   LNKIIKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIITEPIT 64
           +  + +  ++  +L +  C +++S    +  ++ Y L+          RH  +++     
Sbjct: 1   MRALTRSTLLVATLMLAGCGAVTSLSRASEQLDTYTLSPLPGPGGGGARH--VVVEPVTA 58

Query: 65  EKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYA 124
              L+++ I+++ S ++ QYL  ++WSD  P ++Q  L+ + +N G    V +   G+  
Sbjct: 59  GGALSTDRILIKPSRVQAQYLPDARWSDPAPALVQTLLVGSLQNAGGFRLVAREAAGLIP 118

Query: 125 DYQIISAIRSFEINIDR---HCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFI 181
           DY +++ +R F+            + M L +I   D S+   +          D     +
Sbjct: 119 DYTLMTELRDFQAEAPPGATPVVRVAMVLTLIRESDRSVASSRRVEAVAPAASDTTGDVV 178

Query: 182 QSLNRAFSRISSEIIDWTLSS 202
            +   A ++   + I W  + 
Sbjct: 179 VAFEAAVTQALGQAIGWARAQ 199


>gi|221639254|ref|YP_002525516.1| hypothetical protein RSKD131_1155 [Rhodobacter sphaeroides KD131]
 gi|221160035|gb|ACM01015.1| Hypothetical Protein RSKD131_1155 [Rhodobacter sphaeroides KD131]
          Length = 195

 Score =  144 bits (364), Expect = 6e-33,   Method: Composition-based stats.
 Identities = 36/184 (19%), Positives = 80/184 (43%), Gaps = 5/184 (2%)

Query: 22  LCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIITEPITEKILNSEDIIVRSSPIE 81
            C ++SS    +  ++ Y L+          RH  +++        L ++ I+V+ S ++
Sbjct: 12  GCGAVSSLSRASEQLDTYTLSPLPGTGGGGSRH--IVVEAATAGGALATDRILVKPSRVQ 69

Query: 82  IQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFEINIDR 141
             YL  ++WSD  P ++Q  L+ + +N G    V +   G+  DY +++ +R F+  +  
Sbjct: 70  ALYLPDARWSDPAPALLQTLLVGSLQNGGGFRLVAREAAGLVPDYTLMTELRDFQAEVPP 129

Query: 142 ---HCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEIIDW 198
                  ++M L +I   D S+   +    +     D+    + + + A ++   E + W
Sbjct: 130 GQTPTVHVSMVLTLIRESDRSVASTRRIEAQAPAASDSTGDVVVAFDTAVTQALGEAVAW 189

Query: 199 TLSS 202
             + 
Sbjct: 190 ARAQ 193


>gi|77463399|ref|YP_352903.1| hypothetical protein RSP_2812 [Rhodobacter sphaeroides 2.4.1]
 gi|77387817|gb|ABA79002.1| conserved hypothetical protein [Rhodobacter sphaeroides 2.4.1]
          Length = 201

 Score =  144 bits (363), Expect = 7e-33,   Method: Composition-based stats.
 Identities = 37/184 (20%), Positives = 81/184 (44%), Gaps = 5/184 (2%)

Query: 22  LCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIITEPITEKILNSEDIIVRSSPIE 81
            C ++SS    +  ++ Y L+          RH  +++        L ++ I+++ S ++
Sbjct: 18  GCGAVSSLSRASEQLDTYTLSPLPGTGGGGSRH--IVVEAATAGGALATDRILIKPSRVQ 75

Query: 82  IQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFEINIDR 141
             YL  ++WSD  P ++Q  L+ + +N G    V +   G+  DY +++ +R F+  +  
Sbjct: 76  ALYLPDARWSDPAPALVQTLLVGSLQNGGGFRLVAREAAGLVPDYTLMTELREFQAEVPP 135

Query: 142 HCA---IITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEIIDW 198
             A    I+M L +I   D S+   +    +     D+    + + + A ++   E + W
Sbjct: 136 GQAPIVRISMVLTLIRESDRSVASTRRIETQAPAASDSTGDVVVAFDTAVTQALGEAVGW 195

Query: 199 TLSS 202
             + 
Sbjct: 196 ARAQ 199


>gi|126462254|ref|YP_001043368.1| hypothetical protein Rsph17029_1486 [Rhodobacter sphaeroides ATCC
           17029]
 gi|126103918|gb|ABN76596.1| conserved hypothetical protein [Rhodobacter sphaeroides ATCC 17029]
          Length = 201

 Score =  143 bits (362), Expect = 9e-33,   Method: Composition-based stats.
 Identities = 37/184 (20%), Positives = 81/184 (44%), Gaps = 5/184 (2%)

Query: 22  LCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIITEPITEKILNSEDIIVRSSPIE 81
            C ++SS    +  ++ Y L+          RH  +++        L ++ I+++ S ++
Sbjct: 18  GCGAVSSLSRASEQLDTYTLSPLPGTGGGGSRH--IVVEAATAGGALATDRILIKPSRVQ 75

Query: 82  IQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFEINIDR 141
             YL  ++WSD  P ++Q  L+ + +N G    V +   G+  DY +++ +R F+  +  
Sbjct: 76  ALYLPDARWSDPAPALVQTLLVGSLQNGGGFRLVAREAAGLVPDYTLMTELREFQAEVPP 135

Query: 142 HCA---IITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEIIDW 198
             A    I+M L +I   D S+   +    +     D+    + + + A ++   E + W
Sbjct: 136 GQAPVVRISMVLTLIRESDRSVASTRRIETQAPAASDSTGDVVVAFDTAVTQALGEAVGW 195

Query: 199 TLSS 202
             + 
Sbjct: 196 ARAQ 199


>gi|302039180|ref|YP_003799502.1| putative ABC transporter auxiliary component [Candidatus Nitrospira
           defluvii]
 gi|300607244|emb|CBK43577.1| putative ABC-type transport system, auxiliary component [Candidatus
           Nitrospira defluvii]
          Length = 215

 Score =  143 bits (361), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 45/210 (21%), Positives = 87/210 (41%), Gaps = 11/210 (5%)

Query: 8   IIKKKIISCSLAVLLCTSLSSCFF---HNNPVNIYDLTESTKYDESVQRHIQ------LI 58
           ++ ++ I    AV++  +L++C       NPV+ + LT       +  R  Q      L+
Sbjct: 1   MVSRRAIPWVGAVMMSCALAACVLPRSAENPVHTFLLTIDESAWRAGARAGQPEVHGVLV 60

Query: 59  ITEPITEKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKP 118
           +  P  E       +     P E+ Y   + W D   RM+   L+ + E  G    VV  
Sbjct: 61  VGLPQAEAGFEQPRMAYLQRPYEVSYYATNVWVDAPARMLAPLLVRSLEATGLWRVVVSM 120

Query: 119 NQGIYADYQIISAIRSFEINIDRHCAIITMSLK--IINAHDNSLVGQKVFHVEEKLEKDN 176
              +  DY++ ++    +    +  +   + L+  ++   D  ++G + F V E    D+
Sbjct: 121 PTVVRGDYRLDTSGLVLQQEFLQQPSRTRLHLRAQLLEMKDQRVLGVRSFEVLEPASSDD 180

Query: 177 KLHFIQSLNRAFSRISSEIIDWTLSSLPLS 206
               +Q+ NRA +R+   + DW  S L  +
Sbjct: 181 AYGGVQAANRAVTRVLEALNDWIASCLRAA 210


>gi|170743044|ref|YP_001771699.1| hypothetical protein M446_4936 [Methylobacterium sp. 4-46]
 gi|168197318|gb|ACA19265.1| protein of unknown function DUF330 [Methylobacterium sp. 4-46]
          Length = 198

 Score =  142 bits (359), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 47/173 (27%), Positives = 83/173 (47%), Gaps = 2/173 (1%)

Query: 27  SSCFFHNNPVNIYDLTESTKYDESVQRHIQLIITEPITEKILNSEDIIVRSSPIEIQYLI 86
             C         +DLT       +      LI+ EP+  +   ++ IIVR     + +L 
Sbjct: 24  GGCG--GTVPTTFDLTALPGAARAGSARRSLIVAEPVGLQPFEADRIIVREPGGSLSFLG 81

Query: 87  GSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFEINIDRHCAII 146
           G QW D+LPR+IQ +LI + EN   +  V +P   I AD  +++ IR+F+I      A++
Sbjct: 82  GGQWVDRLPRLIQARLIQSLENARSLRAVSRPGDKIAADTLLVTEIRAFDIAAGSREAVV 141

Query: 147 TMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEIIDWT 199
            +S K+++    S+V  +VF     +   +       L+RA S + ++++ W 
Sbjct: 142 DLSAKLVSEATGSVVAARVFAARVPVADLSPGASANGLDRALSLVLADVVRWV 194


>gi|218678849|ref|ZP_03526746.1| putative ABC transporter protein [Rhizobium etli CIAT 894]
          Length = 173

 Score =  142 bits (358), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 55/140 (39%), Positives = 82/140 (58%), Gaps = 5/140 (3%)

Query: 9   IKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIITEPITEKIL 68
           IK  +++  L  L+   LS C       + YDL+ +   D    +  Q++I  P   + L
Sbjct: 13  IKGTVVALPLIALI---LSGCGTSAK-NDTYDLSAAVDGDGPAAKSRQILIAGPTALRAL 68

Query: 69  NSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQI 128
           +SE I++R S  EIQYL  +QW DKLPRM+Q KL+  FEN+GK+  V  P QG+  DYQ+
Sbjct: 69  DSEQIVIRVSSSEIQYLSRAQWGDKLPRMVQSKLVEAFENSGKLGGVGMPGQGLAIDYQV 128

Query: 129 ISAIRSFEINI-DRHCAIIT 147
           ++ IRSFEI+    + A++ 
Sbjct: 129 VTDIRSFEIDASSGNQAVVE 148


>gi|220924822|ref|YP_002500124.1| hypothetical protein Mnod_4964 [Methylobacterium nodulans ORS 2060]
 gi|219949429|gb|ACL59821.1| protein of unknown function DUF330 [Methylobacterium nodulans ORS
           2060]
          Length = 200

 Score =  142 bits (357), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 44/164 (26%), Positives = 85/164 (51%)

Query: 36  VNIYDLTESTKYDESVQRHIQLIITEPITEKILNSEDIIVRSSPIEIQYLIGSQWSDKLP 95
              +DLT       +      L++ EP+  +   ++ IIVR     + +L G QW+D+LP
Sbjct: 33  PTTFDLTAVPGAARAGAARRSLVVAEPVGLQPFEADRIIVREPGGSLSFLGGGQWADRLP 92

Query: 96  RMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFEINIDRHCAIITMSLKIINA 155
           R++Q +LI + EN  ++ +V +P   I AD  +++ IR+F+I      A++ +S K+I+ 
Sbjct: 93  RLVQARLIQSLENANRLRSVSRPGDKIAADTLLVTEIRAFDIAAGTREAVVDLSAKLISD 152

Query: 156 HDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEIIDWT 199
              ++V  +VF     ++          L+RA S + ++++ W 
Sbjct: 153 ATGAVVAARVFEARVPVQDVTPASAANGLDRALSIVLADVVRWI 196


>gi|218886597|ref|YP_002435918.1| ABC transporter [Desulfovibrio vulgaris str. 'Miyazaki F']
 gi|218757551|gb|ACL08450.1| protein of unknown function DUF330 [Desulfovibrio vulgaris str.
           'Miyazaki F']
          Length = 247

 Score =  141 bits (356), Expect = 6e-32,   Method: Composition-based stats.
 Identities = 34/179 (18%), Positives = 79/179 (44%), Gaps = 6/179 (3%)

Query: 31  FHNNPVNIYDLTESTKYDESVQRHIQLIITEPITEKILNSEDIIVR---SSPIEIQYLIG 87
               P ++               H+QL I+ P T ++L+++ I++     +  E++Y  G
Sbjct: 64  PGPAPTHLLLAPAMPGPGAGGAVHLQLAISLPETSRMLDTDRIVLVLGGENGREVRYYAG 123

Query: 88  SQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFEINIDRHCA--- 144
           ++W+   PR++Q  L+  FE  G++    + + GIY DY++++ +R F   +    A   
Sbjct: 124 AKWTSPAPRLVQRLLVEAFERAGRLDGAAEESAGIYPDYRLMTDLRRFNTRMGEGAAPLV 183

Query: 145 IITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEIIDWTLSSL 203
            + ++L+++N     +V       +            ++   A   + +    W+L ++
Sbjct: 184 EVELALRLVNLKTGRIVAFTSIGRDCPAAGSALPQVAEAFETAMGDVLARATAWSLEAM 242


>gi|296445999|ref|ZP_06887949.1| protein of unknown function DUF330 [Methylosinus trichosporium
           OB3b]
 gi|296256517|gb|EFH03594.1| protein of unknown function DUF330 [Methylosinus trichosporium
           OB3b]
          Length = 191

 Score =  141 bits (355), Expect = 6e-32,   Method: Composition-based stats.
 Identities = 42/166 (25%), Positives = 87/166 (52%), Gaps = 3/166 (1%)

Query: 39  YDLTESTKYD-ESVQRHIQLIITEPITEKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRM 97
           +DL+ +      +      L + EP   + ++S+ I++R+ P  + +L  +QW D+LPR+
Sbjct: 28  FDLSSALGEGVAARPLRRTLAVAEPHAIQPVDSDRIVIRTGPNGLAHLAEAQWVDRLPRL 87

Query: 98  IQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFEINIDRHCAIITMSLKIINAHD 157
           +Q +LIA F+   K   VV+P Q   A+  + + IR FEI++    A++ ++ +I++   
Sbjct: 88  VQARLIAAFDRGRKTGFVVRPGQ--AAERILSTDIRRFEIDVSSGEAVVEIAAEILDLRG 145

Query: 158 NSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEIIDWTLSSL 203
            +    ++F  E   E       + +L+ A + +  +I+ WT + +
Sbjct: 146 AATGPGRIFSAEAPAEHSTGPAAVHALDEALTSVLRQIVRWTAAQV 191


>gi|217978937|ref|YP_002363084.1| protein of unknown function DUF330 [Methylocella silvestris BL2]
 gi|217504313|gb|ACK51722.1| protein of unknown function DUF330 [Methylocella silvestris BL2]
          Length = 207

 Score =  139 bits (351), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 54/204 (26%), Positives = 96/204 (47%), Gaps = 6/204 (2%)

Query: 1   MDKKLNKIIKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDL-TESTKYDESVQRHIQLII 59
           + +  +++   +     +       L++C   + P   +DL    T +     R  Q+ I
Sbjct: 9   LRQTASRLAALRPGRLMIVFASAGILAAC--ASAPPATFDLDAAPTGFSAKQARRAQIAI 66

Query: 60  TEPITEKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPN 119
             P     ++S  I+VR    +I  L G+ WS++LP ++Q KLIA+F+N   I  VV P 
Sbjct: 67  AAPSALPPVDSNRIVVRVGEDQIALLAGAAWSNQLPALLQAKLIASFQNASLIRAVVSP- 125

Query: 120 QGIYADYQIISAIRSFEINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLH 179
            G+ ADY++ S IRSFE    R    + +S +I+      +V  K+F        ++   
Sbjct: 126 -GMPADYELRSQIRSFEYVAGRGAVFVEISAQIVGGA-GRIVAGKIFSATAPAPANDGAT 183

Query: 180 FIQSLNRAFSRISSEIIDWTLSSL 203
            + +LN A + +  +I+ WT   +
Sbjct: 184 VVAALNAATADVMRQIVRWTAPQI 207


>gi|270159821|ref|ZP_06188477.1| putative lipoprotein [Legionella longbeachae D-4968]
 gi|289165421|ref|YP_003455559.1| hypothetical protein LLO_2088 [Legionella longbeachae NSW150]
 gi|269988160|gb|EEZ94415.1| putative lipoprotein [Legionella longbeachae D-4968]
 gi|288858594|emb|CBJ12475.1| Conserved hypothetical protein [Legionella longbeachae NSW150]
          Length = 199

 Score =  139 bits (351), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 37/192 (19%), Positives = 80/192 (41%), Gaps = 4/192 (2%)

Query: 14  ISCSLAVLLCTSLSSCFFHNNPV-NIYDLTE-STKYDESVQRHIQLIITEPITEKILNSE 71
           ++  L  L    LS+C      V + Y L+  S K        I L++T P       +E
Sbjct: 4   LAVCLLGLSAVILSACSPVRISVKDQYQLSAFSAKQLAKKPMPITLLVTAPDAAGGYQTE 63

Query: 72  DIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISA 131
            ++    P E++    + W +    M+   ++ + +       V      + ADY++ S 
Sbjct: 64  QMLYIKRPYELEAFAKNAWVNPPADMLYPLILQSLQKTNLFEAVTSNAYALGADYRLDSQ 123

Query: 132 IRSFEINIDRHCAIITMSLKII--NAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFS 189
           +     N  +  ++I  S+KI+  +  DN ++G ++ ++      D     + + N+A  
Sbjct: 124 LLYLNQNFLKKPSVIEFSVKIVLTHVSDNKILGSRIINLSVPCPSDTPYGGVIAANKATQ 183

Query: 190 RISSEIIDWTLS 201
             ++E+  + +S
Sbjct: 184 IFTAELAHFVVS 195


>gi|163850327|ref|YP_001638370.1| hypothetical protein Mext_0894 [Methylobacterium extorquens PA1]
 gi|163661932|gb|ABY29299.1| protein of unknown function DUF330 [Methylobacterium extorquens
           PA1]
          Length = 207

 Score =  139 bits (351), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 43/164 (26%), Positives = 91/164 (55%)

Query: 39  YDLTESTKYDESVQRHIQLIITEPITEKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMI 98
           +DL        +      ++++EP+  + + ++ IIVR     + +L G QW+D+LPR+I
Sbjct: 43  FDLAALPGQARAGGAARSIVVSEPVGLQPMEADRIIVREPGGSLSFLGGGQWADRLPRLI 102

Query: 99  QLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFEINIDRHCAIITMSLKIINAHDN 158
           Q ++I + EN G++ +V +P+  + +DYQ++S IR F++N     A++ +S K+I     
Sbjct: 103 QTRVIQSLENTGRLRSVSRPSDKVPSDYQLVSEIREFDVNSGTGEAVVDLSAKLIAEGTG 162

Query: 159 SLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEIIDWTLSS 202
            +V  +VF     ++K +       L+ A  ++ ++++ W  ++
Sbjct: 163 RVVNARVFTARVPVKKVDPQSAAAGLDAALGQVLADLVRWVNTA 206


>gi|188580088|ref|YP_001923533.1| hypothetical protein Mpop_0820 [Methylobacterium populi BJ001]
 gi|179343586|gb|ACB78998.1| protein of unknown function DUF330 [Methylobacterium populi BJ001]
          Length = 207

 Score =  139 bits (350), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 47/196 (23%), Positives = 99/196 (50%), Gaps = 1/196 (0%)

Query: 6   NKIIKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIITEPITE 65
            +++  + +     +     L  C     P+  +DL        +      ++++EP+  
Sbjct: 11  GRLLSGRFLRAGALLAPLALLGGCGGGATPL-TFDLAALPGQARAGGAARSIVVSEPVGL 69

Query: 66  KILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYAD 125
           + + ++ IIVR     + +L G QW+D+LPR+IQ ++I + EN G++ +V +P   + +D
Sbjct: 70  QPMEADRIIVREPGGSLSFLGGGQWADRLPRLIQTRVIQSLENTGRLRSVSRPTDKVPSD 129

Query: 126 YQIISAIRSFEINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLN 185
           YQ++S IR F+IN     A++ +S K+I      +V  +VF     ++K +       L+
Sbjct: 130 YQLVSEIREFDINSGTGEAVVDLSAKLIAEGSGRVVNARVFTARVPVQKVDPQSAAAGLD 189

Query: 186 RAFSRISSEIIDWTLS 201
            A  ++ ++++ W  +
Sbjct: 190 AALGQVLADLVRWVNT 205


>gi|218528884|ref|YP_002419700.1| hypothetical protein Mchl_0854 [Methylobacterium chloromethanicum
           CM4]
 gi|240137398|ref|YP_002961869.1| putative uncharacterized ABC-transporter auxiliary component
           [Methylobacterium extorquens AM1]
 gi|218521187|gb|ACK81772.1| protein of unknown function DUF330 [Methylobacterium
           chloromethanicum CM4]
 gi|240007366|gb|ACS38592.1| putative uncharacterized ABC-transporter auxiliary component
           [Methylobacterium extorquens AM1]
          Length = 207

 Score =  138 bits (349), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 43/164 (26%), Positives = 91/164 (55%)

Query: 39  YDLTESTKYDESVQRHIQLIITEPITEKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMI 98
           +DL        +      ++++EP+  + + ++ IIVR     + +L G QW+D+LPR+I
Sbjct: 43  FDLAALPGQARAGGAARSIVVSEPVGLQPMEADRIIVREPGGSLSFLGGGQWADRLPRLI 102

Query: 99  QLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFEINIDRHCAIITMSLKIINAHDN 158
           Q ++I + EN G++ +V +P+  + +DYQ++S IR F++N     A++ +S K+I     
Sbjct: 103 QTRVIQSLENTGRLRSVSRPSDKVPSDYQLVSEIREFDVNSGTGEAVVDLSAKLIAEGTG 162

Query: 159 SLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEIIDWTLSS 202
            +V  +VF     ++K +       L+ A  ++ ++++ W  ++
Sbjct: 163 RVVNARVFTARVPVKKVDPQSAAAGLDAALGQVLADLVRWVNTA 206


>gi|254559578|ref|YP_003066673.1| ABC transporter auxiliary protein [Methylobacterium extorquens DM4]
 gi|254266856|emb|CAX22655.1| putative uncharacterized ABC-transporter auxiliary component
           [Methylobacterium extorquens DM4]
          Length = 207

 Score =  138 bits (348), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 43/164 (26%), Positives = 91/164 (55%)

Query: 39  YDLTESTKYDESVQRHIQLIITEPITEKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMI 98
           +DL        +      ++++EP+  + + ++ IIVR     + +L G QW+D+LPR+I
Sbjct: 43  FDLAALPGQARAGGAARSIVVSEPVGLQPMEADRIIVREPGGSLSFLGGGQWADRLPRLI 102

Query: 99  QLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFEINIDRHCAIITMSLKIINAHDN 158
           Q ++I + EN G++ +V +P+  + +DYQ++S IR F++N     A++ +S K+I     
Sbjct: 103 QTRVIQSLENTGRLRSVSRPSDKVPSDYQLVSEIREFDVNSGTGEAVVDLSAKLIGEGTG 162

Query: 159 SLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEIIDWTLSS 202
            +V  +VF     ++K +       L+ A  ++ ++++ W  ++
Sbjct: 163 RVVNARVFTARVPVKKVDPQSAAAGLDAALGQVLADLVRWVNTA 206


>gi|121998621|ref|YP_001003408.1| putative ABC transporter [Halorhodospira halophila SL1]
 gi|121590026|gb|ABM62606.1| putative ABC-type uncharacterized transport system [Halorhodospira
           halophila SL1]
          Length = 208

 Score =  138 bits (348), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 34/183 (18%), Positives = 74/183 (40%), Gaps = 5/183 (2%)

Query: 25  SLSSCFFHNNPVNIYDLTESTKYDESV---QRHIQLIITEPITEKILNSEDIIVRSSPIE 81
           S  +          Y L        +         L +T P +  +L    I V +    
Sbjct: 22  SACTLLPEAETYTAYQLPPPEGDAPAADTEPVDWTLRVTTPSSSDLLAGNRIAVATGEHR 81

Query: 82  IQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFEINI-- 139
           +    G++W   LPR+ Q  LI  F  +G+I  +    + + AD ++ + +R+F+I    
Sbjct: 82  MSTFAGARWVSPLPRLWQEHLIETFYADGRIHRLSADGERLSADLELRTTLRAFQIETRD 141

Query: 140 DRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEIIDWT 199
           +   A + +  ++++     +V  + F     +  D+    + +L  A   +  E++ WT
Sbjct: 142 EGPRARVVVDARLVDVGQRRIVATERFAATRDVASDDTDAAVAALGAANRSVGRELVAWT 201

Query: 200 LSS 202
           +++
Sbjct: 202 VTA 204


>gi|82702736|ref|YP_412302.1| hypothetical protein Nmul_A1609 [Nitrosospira multiformis ATCC
           25196]
 gi|82410801|gb|ABB74910.1| conserved hypothetical protein [Nitrosospira multiformis ATCC
           25196]
          Length = 220

 Score =  138 bits (347), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 38/189 (20%), Positives = 75/189 (39%), Gaps = 5/189 (2%)

Query: 19  AVLLCTSLSSCFFHNNPVNIYDLTESTKYDE--SVQRHIQLIITEPITEKILNSEDIIVR 76
           A+LL  S  S       + IY L  +              L +  P +  I +S  ++  
Sbjct: 22  AMLLLVSSCSILPATENLEIYQLPAAEFAPRSSGSPLPWTLRLATPHSNYITDSPRVLAL 81

Query: 77  SSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQII-SAIRSF 135
               ++    G +WSD +P +++ +L   F  +G+ ++++  N         +   + +F
Sbjct: 82  RQGSQLSSYKGIRWSDPVPVLLRNRLAGAFRADGRFNSIINGNNNNLIANLELGGDLSAF 141

Query: 136 EINI--DRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISS 193
           ++    D   A I     +     N +V  + F V E ++       I +   A  R ++
Sbjct: 142 QVEYTNDGPQATIYFYATLSQPLRNRIVAVRRFEVGEPVQSRGTSGIITAFGVAADRFAA 201

Query: 194 EIIDWTLSS 202
           EI+DWT+  
Sbjct: 202 EIVDWTVQQ 210


>gi|115523757|ref|YP_780668.1| hypothetical protein RPE_1739 [Rhodopseudomonas palustris BisA53]
 gi|115517704|gb|ABJ05688.1| Mammalian cell entry related domain protein [Rhodopseudomonas
           palustris BisA53]
          Length = 384

 Score =  136 bits (343), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 54/203 (26%), Positives = 96/203 (47%), Gaps = 2/203 (0%)

Query: 3   KKLNKIIKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIITEP 62
           +   + + +        V     ++          IYDL   T +        QL I EP
Sbjct: 168 RVFAESLARNSGKLDGIVAGIERMTGADKPVVNKVIYDLATPTDFTPGKPIRGQLAIAEP 227

Query: 63  ITEKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGI 122
               +L+++ I+     ++   L G QWSD +P+M+Q KLI +FEN       +K N  +
Sbjct: 228 SAVVMLDTQRILTAP-GLDFPQLAGVQWSDSIPKMLQAKLIQSFENYDIAHAPIKANDMV 286

Query: 123 YADYQIISAIRSFEINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQ 182
            AD+Q+   +  FEI  D   A I ++ K+++  D  ++  K+F V   L+K   L  + 
Sbjct: 287 SADHQLAIDLHGFEIAGDPPQAAIALAAKLLD-KDGKVMTAKLFRVNRPLDKVEPLAALA 345

Query: 183 SLNRAFSRISSEIIDWTLSSLPL 205
           + N AFS ++ +++ WT+++L  
Sbjct: 346 AFNAAFSELAKDLVGWTVAALDA 368


>gi|302353422|gb|ADL27917.1| putative ABC transporter protein [Candidatus Liberibacter
           asiaticus]
          Length = 112

 Score =  134 bits (337), Expect = 8e-30,   Method: Composition-based stats.
 Identities = 112/112 (100%), Positives = 112/112 (100%)

Query: 97  MIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFEINIDRHCAIITMSLKIINAH 156
           MIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFEINIDRHCAIITMSLKIINAH
Sbjct: 1   MIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFEINIDRHCAIITMSLKIINAH 60

Query: 157 DNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEIIDWTLSSLPLSDN 208
           DNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEIIDWTLSSLPLSDN
Sbjct: 61  DNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEIIDWTLSSLPLSDN 112


>gi|27381174|ref|NP_772703.1| ABC transporter substrate-binding protein [Bradyrhizobium japonicum
           USDA 110]
 gi|30179810|sp|P29285|Y6063_BRAJA RecName: Full=Uncharacterized protein bll6063
 gi|27354341|dbj|BAC51328.1| ABC transporter substrate-binding protein [Bradyrhizobium japonicum
           USDA 110]
          Length = 367

 Score =  133 bits (334), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 43/203 (21%), Positives = 86/203 (42%), Gaps = 5/203 (2%)

Query: 3   KKLNKIIKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKY-DESVQRHIQLIITE 61
           K  +  + +        +     ++        +  YDL         +      L I E
Sbjct: 168 KTFSDGLARNTGKLDGILAGLEKMTGGGAPAQKI-TYDLRTPQNLGPAAKTLSASLAIPE 226

Query: 62  PITEKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQG 121
           P    +L ++ ++               W+D +P+++Q +LI +FEN       ++ +  
Sbjct: 227 PTAVAMLQTQRMLFAPVGDN-PGFADFLWADSIPKLVQARLIDSFENYDIAHAPLRTSDL 285

Query: 122 IYADYQIISAIRSFEINIDRHC-AIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHF 180
             ADYQ++  IR F I  D      I +S +I++  +  +V  ++    EKL+K      
Sbjct: 286 GQADYQLLIDIRRFRIATDGETRVEIGLSARIVD-KNGKVVASRLVETSEKLDKVEPAAA 344

Query: 181 IQSLNRAFSRISSEIIDWTLSSL 203
           + + + AF+RI+ E+I WT+ ++
Sbjct: 345 VAAFDAAFARIAKELIGWTVLAV 367


>gi|152086|gb|AAA26208.1| ORF 180 [Bradyrhizobium japonicum]
          Length = 180

 Score =  131 bits (329), Expect = 7e-29,   Method: Composition-based stats.
 Identities = 42/168 (25%), Positives = 78/168 (46%), Gaps = 4/168 (2%)

Query: 38  IYDLTESTKY-DESVQRHIQLIITEPITEKILNSEDIIVRSSPIEIQYLIGSQWSDKLPR 96
            YDL         +      L I EP    +L ++ ++               W+D +P+
Sbjct: 15  TYDLRTPQNLGPAAKTLSASLAIPEPTAVAMLQTQRMLFAPVGDN-PGFADFLWADSIPK 73

Query: 97  MIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFEINIDRHC-AIITMSLKIINA 155
           ++Q +LI +FEN       ++ +    ADYQ++  IR F I  D      I +S +I++ 
Sbjct: 74  LVQARLIDSFENYDIAHAPLRTSDLGQADYQLLIDIRRFRIATDGETRVEIGLSARIVD- 132

Query: 156 HDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEIIDWTLSSL 203
            +  +V  ++    EKL+K      + + + AF+RI+ E+I WT+ ++
Sbjct: 133 KNGKVVASRLVETSEKLDKVEPAAAVAAFDAAFARIAKELIGWTVLAV 180


>gi|83858855|ref|ZP_00952377.1| hypothetical protein OA2633_05111 [Oceanicaulis alexandrii
           HTCC2633]
 gi|83853678|gb|EAP91530.1| hypothetical protein OA2633_05111 [Oceanicaulis alexandrii
           HTCC2633]
          Length = 211

 Score =  128 bits (323), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 30/191 (15%), Positives = 80/191 (41%), Gaps = 7/191 (3%)

Query: 16  CSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQ-LIITEPITEKILNSEDII 74
            +++++      S    + PV++Y L      +++   + Q L+I      + L  + + 
Sbjct: 13  AAISLVATPGCISLLPESEPVSLYRLNALVDEEQAPSANAQTLVIERITAPRGLAVDRVA 72

Query: 75  VRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRS 134
           +     E+ Y+ G+ W    P M+Q +++   ++        +   G+ A Y++   +R 
Sbjct: 73  LLREG-ELAYMAGAAWLSPAPVMVQDRILDVLQSETPELIPARTEDGVDARYRLQIELRR 131

Query: 135 FEINIDRHCAI-----ITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFS 189
           FE   D+  +      + +  ++I+  + +L   + F V  +   + +   I + + A +
Sbjct: 132 FEAEYDQGPSRAPVIQMRVMARLIDREERTLAAARRFDVSVRASDNRQSALIAAFSEATN 191

Query: 190 RISSEIIDWTL 200
             +  +  W+ 
Sbjct: 192 DTARSLAQWSA 202


>gi|323136831|ref|ZP_08071912.1| protein of unknown function DUF330 [Methylocystis sp. ATCC 49242]
 gi|322398148|gb|EFY00669.1| protein of unknown function DUF330 [Methylocystis sp. ATCC 49242]
          Length = 213

 Score =  126 bits (316), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 36/170 (21%), Positives = 75/170 (44%), Gaps = 6/170 (3%)

Query: 32  HNNPVNIYDLTESTKYDESVQRHI--QLIITEPITEKILNSEDIIVRSSPIEIQYLIGSQ 89
              P   +DL  +     +        LI+ EP   +   S+ ++VR     +  L G Q
Sbjct: 44  AQPPRQTFDLAGAVSAARAAPLRSGPALIVREPAAVQPTGSDRVVVRDVDGSVSVLPGVQ 103

Query: 90  WSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFEINIDRHCAIITMS 149
           WS++LPR+ Q +LI   +  G  +  +     + A   + + IR FEI++ R  A++ + 
Sbjct: 104 WSERLPRLFQNRLIEAMQRAGVPAGQIS----LGATAALATDIRRFEIDVARSIAVVEIE 159

Query: 150 LKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEIIDWT 199
            ++++  + +    ++F  E    +      + +L  A + +++ I  W 
Sbjct: 160 ARLVSESNGATRAAQLFTAEAPAPEHTGAPAVHALGEASATVAARIAVWA 209


>gi|295690465|ref|YP_003594158.1| hypothetical protein Cseg_3100 [Caulobacter segnis ATCC 21756]
 gi|295432368|gb|ADG11540.1| protein of unknown function DUF330 [Caulobacter segnis ATCC 21756]
          Length = 211

 Score =  122 bits (307), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 40/207 (19%), Positives = 86/207 (41%), Gaps = 9/207 (4%)

Query: 11  KKIISCSLAVLLCTSLSSC---FFHNNPVNIYDLTEST-KYDESVQRHIQLIITEPITEK 66
           + I   +    L   LS+C   F    PV +Y   E+     +     +  ++  P T  
Sbjct: 5   RSIARLTAVAALAIGLSACISVFPKTKPVGLYRFGEAEISATKGPPGAMFGVLKSPSTFT 64

Query: 67  ILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADY 126
              + D I+ S+  ++ Y+  ++W      + +  +   FEN+   + ++   +   AD 
Sbjct: 65  RAAASDRILTSNQGQVAYIADARWVSPAFVLFEEAVARAFENDPGRARLIGRGEVAKADL 124

Query: 127 QIISAIRSFEINI-DRHCAIITMSLK----IINAHDNSLVGQKVFHVEEKLEKDNKLHFI 181
            +   +R+FE +  D   A   + ++    +    D  LVG +VF    K   +     +
Sbjct: 125 VLRLEVRTFETDYVDGPKAAPEVVVRVRGVLNRNSDRVLVGDQVFEARVKAADNRVSAIV 184

Query: 182 QSLNRAFSRISSEIIDWTLSSLPLSDN 208
            + ++A +++  E++ WT ++ P   N
Sbjct: 185 PAYDKAVAQVLGEVVAWTNAAGPAIAN 211


>gi|46579023|ref|YP_009831.1| putative lipoprotein [Desulfovibrio vulgaris str. Hildenborough]
 gi|120603388|ref|YP_967788.1| lipoprotein [Desulfovibrio vulgaris DP4]
 gi|46448436|gb|AAS95090.1| lipoprotein, putative [Desulfovibrio vulgaris str. Hildenborough]
 gi|120563617|gb|ABM29361.1| lipoprotein, putative [Desulfovibrio vulgaris DP4]
 gi|311232873|gb|ADP85727.1| protein of unknown function DUF330 [Desulfovibrio vulgaris RCH1]
          Length = 211

 Score =  120 bits (301), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 35/198 (17%), Positives = 73/198 (36%), Gaps = 9/198 (4%)

Query: 10  KKKIISCSLAVLLCTSLSSCF----FHNNPVNIYDLT--ESTKYDESVQRHIQLIITEPI 63
              + +  L      S + C         P  I        T         +QL ++ P 
Sbjct: 7   FTTLCAILLLAASTISGAGCARVLDPGPAPQRILLSPDMPRTDATPRPAAPVQLAVSLPE 66

Query: 64  TEKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIY 123
           T + L+++ I +     E+ YL   +W   +P+M+Q  +I   +   +I TV   + G++
Sbjct: 67  TTRSLDTDHIAIL-QGRELSYLPNVRWGSHVPQMLQRHIIDALDAGTRIGTVSAESAGVF 125

Query: 124 ADYQIISAIRSFEINID--RHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFI 181
            D +++  I+ F    +       I + L++++     ++  +       L  D +   +
Sbjct: 126 PDVRLMVDIQQFAARTEARETGVDIRLRLQMLDVRKGRIIASQNVEAYVPLADDRRATLL 185

Query: 182 QSLNRAFSRISSEIIDWT 199
                A S I  +   W 
Sbjct: 186 DGFEAALSGILEKTARWV 203


>gi|160871905|ref|ZP_02062037.1| conserved hypothetical protein [Rickettsiella grylli]
 gi|159120704|gb|EDP46042.1| conserved hypothetical protein [Rickettsiella grylli]
          Length = 218

 Score =  118 bits (296), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 37/197 (18%), Positives = 74/197 (37%), Gaps = 5/197 (2%)

Query: 12  KIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHI---QLIITEPITEKIL 68
            II C LA LL ++ S       P   Y        +           +++ +P    + 
Sbjct: 18  AIIVCFLAFLLLSACSLFEPIKIPPTHYFTLAIPDPNGDCPIQRGCRTILVNQPRVNAVY 77

Query: 69  NSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQI 128
           N+  +I   +  +IQY   ++W      M+   LI   ++ G    ++        D+ +
Sbjct: 78  NTSRMIYIPACYQIQYFSQNRWVGTPAEMLHPLLINALQHTGYFQAIINTPSTTDYDWVL 137

Query: 129 ISAIRSFEIN--IDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNR 186
            + + SF+           I +  ++I+A    ++  + F   E    D+      + N 
Sbjct: 138 NTQLLSFQQEFIYFPSRFRIAIRAQLIDARSRHILATQDFVAVEIAPHDDPYGGTLAANS 197

Query: 187 AFSRISSEIIDWTLSSL 203
           A  +I +EI  + L +L
Sbjct: 198 AIQKILNEINCFCLKNL 214


>gi|16126560|ref|NP_421124.1| hypothetical protein CC_2321 [Caulobacter crescentus CB15]
 gi|221235342|ref|YP_002517779.1| membrane lipoprotein [Caulobacter crescentus NA1000]
 gi|13423844|gb|AAK24292.1| hypothetical protein CC_2321 [Caulobacter crescentus CB15]
 gi|220964515|gb|ACL95871.1| membrane lipoprotein [Caulobacter crescentus NA1000]
          Length = 216

 Score =  115 bits (289), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 33/214 (15%), Positives = 88/214 (41%), Gaps = 9/214 (4%)

Query: 4   KLNKIIKKKIISCSLAVLLCTSLSSC---FFHNNPVNIYDL-TESTKYDESVQRHIQLII 59
            +N+   +++     A  L  SLS+C   F  + P  +Y          +  +  +  ++
Sbjct: 3   PMNRKAPRRVAKVVAATALALSLSACISVFPESEPATLYRFGQADVGVPKGPKGAVFSVL 62

Query: 60  TEPITEKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPN 119
             P T    ++ D ++ S+  E+ Y+  ++W      + +  + + F+ +   + ++   
Sbjct: 63  KAPTTFTRASAGDRLLTSTRGEVAYIADARWVSPAFVLFEEAVASAFQTDQGRARLIGRG 122

Query: 120 QGIYADYQIISAIRSFEINI-----DRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEK 174
           +   AD  +   +++FE             ++ +   +    D +LV  +VF    K + 
Sbjct: 123 EIAKADLVLRLEVQTFEAQYVNGPKSAPEVVVRVRGVLNRNQDRTLVSDQVFEARVKADD 182

Query: 175 DNKLHFIQSLNRAFSRISSEIIDWTLSSLPLSDN 208
           +     + + ++A +++  E++ W  ++ P   N
Sbjct: 183 NRVSAIVPAYDQAVAQVLGEVVTWVNATGPAIQN 216


>gi|126666398|ref|ZP_01737377.1| lipoprotein, putative [Marinobacter sp. ELB17]
 gi|126629199|gb|EAZ99817.1| lipoprotein, putative [Marinobacter sp. ELB17]
          Length = 214

 Score =  115 bits (287), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 34/203 (16%), Positives = 77/203 (37%), Gaps = 5/203 (2%)

Query: 10  KKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKY--DESVQRHIQLIITEPITEKI 67
            K  +  +L  L+ T   + F       + D   +         Q+   L +  P+  + 
Sbjct: 5   SKNFVPATLCALVMTG-CTIFPVPETPRVMDFAPAPLTLGRAGDQQPYSLRVDTPVASEP 63

Query: 68  LNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQ 127
           +NS  I+ +    E +   G +W D  P +++  + A    +     V+       AD  
Sbjct: 64  INSTRILAKPEATEFRIYGGVRWRDTAPVIMRDAITAALRRSQGFERVITDVSPAEADLT 123

Query: 128 IISAIRSFEINIDRHCA--IITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLN 185
           +++ + +F+     + +  +I +  +I+          +VF ++     +     I + +
Sbjct: 124 MVTELLAFQSQPGANHSDVVIRLYSEIMENRSRRTACSQVFDIKTSAASNRLDDVIIAFD 183

Query: 186 RAFSRISSEIIDWTLSSLPLSDN 208
            A  R+ SE+  W  +   LS +
Sbjct: 184 GAGQRMVSELALWASACEGLSAD 206


>gi|304319770|ref|YP_003853413.1| lipoprotein, hypothetical [Parvularcula bermudensis HTCC2503]
 gi|303298673|gb|ADM08272.1| lipoprotein, hypothetical [Parvularcula bermudensis HTCC2503]
          Length = 215

 Score =  115 bits (287), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 37/155 (23%), Positives = 86/155 (55%), Gaps = 4/155 (2%)

Query: 49  ESVQRHIQLIITEPITEKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFEN 108
            S      L+I +P  E +LN+ ++ V+++P + +YL GS+W+D++P + +  L   FEN
Sbjct: 47  TSRPIDATLVIADPDAEAVLNTFNVAVKTAPYQFEYLDGSEWTDRVPVLFRTYLERRFEN 106

Query: 109 NGKISTVV-KPNQGIYADYQIISAIRSFEIN--IDRHCAIITMSLKIINAHDNSLVGQKV 165
            G ++ V  + +  + AD+++ + +R+F ++  +    A ++   ++++A   + +G ++
Sbjct: 107 VGALTAVGDRSDLPVGADFELKTDLRAFYLDRTVSPEAARLSFGARLVDAQGGT-LGTRI 165

Query: 166 FHVEEKLEKDNKLHFIQSLNRAFSRISSEIIDWTL 200
                 +E   +   +++LNR     S ++I W+L
Sbjct: 166 IDRTIPIEGRGREGAVEALNRVAIDASDDVISWSL 200


>gi|120554121|ref|YP_958472.1| ABC-type uncharacterized transport system auxiliary component-like
           [Marinobacter aquaeolei VT8]
 gi|120323970|gb|ABM18285.1| ABC-type uncharacterized transport system auxiliary component-like
           protein [Marinobacter aquaeolei VT8]
          Length = 202

 Score =  110 bits (274), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 26/193 (13%), Positives = 74/193 (38%), Gaps = 3/193 (1%)

Query: 14  ISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDE-SVQRHIQLIITEPITEKILNSED 72
           +  +LA+ L  +  + F       + +L  ++            L +  P+    L+S  
Sbjct: 3   VLSALALGLVLAGCTVFPVPESPRLMELAPASDLPAFDQALPASLRVDTPLASDPLDSAR 62

Query: 73  IIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAI 132
           I+++ S  E + L G++W + +P +++  L+  F  +G  + V+       +   ++S +
Sbjct: 63  ILIKPSAYEYRALAGARWRESIPVVVRDHLLETFRASGAFANVMTDTSPATSQLTLVSEL 122

Query: 133 RSFEINID--RHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSR 190
             F           +I +  ++++      +  + +      +       +++ + A + 
Sbjct: 123 TGFHAENGETGTRVVIRLHQQLMDNRTRRSLCVRSYEASANAQSTALGELMEAFSNASAH 182

Query: 191 ISSEIIDWTLSSL 203
            S   + W    +
Sbjct: 183 SSVTTVTWAHQCM 195


>gi|218516886|ref|ZP_03513726.1| putative ABC transporter protein [Rhizobium etli 8C-3]
          Length = 96

 Score =  110 bits (274), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 42/97 (43%), Positives = 63/97 (64%), Gaps = 2/97 (2%)

Query: 108 NNGKISTVVKPNQGIYADYQIISAIRSFEINID-RHCAIITMSLKIINAHDNSLVGQKVF 166
           N+GK+  V  P QG+  DYQ+++ IRSFEI+    + A++ +S+KI+N  + S+  QKVF
Sbjct: 1   NSGKLGGVGLPGQGLAIDYQVVTDIRSFEIDASSGNQAVVEISVKILNDRNGSVRAQKVF 60

Query: 167 HVEEKLEKDNKLHFIQSLNRAFSRISSEIIDWTLSSL 203
                   DN   F++SL+RAFS + SEI+ WTL S+
Sbjct: 61  RATAPAGGDN-AGFVKSLDRAFSTVVSEIVSWTLRSI 96


>gi|57168791|ref|ZP_00367922.1| probable lipoprotein Cj1649 [Campylobacter coli RM2228]
 gi|305432467|ref|ZP_07401629.1| probable lipoprotein [Campylobacter coli JV20]
 gi|57019838|gb|EAL56521.1| probable lipoprotein Cj1649 [Campylobacter coli RM2228]
 gi|304444506|gb|EFM37157.1| probable lipoprotein [Campylobacter coli JV20]
          Length = 200

 Score =  106 bits (265), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 34/138 (24%), Positives = 70/138 (50%), Gaps = 3/138 (2%)

Query: 68  LNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQ 127
           L+S  II     I   Y     W+D    + Q  L++ FE +     ++     + +DY 
Sbjct: 61  LHSRSIIYVQKGISKAY-AYHFWADLPNNLYQSLLLSKFEQSQIFKALLSQGSSVGSDYI 119

Query: 128 IISAIRSFEINIDRHC--AIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLN 185
           + S I SFE  +D +     I++S+  I+A ++ ++  ++F ++E+++K +     QS  
Sbjct: 120 LESRIDSFEQVVDENENYVSISISINFIDAKESKIIAHRLFSIKERVKKIDIFDVYQSFE 179

Query: 186 RAFSRISSEIIDWTLSSL 203
           +A + + +EI+ W  ++L
Sbjct: 180 KALNSLGNEIVLWINATL 197


>gi|197120795|ref|YP_002132746.1| ABC transporter [Anaeromyxobacter sp. K]
 gi|196170644|gb|ACG71617.1| ABC-type uncharacterized transport system auxiliary component-like
           protein [Anaeromyxobacter sp. K]
          Length = 220

 Score =  105 bits (261), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 28/170 (16%), Positives = 62/170 (36%), Gaps = 2/170 (1%)

Query: 30  FFHNNPVNIYDLTESTKYDESVQRHIQLIITEPITEKILNSEDIIVRSSPIEIQYLIGSQ 89
           F  + P   + L    +          L++  P      +   I       E+Q+   S+
Sbjct: 25  FGPSTPPTRFALQADFEGQPIAGPGPALVVAVPTAAAGFDGPRIAYVRRAHELQFFARSE 84

Query: 90  WSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFEINIDRHCAIITMS 149
           W D   RM+   L+   E +G    V        A  ++ S +   +       + + ++
Sbjct: 85  WVDAPARMLAPLLVQALERSGGFQAVAGARTPAAAGLRLESELVRLQQEFTVRPSRVRLT 144

Query: 150 LK--IINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEIID 197
           L+  + +     ++G +     E+   D+    +++ NRA  R+  E++ 
Sbjct: 145 LRVQLSDVASRRVLGTRELEAVEEARSDDPYGGVEAANRAVRRLLDEVVA 194


>gi|119945389|ref|YP_943069.1| ABC-type uncharacterized transport system auxiliary component-like
           protein [Psychromonas ingrahamii 37]
 gi|119863993|gb|ABM03470.1| ABC-type uncharacterized transport system auxiliary component-like
           protein [Psychromonas ingrahamii 37]
          Length = 200

 Score =  101 bits (252), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 37/192 (19%), Positives = 76/192 (39%), Gaps = 12/192 (6%)

Query: 18  LAVLLCTSLSSCFFHN-NPVNIYDLTES------TKYDESVQRHIQLIITEPITEKILNS 70
           L  LL   ++ C      PV+ Y L  +       K  E     I L++    +  + N+
Sbjct: 8   LLALLLIGITGCAGKKLPPVSTYTLYPALDTFYLPKSQEGKPAGI-LMLGRMGSSHVFNA 66

Query: 71  EDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIIS 130
            +II             S+WSD    M++L      E +G+   VV  +    +D+ + S
Sbjct: 67  REIIYSDQRYGQSSYAYSRWSDSPTIMLRLIFQEALEKSGRYIAVVPYSSQSKSDFLLES 126

Query: 131 AIRSFEINI---DRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLH-FIQSLNR 186
            +  F   +        +I +   +I+ + + ++  + F     +         + +LN+
Sbjct: 127 TLLDFSHRVNDDGTSDGLIKIHFNLIDNNTSRVIKSRNFVSSLPVAPPINAGNAVAALNK 186

Query: 187 AFSRISSEIIDW 198
           A + ++ E++DW
Sbjct: 187 AATIVTKELVDW 198


>gi|153951354|ref|YP_001398926.1| putative lipoprotein [Campylobacter jejuni subsp. doylei 269.97]
 gi|152938800|gb|ABS43541.1| putative lipoprotein [Campylobacter jejuni subsp. doylei 269.97]
          Length = 199

 Score =  101 bits (252), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 41/150 (27%), Positives = 73/150 (48%), Gaps = 3/150 (2%)

Query: 57  LIITEPITEKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVV 116
           L I        LNS  II   +    +Y     W D    +    +++ FE +   +T++
Sbjct: 51  LKIRNANAPLYLNSRAIIYIDNGFSNKYAHYF-WGDLPSNLYSSLILSKFEQSNIFTTLL 109

Query: 117 KPNQGIYADYQIISAIRSFEI--NIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEK 174
                + ADY + S I SFE   N + + A I++S+  IN  +N ++  K+F+ +EK+EK
Sbjct: 110 SSTSSLNADYALESRINSFEQILNNNENYAQISISVNFINLENNQIIAHKIFNTKEKIEK 169

Query: 175 DNKLHFIQSLNRAFSRISSEIIDWTLSSLP 204
            +      +  +A ++I +EI+ W  S+L 
Sbjct: 170 KDIRSTYNAFQKALNKIGNEIVFWVNSNLS 199


>gi|148925788|ref|ZP_01809476.1| putative lipoprotein [Campylobacter jejuni subsp. jejuni CG8486]
 gi|145845798|gb|EDK22889.1| putative lipoprotein [Campylobacter jejuni subsp. jejuni CG8486]
          Length = 199

 Score =  100 bits (250), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 40/150 (26%), Positives = 73/150 (48%), Gaps = 3/150 (2%)

Query: 57  LIITEPITEKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVV 116
           L I        LNS  I+   +    +Y     W D    +    +++ FE +   +T++
Sbjct: 51  LKIRNANAPLYLNSRAIVYIDNGFSNKYAHYF-WGDLPSNLYSFLILSKFEQSNIFTTLL 109

Query: 117 KPNQGIYADYQIISAIRSFEI--NIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEK 174
                + ADY + S I SFE   N + + A I++S+  IN  +N ++  K+F+ +EK+EK
Sbjct: 110 SSTSSLSADYALESRINSFEQILNNNENYAQISVSVNFINLENNQIIAHKIFNTKEKIEK 169

Query: 175 DNKLHFIQSLNRAFSRISSEIIDWTLSSLP 204
            +      +  +A ++I +EI+ W  S+L 
Sbjct: 170 KDIRSIYNAFQKALNKIGNEIVFWVNSNLS 199


>gi|86152317|ref|ZP_01070528.1| lipoprotein, putative [Campylobacter jejuni subsp. jejuni 260.94]
 gi|121613719|ref|YP_001001292.1| putative lipoprotein [Campylobacter jejuni subsp. jejuni 81-176]
 gi|167006186|ref|ZP_02271944.1| lipoprotein, putative [Campylobacter jejuni subsp. jejuni 81-176]
 gi|315125048|ref|YP_004067052.1| lipoprotein, putative [Campylobacter jejuni subsp. jejuni
           ICDCCJ07001]
 gi|85840806|gb|EAQ58057.1| lipoprotein, putative [Campylobacter jejuni subsp. jejuni 260.94]
 gi|87249863|gb|EAQ72822.1| lipoprotein, putative [Campylobacter jejuni subsp. jejuni 81-176]
 gi|315018770|gb|ADT66863.1| lipoprotein, putative [Campylobacter jejuni subsp. jejuni
           ICDCCJ07001]
          Length = 199

 Score =  100 bits (249), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 40/150 (26%), Positives = 73/150 (48%), Gaps = 3/150 (2%)

Query: 57  LIITEPITEKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVV 116
           L I        LNS  I+   +    +Y     W D    +    +++ FE +   +T++
Sbjct: 51  LKIRNANAPLYLNSRAIVYIDNGFSNKYAHYF-WGDLPSNLYSFLILSKFEQSNIFTTLL 109

Query: 117 KPNQGIYADYQIISAIRSFEI--NIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEK 174
                + ADY + S I SFE   N + + A I++S+  IN  +N ++  K+F+ +EK+EK
Sbjct: 110 SSTSSLNADYALESRINSFEQILNNNENYAQISISVNFINLENNQIIAHKIFNTKEKIEK 169

Query: 175 DNKLHFIQSLNRAFSRISSEIIDWTLSSLP 204
            +      +  +A ++I +EI+ W  S+L 
Sbjct: 170 KDIRSTYNAFQKALNKIGNEIVFWVNSNLS 199


>gi|315927600|gb|EFV06931.1| conserved hypothetical protein [Campylobacter jejuni subsp. jejuni
           DFVF1099]
          Length = 186

 Score =  100 bits (248), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 40/150 (26%), Positives = 73/150 (48%), Gaps = 3/150 (2%)

Query: 57  LIITEPITEKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVV 116
           L I        LNS  I+   +    +Y     W D    +    +++ FE +   +T++
Sbjct: 38  LKIRNANAPLYLNSRAIVYIDNGFSNKYAHYF-WGDLPSNLYSFLILSKFEQSNIFTTLL 96

Query: 117 KPNQGIYADYQIISAIRSFEI--NIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEK 174
                + ADY + S I SFE   N + + A I++S+  IN  +N ++  K+F+ +EK+EK
Sbjct: 97  SSTSSLSADYSLESRINSFEQILNNNENYAQISISVNFINLENNQIIAHKIFNTKEKIEK 156

Query: 175 DNKLHFIQSLNRAFSRISSEIIDWTLSSLP 204
            +      +  +A ++I +EI+ W  S+L 
Sbjct: 157 KDIRSTYNAFQKALNKIGNEIVFWVNSNLS 186


>gi|86152615|ref|ZP_01070820.1| conserved hypothetical protein [Campylobacter jejuni subsp. jejuni
           HB93-13]
 gi|85843500|gb|EAQ60710.1| conserved hypothetical protein [Campylobacter jejuni subsp. jejuni
           HB93-13]
          Length = 199

 Score =  100 bits (248), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 40/150 (26%), Positives = 73/150 (48%), Gaps = 3/150 (2%)

Query: 57  LIITEPITEKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVV 116
           L I        LNS  I+   +    +Y     W D    +    +++ FE +   +T++
Sbjct: 51  LKIRNANAPLYLNSRAIVYIDNGFSNKYAHYF-WGDLPSNLYSFLILSKFEQSNIFTTLL 109

Query: 117 KPNQGIYADYQIISAIRSFEI--NIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEK 174
                + ADY + S I SFE   N + + A I++S+  IN  +N ++  K+F+ +EK+EK
Sbjct: 110 SSTSSLSADYALESRINSFEQILNNNENYAQISISVNFINLENNQIIAHKIFNTKEKIEK 169

Query: 175 DNKLHFIQSLNRAFSRISSEIIDWTLSSLP 204
            +      +  +A ++I +EI+ W  S+L 
Sbjct: 170 KDIHSTYNAFQKALNKIGNEIVFWVNSNLS 199


>gi|29654064|ref|NP_819756.1| hypothetical protein CBU_0730 [Coxiella burnetii RSA 493]
 gi|153209303|ref|ZP_01947338.1| conserved hypothetical protein [Coxiella burnetii 'MSU Goat Q177']
 gi|154706292|ref|YP_001424139.1| hypothetical protein CBUD_0745 [Coxiella burnetii Dugway 5J108-111]
 gi|161830705|ref|YP_001596958.1| hypothetical protein COXBURSA331_A1220 [Coxiella burnetii RSA 331]
 gi|165924014|ref|ZP_02219846.1| conserved hypothetical protein [Coxiella burnetii RSA 334]
 gi|212219045|ref|YP_002305832.1| hypothetical protein CbuK_1525 [Coxiella burnetii CbuK_Q154]
 gi|29541330|gb|AAO90270.1| hypothetical protein CBU_0730 [Coxiella burnetii RSA 493]
 gi|120575419|gb|EAX32043.1| conserved hypothetical protein [Coxiella burnetii 'MSU Goat Q177']
 gi|154355578|gb|ABS77040.1| hypothetical protein CBUD_0745 [Coxiella burnetii Dugway 5J108-111]
 gi|161762572|gb|ABX78214.1| conserved hypothetical protein [Coxiella burnetii RSA 331]
 gi|165916537|gb|EDR35141.1| conserved hypothetical protein [Coxiella burnetii RSA 334]
 gi|212013307|gb|ACJ20687.1| hypothetical protein CbuK_1525 [Coxiella burnetii CbuK_Q154]
          Length = 199

 Score = 99.7 bits (247), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 26/153 (16%), Positives = 57/153 (37%), Gaps = 2/153 (1%)

Query: 48  DESVQRHIQLIITEPITEKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFE 107
               + H+ ++++ PI      +  +I   +P E+     S+W      M+   L+    
Sbjct: 41  PAHSKTHLTILVSMPIPNPGYQTSAMIYMLTPYELSRYANSRWVAPPSEMLMPLLVQALR 100

Query: 108 NNGKISTVVKPNQGIYADYQIISAIRSFEINIDRHCAIITMS--LKIINAHDNSLVGQKV 165
             G    VV P       Y++ + +   +       + I ++    +I +  N +V    
Sbjct: 101 QTGYFYAVVSPPFVGMTHYRLDTRLLKLQQEFFFPISRIRLTMEASLIKSGTNHVVANHR 160

Query: 166 FHVEEKLEKDNKLHFIQSLNRAFSRISSEIIDW 198
           F V      +N    + + N+A + +S  I  +
Sbjct: 161 FEVLVPALTNNPYGGVLAANKAAAIMSYRIAQF 193


>gi|86149476|ref|ZP_01067707.1| lipoprotein, putative [Campylobacter jejuni subsp. jejuni CF93-6]
 gi|88596065|ref|ZP_01099302.1| lipoprotein, putative [Campylobacter jejuni subsp. jejuni 84-25]
 gi|218563238|ref|YP_002345018.1| putative lipoprotein [Campylobacter jejuni subsp. jejuni NCTC
           11168]
 gi|85840258|gb|EAQ57516.1| lipoprotein, putative [Campylobacter jejuni subsp. jejuni CF93-6]
 gi|88190906|gb|EAQ94878.1| lipoprotein, putative [Campylobacter jejuni subsp. jejuni 84-25]
 gi|112360945|emb|CAL35746.1| putative lipoprotein [Campylobacter jejuni subsp. jejuni NCTC
           11168]
 gi|284926843|gb|ADC29195.1| putative lipoprotein [Campylobacter jejuni subsp. jejuni IA3902]
 gi|315929477|gb|EFV08673.1| conserved hypothetical protein [Campylobacter jejuni subsp. jejuni
           305]
          Length = 199

 Score = 99.7 bits (247), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 40/150 (26%), Positives = 73/150 (48%), Gaps = 3/150 (2%)

Query: 57  LIITEPITEKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVV 116
           L I        LNS  I+   +    +Y     W D    +    +++ FE +   +T++
Sbjct: 51  LKIRNANAPLYLNSRAIVYIDNGFSNKYAHYF-WGDLPSNLYSFLILSKFEQSNIFTTLL 109

Query: 117 KPNQGIYADYQIISAIRSFEI--NIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEK 174
                + ADY + S I SFE   N + + A I++S+  IN  +N ++  K+F+ +EK+EK
Sbjct: 110 SSTSSLSADYSLESRINSFEQILNNNENYAQISISVNFINLENNQIIAHKIFNTKEKIEK 169

Query: 175 DNKLHFIQSLNRAFSRISSEIIDWTLSSLP 204
            +      +  +A ++I +EI+ W  S+L 
Sbjct: 170 KDIRSTYNAFQKALNKIGNEIVFWVNSNLS 199


>gi|313683002|ref|YP_004060740.1| hypothetical protein Sulku_1880 [Sulfuricurvum kujiense DSM 16994]
 gi|313155862|gb|ADR34540.1| hypothetical protein Sulku_1880 [Sulfuricurvum kujiense DSM 16994]
          Length = 199

 Score = 99.7 bits (247), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 32/175 (18%), Positives = 67/175 (38%), Gaps = 4/175 (2%)

Query: 28  SCFFHNNPVNIYDL-TESTKYDESVQ-RHIQLIITEPITEKILNSEDIIVRSSPIEIQYL 85
            C      +N Y L +      +S       L +T   +   L  ++II      +    
Sbjct: 16  GCSASTPTINEYTLFSSQISQPKSPPISSKTLSVTLSKSIGSLLGKNIIYLYENGQTGPY 75

Query: 86  IGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFEINI--DRHC 143
           + S+WSD    +IQ  L+A+       +++         D+ + S + +F      D+  
Sbjct: 76  LYSRWSDTPAALIQRSLLASLNEKALFASLSSATSLAQTDWMLESNLDAFYHRFYDDKSE 135

Query: 144 AIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEIIDW 198
             I ++ ++++     L+  K F V       +    +++L  A   ++ + IDW
Sbjct: 136 GYIDITYRLVDTRTKQLLASKRFTVFSPAASMDAKGGVEALKIATGELNRQCIDW 190


>gi|283957035|ref|ZP_06374507.1| lipoprotein, putative [Campylobacter jejuni subsp. jejuni 1336]
 gi|283791536|gb|EFC30333.1| lipoprotein, putative [Campylobacter jejuni subsp. jejuni 1336]
          Length = 199

 Score = 99.7 bits (247), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 40/150 (26%), Positives = 73/150 (48%), Gaps = 3/150 (2%)

Query: 57  LIITEPITEKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVV 116
           L I        LNS  I+   +    +Y     W D    +    +++ FE +   +T++
Sbjct: 51  LKIRNANAPWYLNSRAIVYIDNGFSNKYAHYF-WGDLPSNLYSFLILSKFEQSNIFTTLL 109

Query: 117 KPNQGIYADYQIISAIRSFEI--NIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEK 174
                + ADY + S I SFE   N + + A I++S+  IN  +N ++  K+F+ +EK+EK
Sbjct: 110 SSTSSLNADYALESRINSFEQILNNNENYAQISISVNFINLENNQIIAHKIFNTKEKIEK 169

Query: 175 DNKLHFIQSLNRAFSRISSEIIDWTLSSLP 204
            +      +  +A ++I +EI+ W  S+L 
Sbjct: 170 KDIRSTYNAFQKALNKIGNEIVFWVNSNLS 199


>gi|57238660|ref|YP_179791.1| putative lipoprotein [Campylobacter jejuni RM1221]
 gi|57167464|gb|AAW36243.1| lipoprotein, putative [Campylobacter jejuni RM1221]
 gi|315059099|gb|ADT73428.1| Putative lipoprotein [Campylobacter jejuni subsp. jejuni S3]
          Length = 199

 Score = 99.3 bits (246), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 41/150 (27%), Positives = 73/150 (48%), Gaps = 3/150 (2%)

Query: 57  LIITEPITEKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVV 116
           L I        LNS  II   +    +Y     W D    +    +++ FE +   +T++
Sbjct: 51  LKIRNANAPLYLNSRAIIYIDNGFSNKYAHYF-WGDLPSNLYSFLILSKFEQSNIFTTLL 109

Query: 117 KPNQGIYADYQIISAIRSFEI--NIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEK 174
                + ADY + S I SFE   N + + A I++S+  IN  +N ++  K+F+ +EK+EK
Sbjct: 110 SSTSSLSADYALESRINSFEQILNNNENYAQISVSVNFINLENNQIIAHKIFNTKEKIEK 169

Query: 175 DNKLHFIQSLNRAFSRISSEIIDWTLSSLP 204
            +      +  +A ++I +EI+ W  S+L 
Sbjct: 170 KDIRSTYNAFQKALNKIGNEIVFWVNSNLS 199


>gi|212212804|ref|YP_002303740.1| hypothetical protein CbuG_1273 [Coxiella burnetii CbuG_Q212]
 gi|212011214|gb|ACJ18595.1| hypothetical protein CbuG_1273 [Coxiella burnetii CbuG_Q212]
          Length = 199

 Score = 99.3 bits (246), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 26/153 (16%), Positives = 57/153 (37%), Gaps = 2/153 (1%)

Query: 48  DESVQRHIQLIITEPITEKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFE 107
               + H+ ++++ PI      +  +I   +P E+     S+W      M+   L+    
Sbjct: 41  PAHSKTHLTILVSMPIPNPGYQTSAMIYMLTPYELSRYANSRWVAPPSEMLMPLLVQALR 100

Query: 108 NNGKISTVVKPNQGIYADYQIISAIRSFEINIDRHCAIITMS--LKIINAHDNSLVGQKV 165
             G    VV P       Y++ + +   +       + I ++    +I +  N +V    
Sbjct: 101 QTGYFYAVVSPPFVGMTHYRLDTRLLKLQQEFFFPISRIRLTMEASLIKSGTNHVVANHR 160

Query: 166 FHVEEKLEKDNKLHFIQSLNRAFSRISSEIIDW 198
           F V      +N    + + N+A + +S  I  +
Sbjct: 161 FEVLVPALTNNPYGGVLAANKAAAIMSYRIAQF 193


>gi|75675225|ref|YP_317646.1| ABC transporter substrate-binding protein [Nitrobacter winogradskyi
           Nb-255]
 gi|74420095|gb|ABA04294.1| ABC transporter substrate-binding protein [Nitrobacter winogradskyi
           Nb-255]
          Length = 101

 Score = 98.1 bits (243), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 27/101 (26%), Positives = 48/101 (47%), Gaps = 7/101 (6%)

Query: 90  WSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFEINIDR-HCAIITM 148
           W+D +P ++Q KL+ +FEN       ++   G+ AD+Q++  +R F+I  D    A I +
Sbjct: 2   WADSIPNLLQAKLLESFENYDIAHAPLRSMDGVQADHQLLIDVRRFQITTDPEPVADIGL 61

Query: 149 SLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFS 189
           +       D  +V  ++F   +KL          + N AF 
Sbjct: 62  N------KDVKVVAARLFEETQKLRTIEPDTASAAFNEAFD 96


>gi|157415869|ref|YP_001483125.1| putative lipoprotein [Campylobacter jejuni subsp. jejuni 81116]
 gi|157386833|gb|ABV53148.1| lipoprotein, putative [Campylobacter jejuni subsp. jejuni 81116]
 gi|307748506|gb|ADN91776.1| probable lipoprotein [Campylobacter jejuni subsp. jejuni M1]
 gi|315931382|gb|EFV10351.1| conserved hypothetical protein [Campylobacter jejuni subsp. jejuni
           327]
          Length = 199

 Score = 97.7 bits (242), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 41/150 (27%), Positives = 74/150 (49%), Gaps = 3/150 (2%)

Query: 57  LIITEPITEKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVV 116
           L I    T   LNS  I+   +    +Y     W D    +    +++ FE +   +T++
Sbjct: 51  LKIRNANTPLYLNSRAIVYIDNGFSNKYAHYF-WGDLPSNLYSFLILSKFEQSNIFTTLL 109

Query: 117 KPNQGIYADYQIISAIRSFEI--NIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEK 174
                + ADY + S I SFE   + + + A I++S+  IN  +N ++  K+F+ +EK+EK
Sbjct: 110 SSTSSLNADYALESRINSFEQILSNNENYAQISISVNFINLENNQIIAHKIFNTKEKIEK 169

Query: 175 DNKLHFIQSLNRAFSRISSEIIDWTLSSLP 204
            +      +  +A ++I +EII W  S+L 
Sbjct: 170 KDIRSTYNAFQKALNKIGNEIIFWVNSNLS 199


>gi|296284589|ref|ZP_06862587.1| hypothetical protein CbatJ_13221 [Citromicrobium bathyomarinum
           JL354]
          Length = 205

 Score = 97.0 bits (240), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 34/207 (16%), Positives = 74/207 (35%), Gaps = 13/207 (6%)

Query: 1   MDKKLNKIIKKKIISCSLAVLLCTSLSSC--FFHNNPVNIYDLTE----STKYDESVQRH 54
           +D    ++ +   +  S+      +L  C  F  + P  +  LT     +       +  
Sbjct: 2   IDVPATRMPRMASLRLSILATATFALGGCISFGEDPPPALLTLTPSVQIAEGAGPGGEAS 61

Query: 55  IQLIITEPITEKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANF-ENNGKIS 113
             L + +P     L+   + V+  P  I YL  + W D+  ++ Q  L+    E  G++ 
Sbjct: 62  GVLTVRQPEVPGSLSVTRVPVQVDPSTIAYLKDAVWVDRPSKLFQNLLVTTIRERTGRL- 120

Query: 114 TVVKP-NQGIYADYQIISAIRSFEINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKL 172
            V+        +D  +   +R F  +      ++T     I  +    +  + F      
Sbjct: 121 -VLDDVESRAASDSVLRGTLREFGYDARSGAVVVTYDA--IRENGGK-LQTRRFTARVPG 176

Query: 173 EKDNKLHFIQSLNRAFSRISSEIIDWT 199
                     +LN A ++++ ++ DW 
Sbjct: 177 VPAEASPVGVALNDAANQVAIDVADWI 203


>gi|205355661|ref|ZP_03222431.1| putative lipoprotein [Campylobacter jejuni subsp. jejuni CG8421]
 gi|205346438|gb|EDZ33071.1| putative lipoprotein [Campylobacter jejuni subsp. jejuni CG8421]
          Length = 140

 Score = 97.0 bits (240), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 39/139 (28%), Positives = 71/139 (51%), Gaps = 3/139 (2%)

Query: 68  LNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQ 127
           LNS  II   +    +Y     W D    +    +++ FE +   +T++     + ADY 
Sbjct: 3   LNSRAIIYIDNGFSNKYAHYF-WGDLPSNLYSFLILSKFEQSNIFTTLLSSTSSLSADYA 61

Query: 128 IISAIRSFEI--NIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLN 185
           + S I SFE   N + + A I++S+  IN  +N ++  K+F+ +EK+EK +      +  
Sbjct: 62  LESRINSFEQILNNNENYAQISVSVNFINLENNQIIAHKIFNTKEKIEKKDIRSTYNAFQ 121

Query: 186 RAFSRISSEIIDWTLSSLP 204
           +A ++I +EI+ W  S+L 
Sbjct: 122 KALNKIGNEIVFWVNSNLS 140


>gi|294010010|ref|YP_003543470.1| ABC-type transport system auxiliary component (lipoprotein)
           [Sphingobium japonicum UT26S]
 gi|139001581|dbj|BAF51701.1| putative lipoprotein [Sphingobium japonicum]
 gi|292673340|dbj|BAI94858.1| ABC-type transport system auxiliary component (lipoprotein)
           [Sphingobium japonicum UT26S]
          Length = 202

 Score = 95.8 bits (237), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 31/194 (15%), Positives = 74/194 (38%), Gaps = 8/194 (4%)

Query: 16  CSLAVLLCTSLSSC--FFHNNPVNIYDLTESTKYDES----VQRHIQLIITEPITEKILN 69
             LA +    L+ C  F    P  +  L  + K              + + +P   K+L+
Sbjct: 8   LGLAAVGALMLAGCVSFGGKPPERLLSLNAAQKVAPGTLRSASSGTSITVADPEAPKMLD 67

Query: 70  SEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQII 129
           +  + V +SP  + Y+   QW+D    + Q  L            +        A  +++
Sbjct: 68  TVRVPVITSPTSVAYVTKVQWADTPRHLFQKLLAETIAATSNRIVLDPGQYSADAGQRLM 127

Query: 130 SAIRSFEINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQS-LNRAF 188
             +  F ++   + A++T    ++     + + ++ F     +      + + + LN A 
Sbjct: 128 GELVDFGVDEASNSAVVTYDA-MLAGPGGTAIAKQRFTASAPIGGKIDANSVGAPLNAAA 186

Query: 189 SRISSEIIDWTLSS 202
           +++++++  W  SS
Sbjct: 187 NKVAADVAAWLASS 200


>gi|167647529|ref|YP_001685192.1| hypothetical protein Caul_3567 [Caulobacter sp. K31]
 gi|167349959|gb|ABZ72694.1| conserved hypothetical protein [Caulobacter sp. K31]
          Length = 217

 Score = 95.8 bits (237), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 30/185 (16%), Positives = 68/185 (36%), Gaps = 8/185 (4%)

Query: 25  SLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIITEPITE--KILNSEDIIVRSSPIEI 82
              S F   NP  +Y          +        + +  T   +    +  ++  +  E 
Sbjct: 27  GCISLFPKTNPSGLYRFGHEAAAVSTTPTEKSFGVFKTTTVFTRAAMGDR-LLSVTNGEA 85

Query: 83  QYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFEINI--- 139
            Y+  ++W      +    +   FE +G  + +V   + + A   +   +RSFE++    
Sbjct: 86  AYIADARWVSPAIVLFDEAVARAFEADGSRARLVTRGETLKAVMALRLEVRSFEVDYLNG 145

Query: 140 --DRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEIID 197
                  ++ +   +    D +L+G KVF    K   +     + + ++A  ++ SEI+ 
Sbjct: 146 PKAPPEVLVEIRAVMTRGADRALLGDKVFVARVKAADNRLSAIVPAYDQANGQVLSEIVA 205

Query: 198 WTLSS 202
           W   +
Sbjct: 206 WVNEA 210


>gi|94496557|ref|ZP_01303133.1| hypothetical protein SKA58_17672 [Sphingomonas sp. SKA58]
 gi|94423917|gb|EAT08942.1| hypothetical protein SKA58_17672 [Sphingomonas sp. SKA58]
          Length = 203

 Score = 95.8 bits (237), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 36/199 (18%), Positives = 74/199 (37%), Gaps = 10/199 (5%)

Query: 10  KKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQR----HIQLIITEPITE 65
           K   ++  LA     S    F    P  +  L  + K      R       LI+TEP   
Sbjct: 5   KPHGVTAVLAAAFLLSGCVSFGGKPPERLLSLDAAHKVPSGTPRVAGNGRTLIVTEPEAP 64

Query: 66  KILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYAD 125
           K +++  + V++SP  + Y+   QW+D    + +  L            VV        D
Sbjct: 65  KTVDTVRVPVQTSPTSVAYVTDVQWADTPRHLFRRLLAETISATT--DRVVLDTGQFSGD 122

Query: 126 --YQIISAIRSFEINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQS 183
              ++   +  F I+  +  AI+T    ++       + ++ F     +        + +
Sbjct: 123 GGQRLTGELIDFGIDEAQQSAIVTYDAMLM-TPSGVALARQRFTASAPVGGKINATSVGA 181

Query: 184 -LNRAFSRISSEIIDWTLS 201
            LN A +++++++  W  +
Sbjct: 182 PLNAAANQVATDVAAWVAA 200


>gi|315498542|ref|YP_004087346.1| hypothetical protein Astex_1529 [Asticcacaulis excentricus CB 48]
 gi|315416554|gb|ADU13195.1| protein of unknown function DUF330 [Asticcacaulis excentricus CB
           48]
          Length = 231

 Score = 94.6 bits (234), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 32/214 (14%), Positives = 77/214 (35%), Gaps = 16/214 (7%)

Query: 5   LNKIIKKKIISCSLAVLLCTSLSSC---FFHNNPVNIYDLT----------ESTKYDESV 51
           + ++ ++ +    L   L T LS C        PV +Y +                    
Sbjct: 2   MTRVTRRSLSLGLLTAGLATGLSGCITLLPEVKPVQLYSIRFNPALLEKDEVKAPPASPD 61

Query: 52  QRHIQLIITEPITEKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGK 111
            R   + +      +    + I V     E+ Y+ G +W+       +  +   F  +  
Sbjct: 62  ARPADVFVNFDGFPRAAAGDRI-VTIEGNEVSYVSGGRWASTAQGQFRDLMSEGFARHAS 120

Query: 112 ISTVVKPNQGIYADYQIISAIRSFEINID--RHCAIITMSLKIINAHDNSLVGQKVFHVE 169
               +     +  +Y++   +R FE      R   ++ +  +++   D  ++ +K    E
Sbjct: 121 PEVRLGDQGRVSGNYRLDINVRRFEAVYAKRRPTVVVALDARLVRLKDRQVMAEKFISSE 180

Query: 170 EKLEKDNKLHFIQSLNRAFSRISSEIIDWTLSSL 203
             + K +    I+    A SR++ ++I +T +++
Sbjct: 181 IVVRKGSLGPMIEGFESAASRVTVDVIAFTETAV 214


>gi|114320358|ref|YP_742041.1| ABC-type uncharacterized transport system auxiliary component-like
           protein [Alkalilimnicola ehrlichii MLHE-1]
 gi|114226752|gb|ABI56551.1| ABC-type uncharacterized transport system auxiliary component-like
           protein [Alkalilimnicola ehrlichii MLHE-1]
          Length = 208

 Score = 93.5 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 32/180 (17%), Positives = 71/180 (39%), Gaps = 7/180 (3%)

Query: 24  TSLSSCFFHNNPVNIYDLTESTKYDESV--QRHIQLIITEPITEKILNSEDIIVRSSPIE 81
             L+      +P   Y LT +              + +          S  +  R    E
Sbjct: 21  CGLALPGPAESP-RTYSLTWAPSEAPGGSEPLAGAVRVMATQAAPGYTSSAMRYRRDDWE 79

Query: 82  IQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAI----RSFEI 137
           +Q     QW +   RM+   L+A  E++G    V+     + A  ++ + +      FE 
Sbjct: 80  LQRFAHHQWVEPPARMLTPALVAVLEHDGPFRQVIHGPTVVDAPLRLHTELKRLEHRFEH 139

Query: 138 NIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEIID 197
           + D    ++T+ ++++++    ++  + FH E   E+ + +   ++ NRA + +  +I D
Sbjct: 140 DEDAGRVVLTLRIQLLDSEAGEVLTTRRFHAEVTAERRHPVAGAKAANRALAELLPQITD 199


>gi|332187462|ref|ZP_08389200.1| hypothetical protein SUS17_2543 [Sphingomonas sp. S17]
 gi|332012623|gb|EGI54690.1| hypothetical protein SUS17_2543 [Sphingomonas sp. S17]
          Length = 186

 Score = 92.3 bits (228), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 29/185 (15%), Positives = 74/185 (40%), Gaps = 3/185 (1%)

Query: 16  CSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIITEPITEKILNSEDIIV 75
            SL +  C S  +    +          +    +   R   + I  P T + L +  + V
Sbjct: 2   ASLPLAGCISFGAKPPPSLMTLQAQSAPTVGQTQDSARAKSITIQVPTTPQELATARVPV 61

Query: 76  RSSPIEIQYLIGSQWSDKLPRMIQLKLIANF-ENNGKISTVVKPNQGIYADYQIISAIRS 134
           + +   I Y+  +QW++   R+    +        G++    + +     D ++   +R 
Sbjct: 62  QENATSIAYVKDAQWAEPPARLFARLVSDTLTAREGRVVLSARESVVDSGD-RLAGELRQ 120

Query: 135 FEINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSE 194
           F ++  RH A++     ++  +  + + ++ F     + K +      +LN+A ++++ +
Sbjct: 121 FGMDAVRHDAVVIFDASLMR-NGQTAIEKRRFEARVPVGKIDAQSVGPALNQAANQVAQQ 179

Query: 195 IIDWT 199
           + DW 
Sbjct: 180 VADWV 184


>gi|88810289|ref|ZP_01125546.1| hypothetical protein NB231_14453 [Nitrococcus mobilis Nb-231]
 gi|88791919|gb|EAR23029.1| hypothetical protein NB231_14453 [Nitrococcus mobilis Nb-231]
          Length = 156

 Score = 90.0 bits (222), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 25/148 (16%), Positives = 63/148 (42%), Gaps = 3/148 (2%)

Query: 59  ITEPITEKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKP 118
           +  P      ++  +  R +P EI+Y   S+W D   RM++  L +     G   +    
Sbjct: 2   VEPPQVAAGYDTTAMAYRRTPWEIRYYSLSRWVDDPARMLREALTSALNQLGPFRSAFAS 61

Query: 119 NQGIYADYQIISAIRSFEINID---RHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKD 175
             GI  DY + + +   E +          + + ++++N   ++L+  +V  +      +
Sbjct: 62  PAGIAVDYSLRTELLRLEQDFSNAPPSRERLVVRVQLVNLAHDTLLASQVLELNTTAPSE 121

Query: 176 NKLHFIQSLNRAFSRISSEIIDWTLSSL 203
           +    + + N A  ++++E++ +   +L
Sbjct: 122 DAYGGVVAANTALQQLAAEVVTFCRKAL 149


>gi|329890326|ref|ZP_08268669.1| hypothetical protein BDIM_20270 [Brevundimonas diminuta ATCC 11568]
 gi|328845627|gb|EGF95191.1| hypothetical protein BDIM_20270 [Brevundimonas diminuta ATCC 11568]
          Length = 200

 Score = 89.6 bits (221), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 39/202 (19%), Positives = 76/202 (37%), Gaps = 20/202 (9%)

Query: 12  KIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHI-------QLIITEPIT 64
            I   S+A+  C  LSS     +PV +Y    ++ Y  +               +  P  
Sbjct: 1   MIAGASVALSGCALLSS----PDPVQLYRFGGASAYAGTGATSACPDVHVSMRRVDFPEA 56

Query: 65  EKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYA 124
            +    + I+   +  E  Y+ G++W      + +  L   F  +G   TV+        
Sbjct: 57  AR---GDRIL-AVTGTEAAYIKGARWVSPAETLFEEALRNAFL-DGGTCTVLSSGPLTRD 111

Query: 125 DYQIISAIRSFEINIDRHCAI----ITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHF 180
              +   +R FE +     A+    I + L+++   D S+V +    V E    + +   
Sbjct: 112 GLLLSVDVRRFEASYVAPGAVPDATIVVLLRLVRPGDRSIVAEDRITVSENAGVNRQSAI 171

Query: 181 IQSLNRAFSRISSEIIDWTLSS 202
           + + +RA +  S +I+ WT   
Sbjct: 172 VAAFDRATAETSRQIVLWTDQQ 193


>gi|328954408|ref|YP_004371742.1| protein of unknown function DUF330 [Desulfobacca acetoxidans DSM
           11109]
 gi|328454732|gb|AEB10561.1| protein of unknown function DUF330 [Desulfobacca acetoxidans DSM
           11109]
          Length = 216

 Score = 89.3 bits (220), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 34/205 (16%), Positives = 83/205 (40%), Gaps = 8/205 (3%)

Query: 1   MDKKLNKIIKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQR-HIQLII 59
           M +  N   ++   + +  +++  +   C      +N Y L   +    S       + +
Sbjct: 1   MQRISNLFNRQLAAATAAVIMMTLTAIGCGKPPVTLNRYLLEYPSPVSGSRPTLPDSIRV 60

Query: 60  TEPITEKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTV-VKP 118
                 + L +  +I R  P E      ++W      ++   L+ +  N+G    V    
Sbjct: 61  ELFAAVQSLTTTAMIYRPKPYEASSYAYNRWQVSPSHLVTDYLLRDLRNSGLFQGVFGYQ 120

Query: 119 NQGIYADYQIISAIRSF-EINI-DRHCAIITMSLKIINAH----DNSLVGQKVFHVEEKL 172
             G  + +++  A++ F E++  D   A++ +S+ +++ +       ++ Q+ +  EE +
Sbjct: 121 QSGGVSRFKLEGAVQEFAEVDAPDGWKAVLAISINLLDTNQEEITRRVIMQQNYCSEESM 180

Query: 173 EKDNKLHFIQSLNRAFSRISSEIID 197
                L     ++RA  RIS+++I 
Sbjct: 181 PDQTPLGLAGGMSRAMERISAQVIA 205


>gi|297538916|ref|YP_003674685.1| hypothetical protein M301_1730 [Methylotenera sp. 301]
 gi|297258263|gb|ADI30108.1| hypothetical protein M301_1730 [Methylotenera sp. 301]
          Length = 219

 Score = 88.5 bits (218), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 21/143 (14%), Positives = 51/143 (35%), Gaps = 2/143 (1%)

Query: 56  QLIITEPITEKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTV 115
            L++         +S  ++    P +++Y   +QW D   RM+   ++   +     S V
Sbjct: 66  TLVVNLSTAAAGFDSARMVYSRVPYKLEYFAHNQWIDTPARMLTPLILNTLKAKSLFSAV 125

Query: 116 VKPNQGIYADYQIISAIRSFEINIDRHCAIITMSLK--IINAHDNSLVGQKVFHVEEKLE 173
                   + Y + + I   +       +    +L+  +I+   + +V  +        +
Sbjct: 126 TLTPSTANSHYSLDTQIIRLQQEFFSPQSSERFTLRVTLIDNIKHQVVFVRELEAVVTAK 185

Query: 174 KDNKLHFIQSLNRAFSRISSEII 196
            DN    + + N A   +  E+ 
Sbjct: 186 TDNPYGGVVAANEAVQILLEELA 208


>gi|149187029|ref|ZP_01865336.1| hypothetical protein ED21_31249 [Erythrobacter sp. SD-21]
 gi|148829318|gb|EDL47762.1| hypothetical protein ED21_31249 [Erythrobacter sp. SD-21]
          Length = 201

 Score = 88.5 bits (218), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 29/196 (14%), Positives = 69/196 (35%), Gaps = 2/196 (1%)

Query: 4   KLNKIIKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIITEPI 63
            + K  K  II+ +L +  C S  S    +        +       +      L++ E  
Sbjct: 7   AMIKHFKFAIIAPALLLGGCLSFGSEPPESLLTLTPTASAPAGTGGTSTAGTALVLQEFQ 66

Query: 64  TEKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIY 123
               L+   + V+ +  E+ YL  + W +K  R+ +  +            +   + G  
Sbjct: 67  APSSLDVTRVPVQVTDTELAYLQDAVWVEKPARLFRRLMAETIRTRSSRVVIDGDDPGAL 126

Query: 124 ADYQIISAIRSFEINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQS 183
           A+ ++   +R+F  +       +      +   + S V  + F         +      +
Sbjct: 127 AENRLTGTLRAFGYDARDGSVRVVFDA--VRPGEGSAVVTRRFEAVVPGVPADVSSVGPA 184

Query: 184 LNRAFSRISSEIIDWT 199
           LN+A + ++ ++ +W 
Sbjct: 185 LNQAANDVAGQVAEWV 200


>gi|94498319|ref|ZP_01304878.1| hypothetical protein SKA58_19090 [Sphingomonas sp. SKA58]
 gi|94422199|gb|EAT07241.1| hypothetical protein SKA58_19090 [Sphingomonas sp. SKA58]
          Length = 216

 Score = 88.1 bits (217), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 27/193 (13%), Positives = 62/193 (32%), Gaps = 12/193 (6%)

Query: 21  LLCTSLSSCFFHNNPVNIYDL----TESTKYDESVQRHIQLIITEPITEKILNSEDIIVR 76
           +L  S  +        +++             +       + +  P   + +  + ++  
Sbjct: 1   MLLASCGNLLGGGERADLFRFGVVDPTPVTGMQGALPTRSVSLLRPRFSQEVEGDRMLTT 60

Query: 77  SSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFE 136
                + YL G +W   +P +    L+  +        +        A + +   I  FE
Sbjct: 61  RGERAL-YLKGVRWVAPVPDLFTQALMRQYAARAPDVRLTGVRNATGASHALQIDIERFE 119

Query: 137 INID-------RHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFS 189
                          II     + +  D   V  K F V+E    +     + + +RA +
Sbjct: 120 ARYALDGGEKAPPTVIIEGDATLFDLSDRRPVEAKRFLVQEPASANTTSGIVAAFDRAVA 179

Query: 190 RISSEIIDWTLSS 202
           R ++E+ DW+  +
Sbjct: 180 RSTTELTDWSADT 192


>gi|23011784|ref|ZP_00052043.1| COG3218: ABC-type uncharacterized transport system, auxiliary
           component [Magnetospirillum magnetotacticum MS-1]
          Length = 125

 Score = 86.9 bits (214), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 28/116 (24%), Positives = 55/116 (47%), Gaps = 1/116 (0%)

Query: 9   IKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIITEPITEKIL 68
           +  + +     V     L  C     P+  +DL        +      ++++EP+  + +
Sbjct: 10  LPGRGLRAGALVASLAFLGGCGGGATPL-TFDLAALPGQPRAGGPARSIVVSEPVGLQPM 68

Query: 69  NSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYA 124
            ++ IIVR +   + +L G QW+D+LPR+IQ ++I + EN G++ +V  P      
Sbjct: 69  EADRIIVREAGGSLSFLGGGQWADRLPRLIQTRVIQSLENTGRLRSVSYPGDRCRP 124


>gi|302382568|ref|YP_003818391.1| hypothetical protein Bresu_1456 [Brevundimonas subvibrioides ATCC
           15264]
 gi|302193196|gb|ADL00768.1| protein of unknown function DUF330 [Brevundimonas subvibrioides
           ATCC 15264]
          Length = 201

 Score = 86.9 bits (214), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 29/203 (14%), Positives = 80/203 (39%), Gaps = 14/203 (6%)

Query: 8   IIKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLT---ESTKYDESVQRHIQLI-ITEPI 63
           +I+  + +   AV L  S  +     +PV +Y       +     +    ++L  +  P 
Sbjct: 1   MIRSILATAVAAVTL--SGCALLSSPDPVQLYRFGTTGATPAQAVAEPVQVKLRAVEFPQ 58

Query: 64  TEKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIY 123
             +     D ++  +  +  ++ G++W     ++    L   F    +   ++   +   
Sbjct: 59  ASQG----DRLLGVTGTQAAFIAGARWVSPAQQLYADSLEGAFAGQARAVRLIGRRELTP 114

Query: 124 ADYQIISAIRSFEINID----RHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLH 179
               +   +RSFE   D        +I+   +++   + ++V ++ F V +   ++    
Sbjct: 115 TTRVLDIDMRSFETRYDYAGGVPTIVISARARLLRFPERTVVAEQTFEVSQPASENRIAT 174

Query: 180 FIQSLNRAFSRISSEIIDWTLSS 202
            + + + A   ++S+I+ WT ++
Sbjct: 175 IVDAYDVATRDLNSQIVAWTDTN 197


>gi|326388336|ref|ZP_08209932.1| hypothetical protein Y88_3219 [Novosphingobium nitrogenifigens DSM
           19370]
 gi|326207068|gb|EGD57889.1| hypothetical protein Y88_3219 [Novosphingobium nitrogenifigens DSM
           19370]
          Length = 215

 Score = 86.6 bits (213), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 25/176 (14%), Positives = 56/176 (31%), Gaps = 8/176 (4%)

Query: 28  SCFFHNNPVNIYDLTE----STKYDESVQRHIQLIITEPITEKILNSEDIIVRSSPIEIQ 83
                  P  +  LT     ++    S +    L + EP T   L    + V      + 
Sbjct: 43  GLGNAKVPPTLLTLTPQAVPASGATISGKPDSALSVMEPETPAKLAVLRVPVAVDESRVA 102

Query: 84  YLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFEINIDRHC 143
           YL  +QW ++  R+ Q  L            ++     +     +   +     +   H 
Sbjct: 103 YLRQAQWVERPSRLFQHLLAETLRAKD--GHLISEGDSLTHGPILSGRLIDMGYDAQDHA 160

Query: 144 AIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEIIDWT 199
            ++      +    +  +  + F         +      +LNRA ++++ ++ DW 
Sbjct: 161 VVVRFDA--VRQMPDGTIATRRFDASVPHVDASAEEVGPALNRAANQVAQQVADWV 214


>gi|141212|sp|P26880|YPA1_LEGPN RecName: Full=Uncharacterized protein in pal 5'region; AltName:
           Full=ORFU
          Length = 103

 Score = 86.6 bits (213), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 19/100 (19%), Positives = 47/100 (47%), Gaps = 2/100 (2%)

Query: 106 FENNGKISTVVKPNQGIYADYQIISAIRSFEINIDRHCAIITMSLKII--NAHDNSLVGQ 163
            +++G    V        ADY++ + +   E N  +  +++  S KI+  +  DN ++G 
Sbjct: 1   LQSSGYFYAVTSSPYSEEADYRLDTQLLKLEQNFIKKPSVLEFSAKIVLTHISDNQIIGS 60

Query: 164 KVFHVEEKLEKDNKLHFIQSLNRAFSRISSEIIDWTLSSL 203
           ++  ++    +D     + + N+A  R ++   D+ +S +
Sbjct: 61  RIVSLQIPCSQDTPYGGVIAANQATFRFTATATDFVVSHI 100


>gi|85707664|ref|ZP_01038730.1| hypothetical protein NAP1_00475 [Erythrobacter sp. NAP1]
 gi|85689198|gb|EAQ29201.1| hypothetical protein NAP1_00475 [Erythrobacter sp. NAP1]
          Length = 203

 Score = 86.2 bits (212), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 35/199 (17%), Positives = 72/199 (36%), Gaps = 12/199 (6%)

Query: 11  KKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRH-------IQLIITEPI 63
             ++  SLA+  C SL        P ++  LT +                   + +  P 
Sbjct: 9   SALVGASLALSACVSLGGAEP---PESLLSLTPTAMAPAGSGASHNRAGESSAIAVLTPE 65

Query: 64  TEKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIY 123
               L+ + + V  S  EI YL  + W +K  R+ +  L       G +  +   +    
Sbjct: 66  VPAKLDVQRVPVNVSDTEIAYLQEAVWVEKPARLFRRLLGETLRTRGSMLVLDGEDSPTV 125

Query: 124 ADYQIISAIRSFEINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQS 183
           A   +  ++     +      +++ +   I   D+  V  + F   E+           +
Sbjct: 126 ATRYLRGSLIELGYDAPTSSVVVSFNA--ILTSDDGTVTSRRFEAREEGILAEASDVGPA 183

Query: 184 LNRAFSRISSEIIDWTLSS 202
           LNRA + ++ E+ DW +++
Sbjct: 184 LNRAANTLAGEVADWAIAN 202


>gi|283953733|ref|ZP_06371264.1| putative lipoprotein [Campylobacter jejuni subsp. jejuni 414]
 gi|283794774|gb|EFC33512.1| putative lipoprotein [Campylobacter jejuni subsp. jejuni 414]
          Length = 114

 Score = 86.2 bits (212), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 31/113 (27%), Positives = 61/113 (53%), Gaps = 2/113 (1%)

Query: 94  LPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFEI--NIDRHCAIITMSLK 151
              +    +++ FE +   +T++     + A+Y + S I SFE   N D + A I++S+ 
Sbjct: 2   PSNLYSSLILSKFEQSNIFTTLLSSTSSLNANYVLESRINSFEQILNGDENYAQISISVN 61

Query: 152 IINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEIIDWTLSSLP 204
            IN  +N ++  K+F+++E +EK +      +  +A ++I +EII W  S+L 
Sbjct: 62  FINLENNQIIAHKIFNIKENIEKKDIRSTYNAFQKALNKIGNEIIFWVNSNLS 114


>gi|148555656|ref|YP_001263238.1| ABC transporter auxiliary component-like protein [Sphingomonas
           wittichii RW1]
 gi|148500846|gb|ABQ69100.1| ABC-type uncharacterized transport system auxiliary component-like
           protein [Sphingomonas wittichii RW1]
          Length = 195

 Score = 85.0 bits (209), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 21/141 (14%), Positives = 54/141 (38%), Gaps = 2/141 (1%)

Query: 59  ITEPITEKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKP 118
           ++ P     L ++ I V+ +     YL  + W D   ++ +  L    E           
Sbjct: 54  VSAPALPAALRNQRIAVQ-TGAAFAYLPKAAWVDTPSQLFRSVLAETIEARTGRFVPDTR 112

Query: 119 NQGIYADYQIISAIRSFEINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKL 178
           N  I  D ++   + +F++   +   ++     +  +  + +   + F     +  ++  
Sbjct: 113 NGAITPDTRLSGTLLAFQLLGGQGKVLVIYDATLAKSGSDEIRA-RRFERSVPVAGEDAR 171

Query: 179 HFIQSLNRAFSRISSEIIDWT 199
               +LN A + I++++ DW 
Sbjct: 172 SVAAALNEATNGIATDVADWI 192


>gi|307297004|ref|ZP_07576820.1| protein of unknown function DUF330 [Sphingobium chlorophenolicum
           L-1]
 gi|306877530|gb|EFN08758.1| protein of unknown function DUF330 [Sphingobium chlorophenolicum
           L-1]
          Length = 200

 Score = 85.0 bits (209), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 29/182 (15%), Positives = 67/182 (36%), Gaps = 8/182 (4%)

Query: 16  CSLAVLLCTSLSSC--FFHNNPVNIYDLTESTKYDESVQRHIQ----LIITEPITEKILN 69
             LA +    L+ C  F    P  +  L  + K      R       + + +P   K+L+
Sbjct: 6   LGLAAVGALMLAGCVSFGGKPPERLLSLNAAQKVAPGTLRSASSGTAITVADPEAPKMLD 65

Query: 70  SEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQII 129
           +  + V +SP  + Y+   QW+D    + Q  L            +        A  +++
Sbjct: 66  TVRVPVITSPTSVAYVTKVQWADTPRHLFQKLLAETIAATSSRIVLDPGQYSADAGQRLM 125

Query: 130 SAIRSFEINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQS-LNRAF 188
             +  F ++   + A++T    ++     + + ++ F     +      + + + LN A 
Sbjct: 126 GELVDFGLDEASNSAVVTYDA-MLAGPGGTAIAKQRFTASVPVGGKIDANSVGAPLNAAA 184

Query: 189 SR 190
           ++
Sbjct: 185 NK 186


>gi|85373090|ref|YP_457152.1| hypothetical protein ELI_01315 [Erythrobacter litoralis HTCC2594]
 gi|84786173|gb|ABC62355.1| hypothetical protein ELI_01315 [Erythrobacter litoralis HTCC2594]
          Length = 197

 Score = 83.5 bits (205), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 25/158 (15%), Positives = 53/158 (33%), Gaps = 2/158 (1%)

Query: 42  TESTKYDESVQRHIQLIITEPITEKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLK 101
           T S            L + EP   + L+   + V+     + YL  + W +K  R+ +  
Sbjct: 40  TASAGQPTQGTGQTALTVVEPTAPQRLSVNRVPVQVDDANVAYLKDAMWVEKPTRLFRRL 99

Query: 102 LIANFENNGKISTVVKPNQGIYADYQIISAIRSFEINIDRHCAIITMSLKIINAHDNSLV 161
           L      +G    +   +  I    Q+  ++  F  +      I+T     +      ++
Sbjct: 100 LSETIRASGNRVVIDGFDPTIATGDQLRGSLVDFGYDARTSSVIVTFDA--VREGSGDVI 157

Query: 162 GQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEIIDWT 199
             + F                +LN A + ++ ++ DW 
Sbjct: 158 TTQRFTSVVPGVAAEAGPVGDALNEAANDVAQQVADWV 195


>gi|82703105|ref|YP_412671.1| putative lipoprotein [Nitrosospira multiformis ATCC 25196]
 gi|82411170|gb|ABB75279.1| putative lipoprotein [Nitrosospira multiformis ATCC 25196]
          Length = 217

 Score = 83.5 bits (205), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 34/180 (18%), Positives = 66/180 (36%), Gaps = 15/180 (8%)

Query: 33  NNPVNIYDL--------TESTKYDESVQRHIQLIITEPITEKILNSEDIIVR---SSPIE 81
             PV +YD           + +   + Q    L++T+ I    L+S  I  R     P  
Sbjct: 23  PAPVAVYDFGLQPLPVEPSAAETGGNRQLRTSLLVTDTIAPAWLDSTAIHYRLAYDDPTR 82

Query: 82  IQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFEINIDR 141
                 S+W+    +++  + +           V+   +G +ADY +   +  F    D 
Sbjct: 83  FLAYRSSRWASTPAKLLTQR-VRTRIAALNEGGVMNTGEGAHADYILRVDLEEFAQVFDT 141

Query: 142 HC---AIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEIIDW 198
                AI+ +   +I+      V Q+ F VE      N    +++L  A  ++   ++ W
Sbjct: 142 PSRSSAIVQLRASLIDRTTRYPVSQRSFGVEVPAPTANAAGAVKALTEASDQLIESLVGW 201


>gi|46200919|ref|ZP_00056200.2| COG3218: ABC-type uncharacterized transport system, auxiliary
           component [Magnetospirillum magnetotacticum MS-1]
          Length = 203

 Score = 83.5 bits (205), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 33/180 (18%), Positives = 70/180 (38%), Gaps = 6/180 (3%)

Query: 19  AVLLCTSLSSCFFHNNPVNIY---DLTESTKYDESVQRHIQLIITEPITEKILNSEDIIV 75
           A LL   L++C     P + +   ++    +          L +   +T   + +E  + 
Sbjct: 9   AALLLFVLTACTGPAAPPDAFYRIEVAAPAQRLPKPVLPGVLEVNR-LTSDGVAAERAVA 67

Query: 76  --RSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIR 133
             R+    + +     WS+    ++Q +L      +G    VV P   + +D+ +   +R
Sbjct: 68  FARTEGGALAHYKYDFWSEPPGILLQDRLEHYLSESGLAGRVVTPELRVLSDWVLRGKVR 127

Query: 134 SFEINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISS 193
            FE   DR   +  + L ++ A D  LV  + + V      D      +++ +A + I +
Sbjct: 128 RFEQIADRSEVVADLELAVVGARDGRLVLLETYAVRIPAASDRVEDAARAMEKAVNEIFA 187


>gi|315639125|ref|ZP_07894292.1| lipoprotein [Campylobacter upsaliensis JV21]
 gi|315480829|gb|EFU71466.1| lipoprotein [Campylobacter upsaliensis JV21]
          Length = 192

 Score = 83.5 bits (205), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 33/145 (22%), Positives = 60/145 (41%), Gaps = 3/145 (2%)

Query: 56  QLIITEPITEKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTV 115
            L I +P     LNS++II     +   Y     W+D      +  L+   E +G  + V
Sbjct: 44  TLQILKPKVPLYLNSKEIIYVKKGLSGTY-AYHFWADLPSNFYRFVLLDKLEKSGIFNAV 102

Query: 116 VKPNQGIYADYQIISAIRSFE--INIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLE 173
           V+       D  + S + SFE  I  + + A I++S+ + +  +  ++  + F V   LE
Sbjct: 103 VEKANLTPVDLALKSRLESFEQIITSEGNFAKISLSVTLFDIKEQKILENEFFEVLVVLE 162

Query: 174 KDNKLHFIQSLNRAFSRISSEIIDW 198
                  +    R  + +  +II W
Sbjct: 163 DLQMNTLVVGFERGLNELCDKIIAW 187


>gi|152992945|ref|YP_001358666.1| hypothetical protein SUN_1356 [Sulfurovum sp. NBC37-1]
 gi|151424806|dbj|BAF72309.1| hypothetical protein [Sulfurovum sp. NBC37-1]
          Length = 191

 Score = 83.1 bits (204), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 32/177 (18%), Positives = 75/177 (42%), Gaps = 5/177 (2%)

Query: 27  SSCFFHNNPV-NIYDLTES--TKYDESVQRHIQLIITEPITEKILNSEDIIVRSSPIEIQ 83
           S C F   PV  +Y L     T    +  R+  L ++ P+       +++    S  +  
Sbjct: 13  SGCSFKEAPVMKVYALATPSITPVASAQYRNKILKVSYPVAVNEKLGDEMHYSYSLTDRG 72

Query: 84  YLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFE--INIDR 141
             + S+W++ + R++Q  +I           VV     +  + ++ + +  F   +  + 
Sbjct: 73  TYLNSRWANDVGRLLQGNIIQTLSQARLFKVVVPYTSDLDENLRLEAIVFDFSHHVRGEA 132

Query: 142 HCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEIIDW 198
             A+ ++   +INA    LV  + F   E     +   ++++ NR  +++S ++++W
Sbjct: 133 SYAVASIQFTLINAETGKLVKARRFSYREATPTTDAKGYMEATNRIMAKLSHDLVNW 189


>gi|307720551|ref|YP_003891691.1| hypothetical protein Saut_0630 [Sulfurimonas autotrophica DSM
           16294]
 gi|306978644|gb|ADN08679.1| conserved hypothetical protein [Sulfurimonas autotrophica DSM
           16294]
          Length = 205

 Score = 82.7 bits (203), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 33/197 (16%), Positives = 71/197 (36%), Gaps = 7/197 (3%)

Query: 9   IKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLT---ESTKYDESVQRHIQLIITEPITE 65
           +K ++I+  +  +    ++ C       N Y L    E  K  ++      L + +  ++
Sbjct: 1   MKNRLITLWITCMGLFLVTGCTSPTPAQNEYRLNMNLEVLKAGKTKCSQKTLKVEQAFSD 60

Query: 66  KILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYAD 125
           K+  S  +              ++W       +  ++           +V   +     D
Sbjct: 61  KLFMSLKMYYVKGKYAQYAYTRARWVQSPNDKVTEEITRFLRAMQLFKSVQTADSKTKND 120

Query: 126 YQIISAIRSFEINIDRHC----AIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFI 181
           +++   I  F    D +       I  +  +IN   + +V  K FH +EK   +N L  +
Sbjct: 121 FKLEINIEDFMQYFDENEKNSYVNIAFTCSLINTATHKIVATKTFHAKEKTSSNNALGGV 180

Query: 182 QSLNRAFSRISSEIIDW 198
           ++L  A ++I  E   W
Sbjct: 181 KALESALNKILKECGLW 197


>gi|254196393|ref|ZP_04902817.1| putative lipoprotein [Burkholderia pseudomallei S13]
 gi|254295956|ref|ZP_04963413.1| putative lipoprotein [Burkholderia pseudomallei 406e]
 gi|157805759|gb|EDO82929.1| putative lipoprotein [Burkholderia pseudomallei 406e]
 gi|169653136|gb|EDS85829.1| putative lipoprotein [Burkholderia pseudomallei S13]
          Length = 212

 Score = 82.3 bits (202), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 32/202 (15%), Positives = 72/202 (35%), Gaps = 9/202 (4%)

Query: 1   MDKKLNKIIKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIIT 60
           M   L++  +  +      V+   S  +          YDL  +     S      L + 
Sbjct: 6   MSGSLSRRGRPALALAVALVMASASGCAGTPAALANIRYDLGPAQPAASSGTGP-ALKVL 64

Query: 61  EPITEKILNSEDIIVR---SSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVK 117
           +      LN++  + R   S    I     S+W+    +++  +L      +G+   V+ 
Sbjct: 65  DVSAPDALNTDRFVYRLAYSDAQRIAAYRDSKWTAPPAQLLTQRLRGAL--SGR-GAVLA 121

Query: 118 PNQGIYADYQIISAIRSFEINIDR-HCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDN 176
            + G+ A   +   +  FE   D    +   ++ ++    +  ++GQ+ F         +
Sbjct: 122 ADDGVRAPV-LKVELSEFEQVFDGRSESHAAVTARVTLTQEGKVLGQRTFVSRAPASTPD 180

Query: 177 KLHFIQSLNRAFSRISSEIIDW 198
                Q+L  A   + S+++ W
Sbjct: 181 AAGGAQALATASDALVSQLVAW 202


>gi|126439217|ref|YP_001057487.1| putative lipoprotein [Burkholderia pseudomallei 668]
 gi|126218710|gb|ABN82216.1| putative lipoprotein [Burkholderia pseudomallei 668]
          Length = 212

 Score = 82.3 bits (202), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 32/202 (15%), Positives = 72/202 (35%), Gaps = 9/202 (4%)

Query: 1   MDKKLNKIIKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIIT 60
           M   L++  +  +      V+   S  +          YDL  +     S      L + 
Sbjct: 6   MSGSLSRRGRPALALAVALVMASASGCAGTPAALANIRYDLGPAQPAASSGTGP-ALKVL 64

Query: 61  EPITEKILNSEDIIVR---SSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVK 117
           +      LN++  + R   S    I     S+W+    +++  +L      +G+   V+ 
Sbjct: 65  DVSAPDALNTDRFVYRLAYSDAQRIAAYRDSKWTAPPAQLLTQRLRGAL--SGR-GAVLA 121

Query: 118 PNQGIYADYQIISAIRSFEINIDR-HCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDN 176
            + G+ A   +   +  FE   D    +   ++ ++    +  ++GQ+ F         +
Sbjct: 122 ADDGVRAPV-LKVELSEFEQVFDGRSESHAAVTARVTLTQEGKVLGQRTFVSRAPASTPD 180

Query: 177 KLHFIQSLNRAFSRISSEIIDW 198
                Q+L  A   + S+++ W
Sbjct: 181 AAGGAQALATASDALVSQLVAW 202


>gi|313202098|ref|YP_004040756.1| hypothetical protein MPQ_2375 [Methylovorus sp. MP688]
 gi|312441414|gb|ADQ85520.1| conserved hypothetical protein [Methylovorus sp. MP688]
          Length = 191

 Score = 81.9 bits (201), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 28/197 (14%), Positives = 68/197 (34%), Gaps = 21/197 (10%)

Query: 12  KIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIITEPITEKILNSE 71
            ++  + ++  C SL+     + P   +D       +   +   Q  I    +   LN++
Sbjct: 6   TLLILAGSLSACLSLNGNKPQSGP-QTFDF---GLGEPGERIATQTSIENIRSGDALNNK 61

Query: 72  DIIVR---SSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQI 128
            I  R    +  ++ Y   S+W+     ++  KL        +                +
Sbjct: 62  RIRYRLAYQNAQQVAYYADSRWTAPPAELLTQKL-----RTRQAPAATSNGC------LL 110

Query: 129 ISAIRSFEINIDRHCA---IITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLN 185
             ++ SF+   D   A   ++ +S  +       +V  + F         +    + +L+
Sbjct: 111 TLSLDSFDQVFDSPTASHGLVQISASLQQKKSRQIVASRTFQASSPAPTADAAGGVAALS 170

Query: 186 RAFSRISSEIIDWTLSS 202
           +A  ++ +E + W  S 
Sbjct: 171 KASDQLLTEALTWAESQ 187


>gi|239787373|emb|CAX83849.1| ABC-type uncharacterized transport system, auxiliary component
           [uncultured bacterium]
          Length = 196

 Score = 81.6 bits (200), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 30/173 (17%), Positives = 64/173 (36%), Gaps = 4/173 (2%)

Query: 29  CFFHNNPV-NIYDLTESTKYDESVQRHIQLIITEPITEKILNSEDIIVRS--SPIEIQYL 85
           C     P  + Y LT       +      L++     + +     +       P  ++  
Sbjct: 19  CGGAPPPAEHFYRLTTPVVAPSAKPLPGILVVERLRADGVTGERPMAHSRADQPKNLETY 78

Query: 86  IGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFEINIDR-HCA 144
               W++   RM+Q  L+ +  +    S V+     +   + +   +  FE  +      
Sbjct: 79  RYHFWTEAPGRMLQQHLVKSLNDAKAASQVLTDEVKVEGVWLLKGRLLHFEQVLGGQPKV 138

Query: 145 IITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEIID 197
           +I   + ++ A D SLV   ++  EE  + D+    + ++ +AF R+S  I  
Sbjct: 139 VIEADMTLMKAKDYSLVHHGLYREEEPAQGDSPAAAVDAMQKAFERLSQRIAA 191


>gi|254000135|ref|YP_003052198.1| hypothetical protein Msip34_2434 [Methylovorus sp. SIP3-4]
 gi|253986814|gb|ACT51671.1| protein of unknown function DUF330 [Methylovorus sp. SIP3-4]
          Length = 191

 Score = 81.6 bits (200), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 28/197 (14%), Positives = 68/197 (34%), Gaps = 21/197 (10%)

Query: 12  KIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIITEPITEKILNSE 71
            ++  + ++  C SL+     + P   +D       +   +   Q  I    +   LN++
Sbjct: 6   TLLILAGSLSACLSLNGNKPQSGP-QTFDF---GLGEPGERIATQTSIENIRSGDALNNK 61

Query: 72  DIIVR---SSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQI 128
            I  R    +  ++ Y   S+W+     ++  KL        +                +
Sbjct: 62  RIRYRLAYQNAQQVAYYADSRWTAPPAELLTQKL-----RTRQAPAATSNGC------LL 110

Query: 129 ISAIRSFEINIDRHCA---IITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLN 185
             ++ SF+   D   A   ++ +S  +       +V  + F         +    + +L+
Sbjct: 111 TLSLDSFDQVFDSPTASHGLVQISASLQQKKSRQIVASRTFQASSPAPTADAAGGVAALS 170

Query: 186 RAFSRISSEIIDWTLSS 202
           +A  ++ +E + W  S 
Sbjct: 171 KASDQLLTEALTWAESQ 187


>gi|126451562|ref|YP_001064736.1| putative lipoprotein [Burkholderia pseudomallei 1106a]
 gi|217419701|ref|ZP_03451207.1| putative lipoprotein [Burkholderia pseudomallei 576]
 gi|242317856|ref|ZP_04816872.1| putative lipoprotein [Burkholderia pseudomallei 1106b]
 gi|126225204|gb|ABN88744.1| putative lipoprotein [Burkholderia pseudomallei 1106a]
 gi|217397005|gb|EEC37021.1| putative lipoprotein [Burkholderia pseudomallei 576]
 gi|242141095|gb|EES27497.1| putative lipoprotein [Burkholderia pseudomallei 1106b]
          Length = 212

 Score = 81.6 bits (200), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 32/202 (15%), Positives = 71/202 (35%), Gaps = 9/202 (4%)

Query: 1   MDKKLNKIIKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIIT 60
           M   L++  +  +      V+   S  +          YDL  +     S      L + 
Sbjct: 6   MSGSLSRRGRPALALAVALVMASASGCAGTPAALANIRYDLGPAQPAASSGTGP-ALKVL 64

Query: 61  EPITEKILNSEDIIVR---SSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVK 117
           +      LN++  + R   S    I     S+W+    +++  +L      +G+   V+ 
Sbjct: 65  DVSAPDALNTDRFVYRLAYSDAQRIAVYRDSKWTAPPAQLLTQRLRGAL--SGR-GAVLA 121

Query: 118 PNQGIYADYQIISAIRSFEINIDR-HCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDN 176
            + G+ A   +   +  FE   D    +   ++ +     +  ++GQ+ F         +
Sbjct: 122 GDDGVRAPV-LKVELSEFEQVFDGRSESHAAVTARATLTQEGKVLGQRTFVSRAPASTPD 180

Query: 177 KLHFIQSLNRAFSRISSEIIDW 198
                Q+L  A   + S+++ W
Sbjct: 181 AAGGAQALATASDALVSQLVAW 202


>gi|254187924|ref|ZP_04894436.1| putative lipoprotein [Burkholderia pseudomallei Pasteur 52237]
 gi|157935604|gb|EDO91274.1| putative lipoprotein [Burkholderia pseudomallei Pasteur 52237]
          Length = 212

 Score = 81.6 bits (200), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 32/202 (15%), Positives = 71/202 (35%), Gaps = 9/202 (4%)

Query: 1   MDKKLNKIIKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIIT 60
           M   L++  +  +      V+   S  +          YDL  +     S      L + 
Sbjct: 6   MSGSLSRRGRPALALAVALVMASASGCAGTPAALANIRYDLGPAQPAASSGTGP-ALKVL 64

Query: 61  EPITEKILNSEDIIVR---SSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVK 117
           +      LN++  + R   S    I     S+W+    +++  +L      +G+   V+ 
Sbjct: 65  DVSAPDALNTDRFVYRLAYSDAQRIAVYRDSKWTAPPAQLLTQRLRGAL--SGR-GAVLA 121

Query: 118 PNQGIYADYQIISAIRSFEINIDR-HCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDN 176
            + G+ A   +   +  FE   D    +   ++ +     +  ++GQ+ F         +
Sbjct: 122 ADDGVRAPV-LKVELSEFEQVFDGRSESHAAVTARATLTQEGKVLGQRTFVSRAPASTPD 180

Query: 177 KLHFIQSLNRAFSRISSEIIDW 198
                Q+L  A   + S+++ W
Sbjct: 181 AAGGAQALATASDALVSQLVAW 202


>gi|57505621|ref|ZP_00371548.1| probable lipoprotein Cj1649 , putative [Campylobacter upsaliensis
           RM3195]
 gi|57016168|gb|EAL52955.1| probable lipoprotein Cj1649 , putative [Campylobacter upsaliensis
           RM3195]
          Length = 192

 Score = 81.6 bits (200), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 32/145 (22%), Positives = 58/145 (40%), Gaps = 3/145 (2%)

Query: 56  QLIITEPITEKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTV 115
            L I +P     LNS++II     +   Y     W+D      +  L+   E +   + V
Sbjct: 44  TLQILKPKVPLYLNSKEIIYVKKGLSGTY-AYHFWADLPSNFYRFVLLDKLEKSDIFNAV 102

Query: 116 VKPNQGIYADYQIISAIRSFE--INIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLE 173
           V+       D  + S + SFE  I  + + A I++S+ + +  +  ++  + F V   LE
Sbjct: 103 VEKANLTPVDLALKSRLESFEQIITSEGNFAKISLSVTLFDIKEQKILENEFFEVLVVLE 162

Query: 174 KDNKLHFIQSLNRAFSRISSEIIDW 198
                  +    R  + +   II W
Sbjct: 163 DLQMNTLVVGFERGLNELCDRIIAW 187


>gi|53724949|ref|YP_101912.1| lipoprotein [Burkholderia mallei ATCC 23344]
 gi|121598230|ref|YP_991580.1| putative lipoprotein [Burkholderia mallei SAVP1]
 gi|124384124|ref|YP_001027347.1| putative lipoprotein [Burkholderia mallei NCTC 10229]
 gi|126448054|ref|YP_001082715.1| putative lipoprotein [Burkholderia mallei NCTC 10247]
 gi|167004397|ref|ZP_02270155.1| putative lipoprotein [Burkholderia mallei PRL-20]
 gi|238561974|ref|ZP_00441174.2| conserved hypothetical protein [Burkholderia mallei GB8 horse 4]
 gi|254176799|ref|ZP_04883456.1| putative lipoprotein [Burkholderia mallei ATCC 10399]
 gi|254202025|ref|ZP_04908389.1| putative lipoprotein [Burkholderia mallei FMH]
 gi|254207356|ref|ZP_04913707.1| putative lipoprotein [Burkholderia mallei JHU]
 gi|254357613|ref|ZP_04973887.1| putative lipoprotein [Burkholderia mallei 2002721280]
 gi|52428372|gb|AAU48965.1| lipoprotein, putative [Burkholderia mallei ATCC 23344]
 gi|121227040|gb|ABM49558.1| putative lipoprotein [Burkholderia mallei SAVP1]
 gi|124292144|gb|ABN01413.1| putative lipoprotein [Burkholderia mallei NCTC 10229]
 gi|126240924|gb|ABO04017.1| putative lipoprotein [Burkholderia mallei NCTC 10247]
 gi|147747919|gb|EDK54995.1| putative lipoprotein [Burkholderia mallei FMH]
 gi|147752898|gb|EDK59964.1| putative lipoprotein [Burkholderia mallei JHU]
 gi|148026677|gb|EDK84762.1| putative lipoprotein [Burkholderia mallei 2002721280]
 gi|160697840|gb|EDP87810.1| putative lipoprotein [Burkholderia mallei ATCC 10399]
 gi|238523566|gb|EEP87004.1| conserved hypothetical protein [Burkholderia mallei GB8 horse 4]
 gi|243060279|gb|EES42465.1| putative lipoprotein [Burkholderia mallei PRL-20]
          Length = 212

 Score = 81.2 bits (199), Expect = 9e-14,   Method: Composition-based stats.
 Identities = 32/202 (15%), Positives = 71/202 (35%), Gaps = 9/202 (4%)

Query: 1   MDKKLNKIIKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIIT 60
           M   L++  +  +      V+   S  +          YDL  +     S      L + 
Sbjct: 6   MSGSLSRRGRPALALAVALVMASASGCAGTPAALANIRYDLGPAQPAASSGTEP-ALKVL 64

Query: 61  EPITEKILNSEDIIVR---SSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVK 117
           +      LN++  + R   S    I     S+W+    +++  +L      +G+   V+ 
Sbjct: 65  DVSAPDALNTDRFVYRLAYSDAQRIAVYRDSKWTAPPAQLLTQRLRGAL--SGR-GAVLA 121

Query: 118 PNQGIYADYQIISAIRSFEINIDR-HCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDN 176
            + G+ A   +   +  FE   D    +   ++ +     +  ++GQ+ F         +
Sbjct: 122 GDDGVRAPV-LKVELSEFEQVFDGRSESHAAVTARATLTQEGKVLGQRTFVSRAPASTPD 180

Query: 177 KLHFIQSLNRAFSRISSEIIDW 198
                Q+L  A   + S+++ W
Sbjct: 181 AAGGAQALATASDALVSQLVAW 202


>gi|268678741|ref|YP_003303172.1| hypothetical protein Sdel_0099 [Sulfurospirillum deleyianum DSM
           6946]
 gi|268616772|gb|ACZ11137.1| protein of unknown function DUF330 [Sulfurospirillum deleyianum DSM
           6946]
          Length = 198

 Score = 80.8 bits (198), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 29/182 (15%), Positives = 64/182 (35%), Gaps = 10/182 (5%)

Query: 27  SSCFFHN---NPVNIYDLTESTKYDE-SVQRHIQLIITEPITEKILNSEDIIVRSSPIEI 82
           S C F      P N Y L    +    +   +  L I    T   LNS  I  +     I
Sbjct: 15  SGCSFKETTLKPYN-YSLEPMVQLKRFTTHTNDVLKIARIDTPSGLNSRAIQYK-KGGAI 72

Query: 83  QYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFEINIDRH 142
                  WS+     +Q  +    ++     +V+        +  + S +++FE   D +
Sbjct: 73  LPYKYGTWSETPSLKLQHLITEALQDQNHFESVISGTSMASNNLVLESVLQNFEEVFDEN 132

Query: 143 C---AIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHF-IQSLNRAFSRISSEIIDW 198
                 +++ ++++      ++G      ++ +   N     +++ N A + +  E+  W
Sbjct: 133 EKSHVYVSLRVRLVELKSGEVLGSVRLSSKQPVTNTNGAAGTVEAFNLATAEVIQELAVW 192

Query: 199 TL 200
             
Sbjct: 193 IN 194


>gi|254420144|ref|ZP_05033868.1| hypothetical protein BBAL3_2454 [Brevundimonas sp. BAL3]
 gi|196186321|gb|EDX81297.1| hypothetical protein BBAL3_2454 [Brevundimonas sp. BAL3]
          Length = 216

 Score = 80.8 bits (198), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 33/216 (15%), Positives = 73/216 (33%), Gaps = 23/216 (10%)

Query: 8   IIKKKI-ISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDES---VQRHIQLIITEPI 63
           +I+  + +     V++     S     +PV  Y          +       + + I    
Sbjct: 1   MIRSLVQLGAVAGVVVSLGGCSLLSTPDPVQNYRFGLPLDAPSAEGDTPASLSVSIRRIE 60

Query: 64  TEKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFEN-NGKISTVVKPNQGI 122
             +    + I+   +  E  Y+ G++W      +    L A F N   +I  + +   G 
Sbjct: 61  FPEATGDDRIL-GVTGTETAYIGGARWVSPAATLFDDSLKAAFANRADQIRVLGRREPG- 118

Query: 123 YADYQIISAIRSFEINIDRHC----AIITMSLKIINAHDNSLVGQ------------KVF 166
                +   + +FE            +IT   ++ +  +    G             +VF
Sbjct: 119 TPPLVLQVTVTTFEARYAAPGPTPDVVITARAQLRSTPERRTGGDAAIRPEQGRSVERVF 178

Query: 167 HVEEKLEKDNKLHFIQSLNRAFSRISSEIIDWTLSS 202
            V +   ++     + + + A   I+++I DWT+ S
Sbjct: 179 TVTQPAGENRISAIVAAFDTATRDINTQIADWTIQS 214


>gi|167901082|ref|ZP_02488287.1| putative lipoprotein [Burkholderia pseudomallei NCTC 13177]
          Length = 212

 Score = 80.4 bits (197), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 32/202 (15%), Positives = 71/202 (35%), Gaps = 9/202 (4%)

Query: 1   MDKKLNKIIKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIIT 60
           M   L++  +  +      V+   S  +          YDL  +     S      L + 
Sbjct: 6   MSGSLSRRGRPALALAVALVMASASGCAGTPAALANIRYDLGPAQPAASSGTGP-ALKVL 64

Query: 61  EPITEKILNSEDIIVR---SSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVK 117
           +      LN++  + R   S    I     S+W+    +++  +L      +G+   V+ 
Sbjct: 65  DVSAPDALNTDRFVYRLAYSDAQRIAAYRDSKWTAPPAQLLTQRLRGAL--SGR-GAVLA 121

Query: 118 PNQGIYADYQIISAIRSFEINIDR-HCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDN 176
            + G+ A   +   +  FE   D    +   ++ +     +  ++GQ+ F         +
Sbjct: 122 GDDGVRAPV-LKVELSEFEQVFDGRSESHAAVTARATLTQEGKVLGQRTFVSRAPASTPD 180

Query: 177 KLHFIQSLNRAFSRISSEIIDW 198
                Q+L  A   + S+++ W
Sbjct: 181 AAGGAQALATASDALVSQLVAW 202


>gi|76809584|ref|YP_332029.1| hypothetical protein BURPS1710b_0615 [Burkholderia pseudomallei
           1710b]
 gi|134279622|ref|ZP_01766334.1| putative lipoprotein [Burkholderia pseudomallei 305]
 gi|167909302|ref|ZP_02496393.1| putative lipoprotein [Burkholderia pseudomallei 112]
 gi|167917334|ref|ZP_02504425.1| putative lipoprotein [Burkholderia pseudomallei BCC215]
 gi|226193659|ref|ZP_03789262.1| putative lipoprotein [Burkholderia pseudomallei Pakistan 9]
 gi|237810638|ref|YP_002895089.1| hypothetical protein GBP346_A0362 [Burkholderia pseudomallei
           MSHR346]
 gi|254181995|ref|ZP_04888592.1| putative lipoprotein [Burkholderia pseudomallei 1655]
 gi|254259500|ref|ZP_04950554.1| putative lipoprotein [Burkholderia pseudomallei 1710a]
 gi|76579037|gb|ABA48512.1| hypothetical protein BURPS1710b_0615 [Burkholderia pseudomallei
           1710b]
 gi|134248822|gb|EBA48904.1| putative lipoprotein [Burkholderia pseudomallei 305]
 gi|184212533|gb|EDU09576.1| putative lipoprotein [Burkholderia pseudomallei 1655]
 gi|225934237|gb|EEH30221.1| putative lipoprotein [Burkholderia pseudomallei Pakistan 9]
 gi|237502964|gb|ACQ95282.1| conserved hypothetical protein [Burkholderia pseudomallei MSHR346]
 gi|254218189|gb|EET07573.1| putative lipoprotein [Burkholderia pseudomallei 1710a]
          Length = 212

 Score = 80.4 bits (197), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 32/202 (15%), Positives = 71/202 (35%), Gaps = 9/202 (4%)

Query: 1   MDKKLNKIIKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIIT 60
           M   L++  +  +      V+   S  +          YDL  +     S      L + 
Sbjct: 6   MSGSLSRRGRPALALAVALVMASASGCAGTPAALANIRYDLGPAQPAASSGTGP-ALKVL 64

Query: 61  EPITEKILNSEDIIVR---SSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVK 117
           +      LN++  + R   S    I     S+W+    +++  +L      +G+   V+ 
Sbjct: 65  DVSAPDALNTDRFVYRLAYSDAQRIAAYRDSKWTAPPAQLLTQRLRGAL--SGR-GAVLA 121

Query: 118 PNQGIYADYQIISAIRSFEINIDR-HCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDN 176
            + G+ A   +   +  FE   D    +   ++ +     +  ++GQ+ F         +
Sbjct: 122 ADDGVRAPV-LKVELSEFEQVFDGRSESHAAVTARATLTQEGKVLGQRTFVSRAPASTPD 180

Query: 177 KLHFIQSLNRAFSRISSEIIDW 198
                Q+L  A   + S+++ W
Sbjct: 181 AAGGAQALATASDALVSQLVAW 202


>gi|257092690|ref|YP_003166331.1| putative lipoprotein [Candidatus Accumulibacter phosphatis clade
           IIA str. UW-1]
 gi|257045214|gb|ACV34402.1| putative lipoprotein [Candidatus Accumulibacter phosphatis clade
           IIA str. UW-1]
          Length = 206

 Score = 80.0 bits (196), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 30/190 (15%), Positives = 69/190 (36%), Gaps = 16/190 (8%)

Query: 17  SLAVLLCTSLSSCFFHNN---PVNIYDL--TESTKYDESVQRHIQLIITEPITEKILNSE 71
            L   +   L++C        P ++YD         D     ++ L +  P     L  E
Sbjct: 4   LLMAFVACLLAACAGGARKAPPADVYDFGMPVQHLADVGHWSNLALEVKVPYWFDSLAIE 63

Query: 72  DIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISA 131
             ++   P++++   GS+W+     ++  +L            VV        +  +   
Sbjct: 64  YRLLYDDPLKLRSYAGSRWAGAPGLLLAQRLRQQI-------GVVGSGGQTATNCLLRLE 116

Query: 132 IRSFEINIDRH---CAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAF 188
           ++ F    D       ++     ++++  + +VG++   VEE     +    + +L RA 
Sbjct: 117 LQEFSQVFDTPLQSRGLLRGQASLLDSR-HRIVGERRVAVEEPAAGVDARGGVNALVRAS 175

Query: 189 SRISSEIIDW 198
             ++ E+  W
Sbjct: 176 DALAGELAAW 185


>gi|56551911|ref|YP_162750.1| hypothetical protein ZMO1015 [Zymomonas mobilis subsp. mobilis ZM4]
 gi|241761773|ref|ZP_04759859.1| conserved hypothetical protein [Zymomonas mobilis subsp. mobilis
           ATCC 10988]
 gi|260752533|ref|YP_003225426.1| hypothetical protein Za10_0290 [Zymomonas mobilis subsp. mobilis
           NCIMB 11163]
 gi|56543485|gb|AAV89639.1| protein of unknown function DUF330 [Zymomonas mobilis subsp.
           mobilis ZM4]
 gi|241373687|gb|EER63247.1| conserved hypothetical protein [Zymomonas mobilis subsp. mobilis
           ATCC 10988]
 gi|258551896|gb|ACV74842.1| protein of unknown function DUF330 [Zymomonas mobilis subsp.
           mobilis NCIMB 11163]
          Length = 208

 Score = 80.0 bits (196), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 32/179 (17%), Positives = 68/179 (37%), Gaps = 3/179 (1%)

Query: 22  LCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIITEPITEKILNSEDIIVRSSPIE 81
            C +L +     N + +          +  Q    L++  P     L    I V +SP  
Sbjct: 20  GCVNLGNNKPPKNLLTLTSSAAPAANSDLTQNKPLLLVVPPAVPAELKVTRIPVTTSPTT 79

Query: 82  IQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFEINIDR 141
           + YL    W D   R+    L     ++     VV       A Y +   + +F ++   
Sbjct: 80  VAYLTDGVWVDLPSRLFSNILSTTIASHNHFM-VVNYRAATGAAYHLTGNLTAFGLDAAH 138

Query: 142 HCAIITMSLKIINAHDNS--LVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEIIDW 198
           H  +++    +  + D+    V  + F + +  +K + +    +LN A ++++ ++ DW
Sbjct: 139 HQIVVSYDAFLRGSKDHRTETVTSRHFEIRQPAQKQDAVSVANNLNTAANQMAGQVADW 197


>gi|329851289|ref|ZP_08266046.1| hypothetical protein ABI_41300 [Asticcacaulis biprosthecum C19]
 gi|328840135|gb|EGF89707.1| hypothetical protein ABI_41300 [Asticcacaulis biprosthecum C19]
          Length = 225

 Score = 79.2 bits (194), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 32/209 (15%), Positives = 80/209 (38%), Gaps = 13/209 (6%)

Query: 8   IIKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDL-------TESTKYDESVQRHIQLIIT 60
           + +  +   ++     TS  S     +PV +Y           +    + V   + L   
Sbjct: 1   MKRFLLPVLAVTAFGLTSCISLLPKTDPVQMYRFGFDAGLVESALAQQQGVPVSLSL--- 57

Query: 61  EPITEKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQ 120
            P+     ++ D I+     E+ Y+  ++W+     +    + A +  +G    +    +
Sbjct: 58  GPVVFPPGSAGDGIMTVENNEVAYVEKARWAAGARELFTEAVQAGYARSGGNVRLDPRGR 117

Query: 121 GIYADYQIISAIRSFEINI--DRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKL 178
              A Y++  A+R FE      +    + +  +I    D ++V  K    E  + +++  
Sbjct: 118 SAAA-YRLDIAVRGFETRYVRGKPVVSVALDARITRQSDRTVVASKYITREAPVRRNDMS 176

Query: 179 HFIQSLNRAFSRISSEIIDWTLSSLPLSD 207
             ++S N+A +    ++I ++ ++L    
Sbjct: 177 LTVESYNQAVTEAVGDLIGFSQATLSPMA 205


>gi|144898321|emb|CAM75185.1| ABC-type uncharacterized transport system, auxiliary component
           [Magnetospirillum gryphiswaldense MSR-1]
          Length = 194

 Score = 79.2 bits (194), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 30/159 (18%), Positives = 64/159 (40%), Gaps = 2/159 (1%)

Query: 16  CSLAVLLCTSLSSCFFHNNPVN-IYDL-TESTKYDESVQRHIQLIITEPITEKILNSEDI 73
            SL   L  +L++C     P +  Y L T       +      + ++ P T+ +L+   +
Sbjct: 4   LSLIAALAVTLAACAQQAPPKDRFYRLETPPVAARFAAPSLGVIEVSRPTTDGVLSERPL 63

Query: 74  IVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIR 133
             +     +       W++    ++Q  L+ +   +G   TV+ P   +  D+ I   + 
Sbjct: 64  AYQDGDGTLGRYRYDLWAEPPTALLQNALVDSLRLSGISHTVITPETRVPPDWMIRGRLN 123

Query: 134 SFEINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKL 172
            FE+       +  + L ++++ D SL+  K + VE   
Sbjct: 124 RFEMLAGAGKVVANVELAVVSSRDGSLLLLKTYQVEVPS 162


>gi|167736874|ref|ZP_02409648.1| putative lipoprotein [Burkholderia pseudomallei 14]
          Length = 201

 Score = 79.2 bits (194), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 31/201 (15%), Positives = 71/201 (35%), Gaps = 9/201 (4%)

Query: 1   MDKKLNKIIKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIIT 60
           M   L++  +  +      V+   S  +          YDL  +     S      L + 
Sbjct: 6   MSGSLSRRGRPALALAVALVMASASGCAGTPAALANIRYDLGPAQPAASSGTGP-ALKVL 64

Query: 61  EPITEKILNSEDIIVR---SSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVK 117
           +      LN++  + R   S    I     S+W+    +++  +L      +G+   V+ 
Sbjct: 65  DVSAPDALNTDRFVYRLAYSDAQRIAVYRDSKWTAPPAQLLTQRLRGAL--SGR-GAVLA 121

Query: 118 PNQGIYADYQIISAIRSFEINIDR-HCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDN 176
            + G+ A   +   +  FE   D    +   ++ ++    +  ++GQ+ F         +
Sbjct: 122 GDDGVRAPV-LKVELSEFEQVFDGRSESHAAVTARVTLTQEGKVLGQRTFVSRAPASTPD 180

Query: 177 KLHFIQSLNRAFSRISSEIID 197
                Q+L  A   + S+++ 
Sbjct: 181 AAGGAQALATASDALVSQLVA 201


>gi|53718044|ref|YP_107030.1| putative lipoprotein [Burkholderia pseudomallei K96243]
 gi|52208458|emb|CAH34392.1| putative lipoprotein [Burkholderia pseudomallei K96243]
          Length = 207

 Score = 78.5 bits (192), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 32/202 (15%), Positives = 71/202 (35%), Gaps = 9/202 (4%)

Query: 1   MDKKLNKIIKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIIT 60
           M   L++  +  +      V+   S  +          YDL  +     S      L + 
Sbjct: 1   MSGSLSRRGRPALALAVALVMASASGCAGTPAALANIRYDLGPAQPAASSGTGP-ALKVL 59

Query: 61  EPITEKILNSEDIIVR---SSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVK 117
           +      LN++  + R   S    I     S+W+    +++  +L      +G+   V+ 
Sbjct: 60  DVSAPDALNTDRFVYRLAYSDAQRIAAYRDSKWTAPPAQLLTQRLRGAL--SGR-GAVLA 116

Query: 118 PNQGIYADYQIISAIRSFEINIDR-HCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDN 176
            + G+ A   +   +  FE   D    +   ++ +     +  ++GQ+ F         +
Sbjct: 117 ADDGVRAPV-LKVELSEFEQVFDGRSESHAAVTARATLTQEGKVLGQRTFVSRAPASTPD 175

Query: 177 KLHFIQSLNRAFSRISSEIIDW 198
                Q+L  A   + S+++ W
Sbjct: 176 AAGGAQALATASDALVSQLVAW 197


>gi|325982946|ref|YP_004295348.1| hypothetical protein NAL212_2365 [Nitrosomonas sp. AL212]
 gi|325532465|gb|ADZ27186.1| protein of unknown function DUF330 [Nitrosomonas sp. AL212]
          Length = 208

 Score = 78.5 bits (192), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 30/196 (15%), Positives = 72/196 (36%), Gaps = 21/196 (10%)

Query: 25  SLSSCFFHNNPVNIYD-----LTESTKYDESVQRHI-QLIITEPITEKILNSEDIIVRS- 77
           S +        ++ Y      L+   +       H   L+I +      L++  I  R  
Sbjct: 16  SCTGLHKRQPAISTYTFGMQHLSPIEQIPNQPYLHRKSLLIADAAAPSWLDNTAIHYRLI 75

Query: 78  --SPIEIQYLIGSQWSDKLPRMI----QLKLIANFENNGKISTVVKPNQGIYADYQIISA 131
             +P +      S+W      ++    + +++           V++ +  + ADY +   
Sbjct: 76  YHNPAQSYTYANSRWISTPATLLTQQIRHRIV-----TSTPEQVIRDSGIVKADYTLHIE 130

Query: 132 IRSFEI---NIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAF 188
           +  F       D    ++++ + +I  +   L  QK F   E     +    + +L+ A 
Sbjct: 131 LNEFIQLFDTTDSSHVVVSIRVSLIEHNSRKLFAQKDFSTIESTPSADAAGAVFALSSAS 190

Query: 189 SRISSEIIDWTLSSLP 204
           +++ +E+++W    LP
Sbjct: 191 NKLINELVNWLTVELP 206


>gi|83720907|ref|YP_440934.1| hypothetical protein BTH_I0376 [Burkholderia thailandensis E264]
 gi|83654732|gb|ABC38795.1| hypothetical protein BTH_I0376 [Burkholderia thailandensis E264]
          Length = 210

 Score = 78.1 bits (191), Expect = 7e-13,   Method: Composition-based stats.
 Identities = 29/193 (15%), Positives = 64/193 (33%), Gaps = 9/193 (4%)

Query: 10  KKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIITEPITEKILN 69
           + +        L   S  +          YDL        S      L + +      LN
Sbjct: 13  RGRAALALAVALAIASGCAGTPAALTNIRYDLGPVRPAASSGTGP-ALKVLDVSAPDALN 71

Query: 70  SEDIIVRS---SPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADY 126
           ++  + R        I     S+W+    +++  +L      +G+   V++ + G+ A  
Sbjct: 72  TDRFVYRLAYADAQRISVYRDSKWTAPPAQLLTQRLRGAL--SGR-GAVLEGDDGVRAPV 128

Query: 127 QIISAIRSFEINIDR-HCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLN 185
            +   +  FE   D    +   ++ +     D  ++GQ+ F         +     Q+L 
Sbjct: 129 -LKVELSEFEQVFDGRSQSHAAVTARATLTQDGKVLGQRTFVSRAPASTPDAAGGAQALA 187

Query: 186 RAFSRISSEIIDW 198
            A     ++++ W
Sbjct: 188 TASDEFVAQLVAW 200


>gi|114330426|ref|YP_746648.1| putative lipoprotein [Nitrosomonas eutropha C91]
 gi|114307440|gb|ABI58683.1| putative lipoprotein [Nitrosomonas eutropha C91]
          Length = 200

 Score = 77.7 bits (190), Expect = 8e-13,   Method: Composition-based stats.
 Identities = 26/190 (13%), Positives = 62/190 (32%), Gaps = 14/190 (7%)

Query: 20  VLLCTSLSSCFFHNNP---VNIYDLTESTKYDESVQRHIQ--LIITEPITEKILNSEDII 74
            LL   L+ C         V++YDL   +          Q  + I +      L+++ I 
Sbjct: 8   ALLAILLTGCTLTPKAPSSVSVYDLGPPSAITLGSSLSSQATIQIIDIAAPVWLDTQSIH 67

Query: 75  VRS---SPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISA 131
            R     P  I     S+W+     ++  +    F   G I    K +  +  +Y +   
Sbjct: 68  YRLAYHDPARIYTYADSRWNAPPAELLTERFRQYF-ATGNIDRHHKDDTPV--NYLLKID 124

Query: 132 IRSFEI---NIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAF 188
           +  F            ++ +   +        +  + F   ++ +  +    + +  +  
Sbjct: 125 LGEFTQIFNTPGNSQVVVQLRASLYEPTSRLPIAHQHFLGRQETQTADAAGAVTAFIQVS 184

Query: 189 SRISSEIIDW 198
             + +E++ W
Sbjct: 185 DNLLNELVQW 194


>gi|167561349|ref|ZP_02354265.1| hypothetical protein BoklE_02229 [Burkholderia oklahomensis EO147]
 gi|167568581|ref|ZP_02361455.1| hypothetical protein BoklC_01974 [Burkholderia oklahomensis C6786]
          Length = 212

 Score = 77.3 bits (189), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 28/202 (13%), Positives = 64/202 (31%), Gaps = 9/202 (4%)

Query: 1   MDKKLNKIIKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIIT 60
           M     +  +  +       +   +  +          YDL  +     +      L + 
Sbjct: 6   MSGPFFRRSRPALALAVALAIAGLNGCAGTPAALSNIRYDLGPAQPSASAGAGP-ALKVL 64

Query: 61  EPITEKILNSEDIIVRS---SPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVK 117
           +      LNS+  + R        I     S+W+    +++  +L       G    V++
Sbjct: 65  DVSAPDALNSDRFVYRLAYADAQRIAMYRDSKWTAPPAQLLTQRLRGALSRRG---AVLE 121

Query: 118 PNQGIYADYQIISAIRSFEINIDR-HCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDN 176
               + A   +   +  FE   D    +   ++ +     D  ++GQ+ F         +
Sbjct: 122 GEDSVRAPV-LKVELSEFEQVFDGRSQSHAAVTARATLTQDGKVLGQRTFVSRAPASTPD 180

Query: 177 KLHFIQSLNRAFSRISSEIIDW 198
                Q+L  A   + S+++ W
Sbjct: 181 AAGGAQALATASDELVSQLVAW 202


>gi|197105494|ref|YP_002130871.1| hypothetical protein PHZ_c2031 [Phenylobacterium zucineum HLK1]
 gi|196478914|gb|ACG78442.1| conserved hypothetical protein [Phenylobacterium zucineum HLK1]
          Length = 211

 Score = 77.3 bits (189), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 19/144 (13%), Positives = 56/144 (38%), Gaps = 8/144 (5%)

Query: 69  NSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQI 128
             + I+   +  ++ Y+  ++W      +    + A F+ +     ++   +   A Y +
Sbjct: 71  AGDRIL-TVTGGKVAYIAETRWVAPASTLFNQAVTAAFDASPGPVRLIPRGEPAPAQYVL 129

Query: 129 ISAIRSFEINIDRHC-----AIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQS 183
              +R+FE + DR        ++ +   +    + S    ++F  + +   +     +++
Sbjct: 130 RLDVRNFETHYDRGGKAAPMVLVRVRAALARGGEGST--DRLFEAQVRASGNRVSSIVEA 187

Query: 184 LNRAFSRISSEIIDWTLSSLPLSD 207
            + A + +  EI  WT   +  + 
Sbjct: 188 YDEAVAEVLGEITAWTNGQVSPAA 211


>gi|87200855|ref|YP_498112.1| hypothetical protein Saro_2842 [Novosphingobium aromaticivorans DSM
           12444]
 gi|87136536|gb|ABD27278.1| conserved hypothetical protein [Novosphingobium aromaticivorans DSM
           12444]
          Length = 190

 Score = 77.3 bits (189), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 25/145 (17%), Positives = 53/145 (36%), Gaps = 5/145 (3%)

Query: 56  QLIITEPITEKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTV 115
            L++ EP  E+ L    + V+     + YL  + W ++  R+ Q  L       G  + +
Sbjct: 51  ALVVLEPTAEQRLAVTRVPVQIDDANVAYLKKTMWVERPSRLFQRLLAETIRARG--NRL 108

Query: 116 VKPNQGIYADYQIISAIRSFEINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKD 175
           V  N    +  Q+   +     +     A++      I      +   + F     +   
Sbjct: 109 VIENDPGASGTQLSGRLLDMGYDARTRMAVVRYDA--IRETAGRVE-TRRFESTVPVTDA 165

Query: 176 NKLHFIQSLNRAFSRISSEIIDWTL 200
              +   +LN A + ++S++ DW  
Sbjct: 166 EAKYVGPALNEAANAVASQVADWVA 190


>gi|303256380|ref|ZP_07342394.1| conserved hypothetical protein [Burkholderiales bacterium 1_1_47]
 gi|302859871|gb|EFL82948.1| conserved hypothetical protein [Burkholderiales bacterium 1_1_47]
          Length = 201

 Score = 76.9 bits (188), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 28/176 (15%), Positives = 62/176 (35%), Gaps = 5/176 (2%)

Query: 27  SSCFFHNNPVNIYDLTE---STKYDESVQRHIQLIITEPITEKILNSEDIIVRSSPIEIQ 83
            S      P+ +Y L     +       +R   + I  P+     +S    V +    I 
Sbjct: 17  CSILPERPPLKLYTLLANLNTQDCRAPKRRLSSVRINSPMIASPYDSTRCYVLTKDNRIY 76

Query: 84  YLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFEINIDRHC 143
               +++S     +I   L    ++ G  + V+ PN      YQ+   +  F IN  +  
Sbjct: 77  NTDINRFSSNPGNLIGDGLREVIQDCGPWNVVLSPNSISTPAYQLTVFVSKFFINAVKKP 136

Query: 144 --AIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEIID 197
             A++ M + ++ +    LV  + +   +    D+    + + +     I   + +
Sbjct: 137 FAAVVEMEVSVVASVSGKLVFHETYSQTQNTPTDDMPGAVSAFDVCLENIFKTLTN 192


>gi|315635508|ref|ZP_07890774.1| conserved hypothetical protein [Arcobacter butzleri JV22]
 gi|315480266|gb|EFU70933.1| conserved hypothetical protein [Arcobacter butzleri JV22]
          Length = 192

 Score = 76.5 bits (187), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 34/186 (18%), Positives = 73/186 (39%), Gaps = 6/186 (3%)

Query: 16  CSLAVLLCTSLSSCFFHNNPVNI--YDLTESTKYDESVQRHIQLIITEPITEKILNSEDI 73
             L + +    + C F    ++I  Y +   T+      +   + I EP   +  N   I
Sbjct: 4   SILILTIFLLFTGCTFKQQRIDINHYSIDFKTQKISQNAKLSSIFIEEPNVNRSFNLTSI 63

Query: 74  IVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIR 133
              + P   +    ++W +    MI  +LI +F  +   S V+  +  I   Y + + I 
Sbjct: 64  YYNTKPYLFEEYAKNKWINLPSNMIYNQLIDSFIASNIFSNVISKDSKIEHRYTLRTDII 123

Query: 134 SF--EINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRI 191
               E   D+  AI+ +   +I   D  ++    F      E ++   F+++LN+     
Sbjct: 124 KLYHEFKEDKSYAILKIKFDLI--EDKKVIKTISFDKNVLCETNDAYGFVKALNKGLEES 181

Query: 192 SSEIID 197
           ++ +++
Sbjct: 182 TNSLLN 187


>gi|167579647|ref|ZP_02372521.1| hypothetical protein BthaT_15964 [Burkholderia thailandensis TXDOH]
 gi|167617725|ref|ZP_02386356.1| hypothetical protein BthaB_15559 [Burkholderia thailandensis Bt4]
 gi|257140411|ref|ZP_05588673.1| hypothetical protein BthaA_14575 [Burkholderia thailandensis E264]
          Length = 201

 Score = 76.2 bits (186), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 29/193 (15%), Positives = 64/193 (33%), Gaps = 9/193 (4%)

Query: 10  KKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIITEPITEKILN 69
           + +        L   S  +          YDL        S      L + +      LN
Sbjct: 4   RGRAALALAVALAIASGCAGTPAALTNIRYDLGPVRPAASSGTGP-ALKVLDVSAPDALN 62

Query: 70  SEDIIVRS---SPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADY 126
           ++  + R        I     S+W+    +++  +L      +G+   V++ + G+ A  
Sbjct: 63  TDRFVYRLAYADAQRISVYRDSKWTAPPAQLLTQRLRGAL--SGR-GAVLEGDDGVRAPV 119

Query: 127 QIISAIRSFEINIDR-HCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLN 185
            +   +  FE   D    +   ++ +     D  ++GQ+ F         +     Q+L 
Sbjct: 120 -LKVELSEFEQVFDGRSQSHAAVTARATLTQDGKVLGQRTFVSRAPASTPDAAGGAQALA 178

Query: 186 RAFSRISSEIIDW 198
            A     ++++ W
Sbjct: 179 TASDEFVAQLVAW 191


>gi|83748497|ref|ZP_00945518.1| Transcriptional regulator [Ralstonia solanacearum UW551]
 gi|207742157|ref|YP_002258549.1| cog3218, abc-type uncharacterized transport system, auxiliary
           component protein [Ralstonia solanacearum IPO1609]
 gi|83724801|gb|EAP71958.1| Transcriptional regulator [Ralstonia solanacearum UW551]
 gi|206593545|emb|CAQ60472.1| cog3218, abc-type uncharacterized transport system, auxiliary
           component protein [Ralstonia solanacearum IPO1609]
          Length = 211

 Score = 75.8 bits (185), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 35/208 (16%), Positives = 71/208 (34%), Gaps = 15/208 (7%)

Query: 8   IIKKKIISCSLAVLLCTSLSSCF-FHNNPVNIYDLTESTKYDESVQRHIQLIITEPITEK 66
           +I + +   +L +     L+ C    + P  +YD   +       +    L +TE +   
Sbjct: 2   LILQTVFRRALVLSAVAVLAGCSSTPSAPTAVYDFGLAPAAVGGPRLPTALRVTEVVGPG 61

Query: 67  ILNSEDIIVRS---SPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIY 123
            ++   I  R         +    S+W +    +   +L       G++     P     
Sbjct: 62  WMDGSAIYYRLAYAQGQRTELYANSRWVESPVNLFDARLRNAVAARGQVVGYGLPEVP-- 119

Query: 124 ADYQIISAIRSFEINIDRHCA---IITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHF 180
               +   +  F    DR  A   ++ +   +  A    LV Q+V   +      +    
Sbjct: 120 ---TLRIELVDFSQVFDRPDASRGVVRLRASVFMARG--LVAQRVVQADVPAPSADAAGG 174

Query: 181 IQSLNRAFSRISSEIIDWTLS-SLPLSD 207
           + +L +A  R   E++DW    SLP + 
Sbjct: 175 VSALAQASDRAIGEVLDWVAGLSLPAAA 202


>gi|103485971|ref|YP_615532.1| hypothetical protein Sala_0478 [Sphingopyxis alaskensis RB2256]
 gi|98976048|gb|ABF52199.1| conserved hypothetical protein [Sphingopyxis alaskensis RB2256]
          Length = 199

 Score = 75.8 bits (185), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 27/142 (19%), Positives = 60/142 (42%), Gaps = 4/142 (2%)

Query: 59  ITEPITEKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKP 118
           I  P   + L +  I V+     I Y+  +QW +   R+ Q +L++          V+  
Sbjct: 57  ILIPTAPQKLRTTRIPVQQDDASIAYVQDAQWVEAPQRLFQ-RLVSETVAARTSRVVLDE 115

Query: 119 NQGIYAD-YQIISAIRSFEINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNK 177
            Q + A   Q+   +  F ++   + A++     ++ +     V Q+ F   E +    +
Sbjct: 116 GQYLTAPGEQLAGQLMEFGVDARSNEALVVYQAMLV-SAGGKTVTQRRFETREPIGGKVE 174

Query: 178 LHFI-QSLNRAFSRISSEIIDW 198
              + ++L RA +R++ ++  W
Sbjct: 175 AKPVGEALTRAANRVALDVAAW 196


>gi|198283900|ref|YP_002220221.1| hypothetical protein Lferr_1793 [Acidithiobacillus ferrooxidans
           ATCC 53993]
 gi|218668139|ref|YP_002426534.1| lipoprotein, putative [Acidithiobacillus ferrooxidans ATCC 23270]
 gi|198248421|gb|ACH84014.1| conserved hypothetical protein [Acidithiobacillus ferrooxidans ATCC
           53993]
 gi|218520352|gb|ACK80938.1| lipoprotein, putative [Acidithiobacillus ferrooxidans ATCC 23270]
          Length = 221

 Score = 75.8 bits (185), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 28/187 (14%), Positives = 65/187 (34%), Gaps = 11/187 (5%)

Query: 27  SSCFFHNNPVNIYDLTESTKYDESVQRHIQ-----LIITEPITEKILNSEDI---IVRSS 78
           + C    +    YD+T       +           L +      + L +++    ++   
Sbjct: 25  TGCATSVSWQAPYDITPPHPAPLASTTRSTATLPVLRLGPVSAVQWLETDNYQYHLLYQD 84

Query: 79  PIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFEIN 138
              +     ++W    P+MI  +L    E +G+   V+ P     + + +   +  F +N
Sbjct: 85  QQRLLAYRDARWIGTPPQMIASRLQRQLEESGQWRAVLTPLSRGRSVWLLQVRLTDFVVN 144

Query: 139 IDRH---CAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEI 195
                   A++  +  ++   D  ++ Q+ F   E L   +     +++  A SR    I
Sbjct: 145 FSGPDAGAALVAGTATLVKTADYQVIAQRHFSFTEMLPSASAQGGAKAMATASSRFVRAI 204

Query: 196 IDWTLSS 202
             W   +
Sbjct: 205 SSWAAQT 211


>gi|207727756|ref|YP_002256150.1| cog3218, abc-type uncharacterized transport system, auxiliary
           component protein [Ralstonia solanacearum MolK2]
 gi|206590997|emb|CAQ56609.1| cog3218, abc-type uncharacterized transport system, auxiliary
           component protein [Ralstonia solanacearum MolK2]
          Length = 211

 Score = 75.0 bits (183), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 34/208 (16%), Positives = 71/208 (34%), Gaps = 15/208 (7%)

Query: 8   IIKKKIISCSLAVLLCTSLSSCF-FHNNPVNIYDLTESTKYDESVQRHIQLIITEPITEK 66
           +I + +   +L +     L++C    + P  +YD   +       +    L + E +   
Sbjct: 2   LILQTVFRRALVLSAVAVLAACSSTPSAPSAVYDFGLAPAAVGGPRLPTALRVAEVVGPG 61

Query: 67  ILNSEDIIVRS---SPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIY 123
            ++   I  R         +    S+W +    +   +L       G++     P     
Sbjct: 62  WMDGSAIYYRLAYAQGQRTELYANSRWVESPVNLFDARLRNAVAARGQVVGYGLPEVP-- 119

Query: 124 ADYQIISAIRSFEINIDRHCA---IITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHF 180
               +   +  F    DR  A   ++ +   +  A    LV Q+V   +      +    
Sbjct: 120 ---TLRIELVDFSQVFDRPDASRGVVRLRASVFMARG--LVAQRVVQADVPAPSADAAGG 174

Query: 181 IQSLNRAFSRISSEIIDWTLS-SLPLSD 207
           + +L +A  R   E++DW    SLP + 
Sbjct: 175 VSALAQASDRAIGEVLDWVAGLSLPAAA 202


>gi|254292869|ref|YP_003058892.1| hypothetical protein Hbal_0493 [Hirschia baltica ATCC 49814]
 gi|254041400|gb|ACT58195.1| hypothetical protein Hbal_0493 [Hirschia baltica ATCC 49814]
          Length = 255

 Score = 75.0 bits (183), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 32/190 (16%), Positives = 70/190 (36%), Gaps = 2/190 (1%)

Query: 13  IISCSLAVLLCTSLSSCFFHNN-PVNIYDLTESTKYDESVQRHIQLIITEPITEKILNSE 71
           ++   L  +      S       P  +  L  S     S   +  +++  P     ++  
Sbjct: 11  VLPLILVGMGLGGCVSVLPEPKQPDALVRLPTSGMRGASSPLNTNIVVHIPDAMGAISGA 70

Query: 72  DIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISA 131
           +I   S    IQY+   +W+D   R+ Q  ++     +      V    G   +Y +  +
Sbjct: 71  EIA-ASDNQRIQYINDVRWADSPARLFQAAVVDALTVSEGDGLAVPVQVGARGEYDLRLS 129

Query: 132 IRSFEINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRI 191
           I    ++ ++  A+  + + +  + D S++   V    E LE    +   ++L RA S  
Sbjct: 130 ILDLTVDNEKEEAVCKVRVVLTRSGDKSIIASDVLQAVELLENKKSVDRAEALARAISNA 189

Query: 192 SSEIIDWTLS 201
           +    D+  +
Sbjct: 190 AEITADFVAT 199


>gi|157736376|ref|YP_001489059.1| hypothetical protein Abu_0105 [Arcobacter butzleri RM4018]
 gi|157698230|gb|ABV66390.1| hypothetical protein Abu_0105 [Arcobacter butzleri RM4018]
          Length = 192

 Score = 75.0 bits (183), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 33/186 (17%), Positives = 72/186 (38%), Gaps = 6/186 (3%)

Query: 16  CSLAVLLCTSLSSCFFHNNPVNI--YDLTESTKYDESVQRHIQLIITEPITEKILNSEDI 73
             L + +    + C F    ++I  Y +   T+      +   + I EP   +  N   I
Sbjct: 4   SILILTIFLLFTGCTFKQQRIDINHYSIDFKTQKISQNAKLSSIFIEEPNVNRSFNLTSI 63

Query: 74  IVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIR 133
              + P   +    ++W +    MI  +LI +F  +   S V+  +  I   Y + + I 
Sbjct: 64  YYNTKPYLFEEYAKNKWINLPSNMIYNQLIDSFIASNIFSNVISKDSKIEHKYTLKTDII 123

Query: 134 SF--EINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRI 191
               E   D+  AI+ +   +I   D  ++    F        ++   F+++LN+     
Sbjct: 124 KLYHEFKEDKSYAILKIKFDLI--EDKKVIKTISFDKNVLCVTNDAYGFVKALNKGLEES 181

Query: 192 SSEIID 197
           ++ +++
Sbjct: 182 TNSLLN 187


>gi|158521031|ref|YP_001528901.1| ABC-type transport system auxiliary component-like protein
           [Desulfococcus oleovorans Hxd3]
 gi|158509857|gb|ABW66824.1| ABC-type transport system auxiliary component-like protein
           [Desulfococcus oleovorans Hxd3]
          Length = 215

 Score = 74.2 bits (181), Expect = 9e-12,   Method: Composition-based stats.
 Identities = 31/189 (16%), Positives = 67/189 (35%), Gaps = 6/189 (3%)

Query: 15  SCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDES-VQRHIQLIITEPITEKILNSEDI 73
           + +L    C +LSS          Y L                + +     + +  +  +
Sbjct: 16  ALTLVAAGCINLSSLTQPPIQTAYYILEYDPPAPTGSKPSAPAIRVDRFSADPLYATTAM 75

Query: 74  IVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIR 133
           I +  P +    +  +W      M+   L  +   +G  + V  P     A Y I   + 
Sbjct: 76  IYKKQPFQTDAYVYHRWHTAPADMVSHLLARDLRRSGNFAAVFGPAAPASAAYDIKGHVE 135

Query: 134 SF--EINIDRHCAIITMSLKII---NAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAF 188
            F      D   A + +++ +       ++++V QK +       +++   F ++++RA 
Sbjct: 136 IFLENDTADPWQAELLLTVTVTGPPGTGNSAVVLQKSYQASAPCVRNHPRAFAEAMSRAM 195

Query: 189 SRISSEIID 197
             +S EII 
Sbjct: 196 QLLSEEIIA 204


>gi|78067709|ref|YP_370478.1| ABC-type uncharacterized transport system auxiliary component-like
           [Burkholderia sp. 383]
 gi|77968454|gb|ABB09834.1| ABC-type uncharacterized transport system auxiliary component-like
           protein [Burkholderia sp. 383]
          Length = 207

 Score = 74.2 bits (181), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 28/165 (16%), Positives = 61/165 (36%), Gaps = 9/165 (5%)

Query: 39  YDLTESTKYDESVQRHIQLIITEPITEKILNSEDIIVR---SSPIEIQYLIGSQWSDKLP 95
           YDL  +T    +      L + +      L+S+    R        +     S+W+    
Sbjct: 39  YDLGPATSVVTAGPGP-ALKVLDVAAPDALDSDKFAYRLAYVDAQHVAVYRDSRWTAPPA 97

Query: 96  RMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFEINIDRH-CAIITMSLKIIN 154
           +++  +L     + G   TV++ + G+ A   +   +  FE   D    +   ++ +   
Sbjct: 98  QLLTQRLRGALSSRG---TVLEGSDGVRAP-TLKVDLNEFEQVFDGQSQSHGAVTARATL 153

Query: 155 AHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEIIDWT 199
             D  ++GQ+ F         +     ++L  A  ++ S+I  W 
Sbjct: 154 TLDGKVLGQRTFVARAPSSTPDAAGGARALATASDQLVSQIAAWV 198


>gi|83309428|ref|YP_419692.1| ABC transporter [Magnetospirillum magneticum AMB-1]
 gi|82944269|dbj|BAE49133.1| ABC-type uncharacterized transport system [Magnetospirillum
           magneticum AMB-1]
          Length = 197

 Score = 73.8 bits (180), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 26/156 (16%), Positives = 56/156 (35%), Gaps = 3/156 (1%)

Query: 40  DLTESTKYDESVQRHIQLIITEPITEKILNSEDIIV--RSSPIEIQYLIGSQWSDKLPRM 97
           ++    +          L I   +    + +E  +   R+    + +     WS+    +
Sbjct: 32  EVAAPAQRLPRPVLPGVLEINR-LASDGVAAERALAFSRTEGGALAHYKYDFWSEPPGLL 90

Query: 98  IQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFEINIDRHCAIITMSLKIINAHD 157
           +Q +L       G    VV P   + AD+ +   +R FE   DR  A++ + L ++ A D
Sbjct: 91  LQDRLAHYLAAAGIADKVVTPELRVLADWVLRGKVRRFEQIADRAEAVVDLELAVVRARD 150

Query: 158 NSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISS 193
             LV  + +     +          ++ +  + I  
Sbjct: 151 GRLVLLETYTARVPVSSARVEDAALAMEKGVADIFG 186


>gi|300705332|ref|YP_003746935.1| hypothetical protein RCFBP_21175 [Ralstonia solanacearum CFBP2957]
 gi|299072996|emb|CBJ44353.1| conserved exported protein of unknown function [Ralstonia
           solanacearum CFBP2957]
          Length = 211

 Score = 73.8 bits (180), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 35/208 (16%), Positives = 70/208 (33%), Gaps = 15/208 (7%)

Query: 8   IIKKKIISCSLAVLLCTSLSSCF-FHNNPVNIYDLTESTKYDESVQRHIQLIITEPITEK 66
           +I   +    L +    +L +C    + P  +YD   +       +    L +TE +   
Sbjct: 2   LILPTVFRRVLVLSTVAALVACSSTPSAPSAVYDFGLAPAAVGGPRLLTALRVTEVVGPG 61

Query: 67  ILNSEDIIVRS---SPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIY 123
            ++   I  R         +    S+W +    +   +L       G++     P     
Sbjct: 62  WMDGNAIYYRLAYAQGQRTELYANSRWVESPVNLFDARLRNAVAARGQVVGYGLPEVP-- 119

Query: 124 ADYQIISAIRSFEINIDRHCA---IITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHF 180
               +   +  F    DR  A   ++ +   +  A    LV Q+V   +      +    
Sbjct: 120 ---TLRIELVDFSQVFDRPDASRGVVRLRASVFMARG--LVAQRVVQADVPAPSADAAGG 174

Query: 181 IQSLNRAFSRISSEIIDWTLS-SLPLSD 207
           + +L +A  R   E++DW    SLP + 
Sbjct: 175 VSALAQASDRAIGEVLDWVAGLSLPAAA 202


>gi|115352998|ref|YP_774837.1| ABC transporter auxiliary component-like protein [Burkholderia
           ambifaria AMMD]
 gi|115282986|gb|ABI88503.1| ABC-type uncharacterized transport system auxiliary component-like
           protein [Burkholderia ambifaria AMMD]
          Length = 238

 Score = 73.8 bits (180), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 28/203 (13%), Positives = 73/203 (35%), Gaps = 9/203 (4%)

Query: 1   MDKKLNKIIKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIIT 60
           M + L++ ++    + ++ +L   +  +          YDL  +     +      L + 
Sbjct: 32  MPRILDRALRPAATTLAILMLAFAAGCAGNGTALSNVRYDLGPAASVVTAGTGP-ALKVL 90

Query: 61  EPITEKILNSEDIIVRSS---PIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVK 117
           +      L+++  + R +            S+W+    +++  +L     + G    V++
Sbjct: 91  DVAAPDALDTDKFVYRLTYADAQRTAVYRDSRWTAPPAQLLTQRLRGALSSRG---AVLE 147

Query: 118 PNQGIYADYQIISAIRSFEINIDRH-CAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDN 176
            + G+ A   +   +  FE   D    +   ++ +     D  ++GQ+ F         +
Sbjct: 148 GSDGVRAP-TLKVDLNEFEQVFDGESQSHGAVTARATLMQDGKVLGQRTFVARAPSSTPD 206

Query: 177 KLHFIQSLNRAFSRISSEIIDWT 199
                ++L  A   + S+I  W 
Sbjct: 207 AAGGARALAAASDELVSQIAAWV 229


>gi|189351644|ref|YP_001947272.1| ABC-type uncharacterized transporter auxiliary component-like
           protein [Burkholderia multivorans ATCC 17616]
 gi|189335666|dbj|BAG44736.1| ABC-type uncharacterized transport system auxiliary component-like
           protein [Burkholderia multivorans ATCC 17616]
          Length = 212

 Score = 73.5 bits (179), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 29/203 (14%), Positives = 71/203 (34%), Gaps = 9/203 (4%)

Query: 1   MDKKLNKIIKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIIT 60
           M + L++ ++    + ++  L+  +  +          YDL  +T           L + 
Sbjct: 6   MSRLLDRALRPAATALAVLTLVLAAGCAADRAVLSNIRYDLGPATPVGTVGSGP-ALKVL 64

Query: 61  EPITEKILNSEDIIVRS---SPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVK 117
           +    +  +S+  + R        +     S+W     +++  +L       G    V++
Sbjct: 65  DVSAPEAFDSDKFVYRLAYADAQRMAVYRDSRWIAPPAQLLTQRLRGALSARG---AVLE 121

Query: 118 PNQGIYADYQIISAIRSFEINIDRH-CAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDN 176
            + G+ A   +   +  FE   D    +   ++ +     D  ++GQ+ F         +
Sbjct: 122 GSDGVRAP-TLKVDLSEFEQVFDGQSQSHGAVTARATLMQDGKVLGQRTFVARAPSSTPD 180

Query: 177 KLHFIQSLNRAFSRISSEIIDWT 199
                ++L  A   + S+I  W 
Sbjct: 181 AAGGARALAAASDELVSQIAAWV 203


>gi|30249904|ref|NP_841974.1| putative lipoprotein [Nitrosomonas europaea ATCC 19718]
 gi|30180941|emb|CAD85867.1| putative lipoprotein [Nitrosomonas europaea ATCC 19718]
          Length = 205

 Score = 73.1 bits (178), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 33/195 (16%), Positives = 66/195 (33%), Gaps = 16/195 (8%)

Query: 19  AVLLCTSLSSCFFHNN---PVNIYDLTESTKYDESVQRHIQ---LIITEPITEKILNSED 72
           AV L   L+ C        PV+IYDL  +T    +    +    + + +      L+++ 
Sbjct: 6   AVFLAVLLTGCTLTPKTLAPVSIYDLGPATSVTVTDSSRLSQAIIQVMDVTAPVWLDTQS 65

Query: 73  IIVRS---SPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKP---NQGIYADY 126
           I  R     P  I    GS+W+    +++  +    F  +  I +          + A Y
Sbjct: 66  IHYRLAYHDPARIYAYAGSRWAAPPAKLLTERFRQYF-ASHAIDSQKDDKNKESHVPAHY 124

Query: 127 QIISAIRSFEINIDRH---CAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQS 183
            +   +  F            II +   +   +    V Q+ F  E   +  +    + +
Sbjct: 125 LLKIELGEFTQIFHAQNDSRIIIRLRASLYEPNTRLPVAQRSFTGERPAQTADAAGAVAA 184

Query: 184 LNRAFSRISSEIIDW 198
                  +  E++ W
Sbjct: 185 FILVSDNLLDELVQW 199


>gi|301057222|ref|ZP_07198351.1| conserved hypothetical protein [delta proteobacterium NaphS2]
 gi|300448673|gb|EFK12309.1| conserved hypothetical protein [delta proteobacterium NaphS2]
          Length = 211

 Score = 73.1 bits (178), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 28/194 (14%), Positives = 67/194 (34%), Gaps = 8/194 (4%)

Query: 12  KIISCSLAVLLCTSLSSCFFHNNP-VNIYDLT-ESTKYDESVQRHIQLIITEPITEKILN 69
           K++      L      S      P ++ Y L     K          + +         +
Sbjct: 6   KLLLVVFCALFLGGGCSALKKPKPKIDYYTLEYTVPKIAGLKPIDKVIRVDRFGVAPAYD 65

Query: 70  SEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQII 129
           S  +I +    +    +  +W           L  +  ++G    V      + A Y + 
Sbjct: 66  SNRMIFQDQSFKQDEYVYFKWIANPGSFATYFLARDLRDSGLFKAVFTYKSHMAASYALE 125

Query: 130 SAIRS-FEINIDRHC-AIITMSLKII----NAHDNSLVGQKVFHVEEKLEKDNKLHFIQS 183
            ++   FE++  +   A++ MS+ ++          ++ QK +    K  +++     ++
Sbjct: 126 GSVDEFFELDTPKGWDAVLGMSVTLVVIGEPDVSKRILFQKSYRARRKCGEEHPRGLAEA 185

Query: 184 LNRAFSRISSEIID 197
           ++ A   +SS+II 
Sbjct: 186 MSEAMGEVSSKIIR 199


>gi|161523586|ref|YP_001578598.1| ABC transporter auxiliary component-like protein [Burkholderia
           multivorans ATCC 17616]
 gi|160341015|gb|ABX14101.1| ABC-type uncharacterized transport system auxiliary component-like
           protein [Burkholderia multivorans ATCC 17616]
          Length = 207

 Score = 72.7 bits (177), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 29/203 (14%), Positives = 71/203 (34%), Gaps = 9/203 (4%)

Query: 1   MDKKLNKIIKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIIT 60
           M + L++ ++    + ++  L+  +  +          YDL  +T           L + 
Sbjct: 1   MSRLLDRALRPAATALAVLTLVLAAGCAADRAVLSNIRYDLGPATPVGTVGSGP-ALKVL 59

Query: 61  EPITEKILNSEDIIVRS---SPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVK 117
           +    +  +S+  + R        +     S+W     +++  +L       G    V++
Sbjct: 60  DVSAPEAFDSDKFVYRLAYADAQRMAVYRDSRWIAPPAQLLTQRLRGALSARG---AVLE 116

Query: 118 PNQGIYADYQIISAIRSFEINIDRH-CAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDN 176
            + G+ A   +   +  FE   D    +   ++ +     D  ++GQ+ F         +
Sbjct: 117 GSDGVRAP-TLKVDLSEFEQVFDGQSQSHGAVTARATLMQDGKVLGQRTFVARAPSSTPD 175

Query: 177 KLHFIQSLNRAFSRISSEIIDWT 199
                ++L  A   + S+I  W 
Sbjct: 176 AAGGARALAAASDELVSQIAAWV 198


>gi|78777722|ref|YP_394037.1| hypothetical protein Suden_1525 [Sulfurimonas denitrificans DSM
           1251]
 gi|78498262|gb|ABB44802.1| hypothetical protein Suden_1525 [Sulfurimonas denitrificans DSM
           1251]
          Length = 198

 Score = 71.5 bits (174), Expect = 6e-11,   Method: Composition-based stats.
 Identities = 32/187 (17%), Positives = 70/187 (37%), Gaps = 4/187 (2%)

Query: 16  CSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIITEPITEKILNSEDIIV 75
             + + L    ++   H +   +       K   S  R   L I++  +   L S D+  
Sbjct: 6   ALITIFLFVGCTTIKPHVSEFRVITKDTQIKSSASGCRDKSLKISQAFSTPSLLSLDMDY 65

Query: 76  RSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSF 135
             S  +I     SQW +     I  +L  +  ++    +V      + ++Y +   I  F
Sbjct: 66  TESDNKIFSYSQSQWQESPNSSITSELFKSIRDSDIFKSVHSFKSRVKSEYILEIDIEEF 125

Query: 136 EINIDRH----CAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRI 191
                ++       I ++L +++A  N+ +    F  +   +  +     ++L+ A   I
Sbjct: 126 MQFYTKNMSSSHVNIVVNLSLVDAKTNNTLSTNKFTSKVDAKTADASGGAEALSIALDEI 185

Query: 192 SSEIIDW 198
            S+ I+W
Sbjct: 186 ISKNIEW 192


>gi|299068158|emb|CBJ39377.1| conserved exported protein of unknown function [Ralstonia
           solanacearum CMR15]
          Length = 214

 Score = 71.5 bits (174), Expect = 6e-11,   Method: Composition-based stats.
 Identities = 33/207 (15%), Positives = 68/207 (32%), Gaps = 14/207 (6%)

Query: 8   IIKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIITEPITEKI 67
            + ++++  S    L    +       P  +YD   +       +    L +TE +    
Sbjct: 6   TVLRRVLVLSALAALSALAACSSTPTAPAAVYDFGLAPAAVGGPRLPTALRVTEVVGPGW 65

Query: 68  LNSEDIIVRS---SPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYA 124
           ++   I  R         +    S+W +    +   +L       G++     P      
Sbjct: 66  MDGNAIYYRLAYAQGQRTELYANSRWVESPVNLFDARLRNAVAARGQVVGYGLPEVP--- 122

Query: 125 DYQIISAIRSFEINIDRHCA---IITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFI 181
              +   +  F    DR  A   ++ +   +  A    LV Q+V   +      +    +
Sbjct: 123 --TLRVELVDFSQVFDRPDASHGVVRLRASVFLARG--LVAQRVVQADVPAPSADAAGGV 178

Query: 182 QSLNRAFSRISSEIIDWTLS-SLPLSD 207
            +L +A  R   E++DW    +LP S 
Sbjct: 179 SALAQASDRAIGEVLDWVAGLALPASA 205


>gi|254251299|ref|ZP_04944617.1| hypothetical protein BDAG_00480 [Burkholderia dolosa AUO158]
 gi|124893908|gb|EAY67788.1| hypothetical protein BDAG_00480 [Burkholderia dolosa AUO158]
          Length = 214

 Score = 71.2 bits (173), Expect = 9e-11,   Method: Composition-based stats.
 Identities = 28/203 (13%), Positives = 74/203 (36%), Gaps = 9/203 (4%)

Query: 1   MDKKLNKIIKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIIT 60
           M + L++ ++    + ++  L+  +  +          YDL  +     +      L + 
Sbjct: 8   MPRILDRALRPAATALAVLTLVLAAGCAADRAALSNIRYDLGPAAPVVSAGTGP-ALKVL 66

Query: 61  EPITEKILNSEDIIVRS---SPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVK 117
           +    + L+++  + R        +     S+W+    +++  +L +     G    V++
Sbjct: 67  DVAAPEALDTDKFVYRLAYADAQRMAVYRDSRWTAPPAQLLTQRLRSALSARG---AVLE 123

Query: 118 PNQGIYADYQIISAIRSFEINIDRH-CAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDN 176
            + G+ A   +   +  FE   D    +   ++ +     D  ++GQ+ F         +
Sbjct: 124 GSDGVRAP-TLKVDLSEFEQVFDGESQSHGAVTARATLMQDGKVLGQRTFVARAPASTPD 182

Query: 177 KLHFIQSLNRAFSRISSEIIDWT 199
                ++L  A   + S+I  W 
Sbjct: 183 AAGGARALAAASDELVSQIAAWI 205


>gi|73539804|ref|YP_294324.1| lipoprotein [Ralstonia eutropha JMP134]
 gi|72117217|gb|AAZ59480.1| probable lipoprotein [Ralstonia eutropha JMP134]
          Length = 208

 Score = 71.2 bits (173), Expect = 9e-11,   Method: Composition-based stats.
 Identities = 26/187 (13%), Positives = 64/187 (34%), Gaps = 16/187 (8%)

Query: 22  LCTSLSSCFF--HNNPVNIYDLTESTKYDESVQRHIQLIITEPITEKILNSEDIIVR--- 76
           + ++L  C     + PV  YDL        +     +L I +      + S  +  R   
Sbjct: 23  IVSALPGCSLTRASAPVTTYDLGPPLSTQAAAGTLPKLRIAQTDGPTWMESNALYYRLQY 82

Query: 77  SSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFE 136
           S    +Q     +W     ++   +L       G ++     +        +   +  FE
Sbjct: 83  SQAQRMQSYATQRWVIPPTQLFDGRLREAVAARGALTWFGDTSVP-----ALKVDMLEFE 137

Query: 137 INIDRHC---AIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISS 193
              D       ++ +   +   + + ++GQ+ F   E     +    +++L  A  ++ +
Sbjct: 138 QVFDSATDSRGVVRVRATV---YQHGMIGQQTFTAREPAPSADGAGGVKALADATDKVIA 194

Query: 194 EIIDWTL 200
           +++ W  
Sbjct: 195 DMLAWAA 201


>gi|256828278|ref|YP_003157006.1| protein of unknown function DUF330 [Desulfomicrobium baculatum DSM
           4028]
 gi|256577454|gb|ACU88590.1| protein of unknown function DUF330 [Desulfomicrobium baculatum DSM
           4028]
          Length = 206

 Score = 71.2 bits (173), Expect = 9e-11,   Method: Composition-based stats.
 Identities = 33/193 (17%), Positives = 71/193 (36%), Gaps = 9/193 (4%)

Query: 14  ISCSLAVLLCTSLSSCFFHNNP---VNIYDLTESTKYDESVQRHIQLIITEPITEKILNS 70
           I   +  +L  +L+ C         V  Y L   +      Q    + +         N+
Sbjct: 3   IRYLVPFILILTLAGCGAARTTAPDVRYYTLEYESPTPTGQQAKAVIALNRFGVAPEFNT 62

Query: 71  EDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIIS 130
             I+ R      Q     QW      ++   L  + + +G    V +P   + A +Q+  
Sbjct: 63  GKIVYRDLSFGRQEYAYHQWRSAPQALVADYLRRDLQQSGLFLAVNQPGSSLSATHQLEG 122

Query: 131 AIRSF-EINI-DRHCAIITMSLKIINAHDN----SLVGQKVFHVEEKLEKDNKLHFIQSL 184
            +  + E++  DR  A  ++++ +I+         ++ Q+ +   E   K N    ++++
Sbjct: 123 MVEEWMEVDGEDRWLATASLTITLIDLRARAIPEQVLFQRTYRGSEPAAKKNPGSVVEAM 182

Query: 185 NRAFSRISSEIID 197
           +R    +S  II 
Sbjct: 183 SRVMRTLSGRIIA 195


>gi|94309014|ref|YP_582224.1| hypothetical protein Rmet_0069 [Cupriavidus metallidurans CH34]
 gi|93352866|gb|ABF06955.1| putative lipoprotein [Cupriavidus metallidurans CH34]
          Length = 215

 Score = 70.8 bits (172), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 36/205 (17%), Positives = 72/205 (35%), Gaps = 16/205 (7%)

Query: 8   IIKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDL-TESTKYDESVQRHIQLIITEPITEK 66
            I   +   +L +L+  S  S      P   YD    +    +      +L IT+     
Sbjct: 2   TIASALRFTALGLLIALSGCSVLSSQPPSTTYDFGPLAAAPSQPPAPLPKLRITQTDGPV 61

Query: 67  ILNSEDIIVR---SSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIY 123
            ++   I  R   +    +Q     +W D    +   +L       G +S          
Sbjct: 62  WMDGSGIYYRLQYTQAQRLQAYSTQRWVDSPQHLFNDRLRDAVAARGPLSWSGDTTIP-- 119

Query: 124 ADYQIISAIRSFEINIDRHCA---IITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHF 180
               +   + +FE   D   +   ++     + +     L+GQK F  E+     +    
Sbjct: 120 ---ALKVDLLAFEQVFDSPTSSRGVVRARATVYHKG---LIGQKTFVAEQPAPSADGQGG 173

Query: 181 IQSLNRAFSRISSEIIDWTLSSLPL 205
           +++L+     + + I+DWT ++LPL
Sbjct: 174 VKALSAGVDAVIAAILDWT-ATLPL 197


>gi|293602526|ref|ZP_06684972.1| hypothetical protein HMPREF0004_0548 [Achromobacter piechaudii ATCC
           43553]
 gi|292819288|gb|EFF78323.1| hypothetical protein HMPREF0004_0548 [Achromobacter piechaudii ATCC
           43553]
          Length = 233

 Score = 70.8 bits (172), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 21/192 (10%), Positives = 69/192 (35%), Gaps = 6/192 (3%)

Query: 9   IKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIITEPITEKIL 68
           +++ ++  +L +    +         P +++DL    K   ++   + + ++      + 
Sbjct: 3   MRRAVLILTLTITSALAGCGIGRVGTPPSVFDLGLDAKPVPALPARVPIAMSLQAPPALS 62

Query: 69  NSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQI 128
           ++  I         +     +W+     +++ +L       G    V+     +    Q+
Sbjct: 63  DTSMIWRVGDSAAPRAYATFRWASSPSELVRQRLTDRLSRQGP---VLADRINLQMP-QL 118

Query: 129 ISAIRSFEINI--DRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNR 186
             ++  FE     +   +   + L+ +  +  ++V QK   V+      +    + +L +
Sbjct: 119 QLSLMQFEQVYADNGQTSEGRLLLQAVLLNGRAVVAQKRIQVQTPAPTQDAAGGVAALRQ 178

Query: 187 AFSRISSEIIDW 198
           A    + ++  W
Sbjct: 179 ATDEAADQLAKW 190


>gi|167717855|ref|ZP_02401091.1| putative lipoprotein [Burkholderia pseudomallei DM98]
          Length = 214

 Score = 70.8 bits (172), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 27/185 (14%), Positives = 62/185 (33%), Gaps = 9/185 (4%)

Query: 1   MDKKLNKIIKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIIT 60
           M   L++  +  +      V+   S  +          YDL  +     S      L + 
Sbjct: 6   MSGSLSRRGRPALALAVALVMASASGCAGTPAALANIRYDLGPAQPAASSGTGP-ALKVL 64

Query: 61  EPITEKILNSEDIIVR---SSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVK 117
           +      LN++  + R   S    I     S+W+    +++  +L      +G+   V+ 
Sbjct: 65  DVSAPDALNTDRFVYRLAYSDAQRIAAYRDSKWTAPPAQLLTQRLRGAL--SGR-GAVLA 121

Query: 118 PNQGIYADYQIISAIRSFEINIDR-HCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDN 176
            + G+ A   +   +  FE   D    +   ++ ++    +  ++GQ+ F         +
Sbjct: 122 ADDGVRAPV-LKVELSEFEQVFDGRSESHAAVTARVTLTQEGKVLGQRTFVSRAPASTPD 180

Query: 177 KLHFI 181
                
Sbjct: 181 LAGLA 185


>gi|221199883|ref|ZP_03572926.1| ABC-type transporter, auxiliary component [Burkholderia multivorans
           CGD2M]
 gi|221207449|ref|ZP_03580458.1| ABC-type transporter, auxiliary component [Burkholderia multivorans
           CGD2]
 gi|221172652|gb|EEE05090.1| ABC-type transporter, auxiliary component [Burkholderia multivorans
           CGD2]
 gi|221180122|gb|EEE12526.1| ABC-type transporter, auxiliary component [Burkholderia multivorans
           CGD2M]
          Length = 207

 Score = 70.8 bits (172), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 29/203 (14%), Positives = 71/203 (34%), Gaps = 9/203 (4%)

Query: 1   MDKKLNKIIKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIIT 60
           M + L++ ++    + ++  L+  +  +          YDL  +T           L + 
Sbjct: 1   MSRLLDRALRPAATALAVLTLVLAAGCAADRAALSNIRYDLGPATPVGTVGSGP-ALKVL 59

Query: 61  EPITEKILNSEDIIVRS---SPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVK 117
           +    +  +S+  + R        +     S+W     +++  +L       G    V++
Sbjct: 60  DVSAPEAFDSDKFVYRLAYADAQRMAVYRDSRWIAPPAQLLTQRLRGALSARG---AVLE 116

Query: 118 PNQGIYADYQIISAIRSFEINIDRH-CAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDN 176
            + G+ A   +   +  FE   D    +   ++ +     D  ++GQ+ F         +
Sbjct: 117 GSDGVRAP-TLKVDLSEFEQVFDGQSQSHGAVTARATLMQDGKVLGQRTFVARAPSSTPD 175

Query: 177 KLHFIQSLNRAFSRISSEIIDWT 199
                ++L  A   + S+I  W 
Sbjct: 176 AAGGARALAAASDELVSQIAAWV 198


>gi|221211091|ref|ZP_03584070.1| ABC-type transporter, auxiliary component [Burkholderia multivorans
           CGD1]
 gi|221168452|gb|EEE00920.1| ABC-type transporter, auxiliary component [Burkholderia multivorans
           CGD1]
          Length = 207

 Score = 70.4 bits (171), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 29/203 (14%), Positives = 71/203 (34%), Gaps = 9/203 (4%)

Query: 1   MDKKLNKIIKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIIT 60
           M + L++ ++    + ++  L+  +  +          YDL  +T           L + 
Sbjct: 1   MSRLLDRALRPAATALAVLTLVLAAGCAADRAALSNIRYDLGPATPVGSVGSGP-ALKVL 59

Query: 61  EPITEKILNSEDIIVRS---SPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVK 117
           +    +  +S+  + R        +     S+W     +++  +L       G    V++
Sbjct: 60  DVSAPEAFDSDKFVYRLAYADAQRMAVYRDSRWIAPPAQLLTQRLRGALSARG---AVLE 116

Query: 118 PNQGIYADYQIISAIRSFEINIDRH-CAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDN 176
            + G+ A   +   +  FE   D    +   ++ +     D  ++GQ+ F         +
Sbjct: 117 GSDGVRAP-TLKVDLSEFEQVFDGQSQSHGAVTARATLMQDGKVLGQRTFVARAPSSTPD 175

Query: 177 KLHFIQSLNRAFSRISSEIIDWT 199
                ++L  A   + S+I  W 
Sbjct: 176 AAGGARALAAASDELVSQIAAWV 198


>gi|91781624|ref|YP_556830.1| hypothetical protein Bxe_A4222 [Burkholderia xenovorans LB400]
 gi|91685578|gb|ABE28778.1| Conserved hypothetical protein [Burkholderia xenovorans LB400]
          Length = 208

 Score = 70.0 bits (170), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 34/206 (16%), Positives = 74/206 (35%), Gaps = 16/206 (7%)

Query: 1   MDKKLNKIIKKKIISCSLAVLLCTSLSSCFFHNNPVNI----YDLTESTKYDESVQRHIQ 56
           M + +++++     S +LAVLL   + +      P  I    YD         +      
Sbjct: 1   MSRSIHRLLSS---SAALAVLLAFGVLATGCAGTPAAISDIRYDFGPPAPAASAGTSP-A 56

Query: 57  LIITEPITEKILNSEDIIVRSS---PIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKIS 113
           + + +     +L S+ ++ R S     +      S W+    +++  +L     + G   
Sbjct: 57  VKVLDVTAPDVLESDKLMYRLSYADAQQTASYANSHWTMTPSQLLTQRLRGALSSRG--- 113

Query: 114 TVVKPNQGIYADYQIISAIRSFEINIDRHC-AIITMSLKIINAHDNSLVGQKVFHVEEKL 172
           TV+    G+ A   +   +  FE   D    +   ++ +        ++GQ+ F      
Sbjct: 114 TVLTGADGVSAPV-LKVELSEFEQVFDSQSKSHAAVTARATLTQGGKVLGQRTFIARAPS 172

Query: 173 EKDNKLHFIQSLNRAFSRISSEIIDW 198
              +     Q+L  A   + ++I  W
Sbjct: 173 SSGDAAGGAQALATASDDLVAQIGAW 198


>gi|302342026|ref|YP_003806555.1| hypothetical protein Deba_0589 [Desulfarculus baarsii DSM 2075]
 gi|301638639|gb|ADK83961.1| protein of unknown function DUF330 [Desulfarculus baarsii DSM 2075]
          Length = 211

 Score = 69.6 bits (169), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 24/146 (16%), Positives = 53/146 (36%), Gaps = 5/146 (3%)

Query: 57  LIITEPITEKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVV 116
           L I +P          +I RS P + Q    ++W      M+   L+ +F+ +G    V 
Sbjct: 53  LAINDPTAAAGYIDTAMIFRSGPYQRQSYNYNRWRVTPAEMVGDFLLRDFQASGLFEAVF 112

Query: 117 KPNQGIYADYQIISAIRSFEIN-IDRHCAIITMSLKIINAHDN----SLVGQKVFHVEEK 171
                  A + +   +     +        I +   + +   +     +V QK + V + 
Sbjct: 113 DSQDDANARFFLDIGVEDLLADRAGGGQLEIALLATLTDIEHSRLPLRVVFQKRYAVAQP 172

Query: 172 LEKDNKLHFIQSLNRAFSRISSEIID 197
           +  D+     ++ ++A   +S  +I 
Sbjct: 173 MAGDSPKEMARAASQAMEALSRRLIG 198


>gi|171322067|ref|ZP_02910939.1| ABC-type uncharacterized transport system auxiliary component-like
           protein [Burkholderia ambifaria MEX-5]
 gi|171092629|gb|EDT37933.1| ABC-type uncharacterized transport system auxiliary component-like
           protein [Burkholderia ambifaria MEX-5]
          Length = 207

 Score = 69.2 bits (168), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 28/203 (13%), Positives = 73/203 (35%), Gaps = 9/203 (4%)

Query: 1   MDKKLNKIIKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIIT 60
           M + L++ ++    + ++ +L   +  +          YDL  +     +      L + 
Sbjct: 1   MPRILDRALRPAATALAMLMLAFAAGCAGNGAALSNVHYDLGPAASVVTAGTGP-ALKVL 59

Query: 61  EPITEKILNSEDIIVRSS---PIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVK 117
           +      L+++  + R +            S+W+    +++  +L     + G    V++
Sbjct: 60  DVAAPDALDTDKFVYRLTYADAQRTAVYRDSRWTAPPAQLLTQRLRGALSSRG---AVLE 116

Query: 118 PNQGIYADYQIISAIRSFEINIDRH-CAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDN 176
            + G+ A   +   +  FE   D    +   ++ +     D  ++GQ+ F         +
Sbjct: 117 GSDGVRAP-TLKVDLNEFEQVFDGESQSHGAVTARATLMQDGKVLGQRTFVARAPSSTPD 175

Query: 177 KLHFIQSLNRAFSRISSEIIDWT 199
                ++L  A   + S+I  W 
Sbjct: 176 AAGGARALAAASDELVSQIAAWV 198


>gi|17545035|ref|NP_518437.1| lipoprotein [Ralstonia solanacearum GMI1000]
 gi|17427325|emb|CAD13844.1| putative cog3218, abc-type uncharacterized transport system,
           auxiliary component abc transporter protein [Ralstonia
           solanacearum GMI1000]
          Length = 211

 Score = 69.2 bits (168), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 30/183 (16%), Positives = 60/183 (32%), Gaps = 14/183 (7%)

Query: 32  HNNPVNIYDLTESTKYDESVQRHIQLIITEPITEKILNSEDIIVRS---SPIEIQYLIGS 88
              P  +YD   +       +    L +TE +    ++   I  R         +    S
Sbjct: 27  PTAPAAVYDFGLAPAAAGGPRLPTALRVTEVVGPGWMDGNAIYYRLAYAQGQRTELYANS 86

Query: 89  QWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFEINIDRHCA---I 145
           +W +    +   +L       G++     P         +   +  F    DR  A   +
Sbjct: 87  RWVESPVNLFDARLRNAVAARGQVVGYGLPEVP-----TLRVELVDFSQVFDRPDASRGV 141

Query: 146 ITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEIIDWTLS-SLP 204
           + +   +  A    LV Q+V   +      +    + +L +A  R   E++DW    +LP
Sbjct: 142 VRLRASVFMARG--LVAQRVVQADVPAPSADAAGGVSALAQASDRAIGEVLDWVAGLALP 199

Query: 205 LSD 207
            + 
Sbjct: 200 AAA 202


>gi|319791000|ref|YP_004152640.1| hypothetical protein Varpa_0307 [Variovorax paradoxus EPS]
 gi|315593463|gb|ADU34529.1| protein of unknown function DUF330 [Variovorax paradoxus EPS]
          Length = 224

 Score = 69.2 bits (168), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 30/215 (13%), Positives = 70/215 (32%), Gaps = 21/215 (9%)

Query: 3   KKLNKIIKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQ------ 56
           K     +   +    +A+L+     +         +YD         +            
Sbjct: 2   KTTTHPLASALAGLGIALLVA-GCGALPDKPARAKLYDFGPGVSAMATAPAAAASPALPM 60

Query: 57  LIITEPITEKILNSEDIIVRSS---PIEIQYLIGSQWSDKLPRMIQLKLIANF-ENNGKI 112
           L + E      L+   I+ R       E++    S+WS    ++++ +L  +  E    +
Sbjct: 61  LALAEIEANTRLDGTQILYRLGYADTNELRPYGQSRWSQPPAQLLRQRLRDSLAERRTVL 120

Query: 113 S----TVVKPNQGIYADYQIISAIRSFEINIDRHCA---IITMSLKIINAHDN--SLVGQ 163
                  +  ++G   D  +  ++  F    D   +   ++ +   +I        ++GQ
Sbjct: 121 GPEESATLARSKGEVPD-TLRISLDEFSHYFDSPASSAGLVRLRATLIRGGTGGDRVLGQ 179

Query: 164 KVFHVEEKLEKDNKLHFIQSLNRAFSRISSEIIDW 198
           K F V       +    +++L  A     +E+  W
Sbjct: 180 KTFTVRRPAPSADAPGGVKALAAASDAAVAEVTQW 214


>gi|172061850|ref|YP_001809502.1| ABC transporter auxiliary component-like protein [Burkholderia
           ambifaria MC40-6]
 gi|171994367|gb|ACB65286.1| ABC-type uncharacterized transport system auxiliary component-like
           protein [Burkholderia ambifaria MC40-6]
          Length = 207

 Score = 68.8 bits (167), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 28/203 (13%), Positives = 73/203 (35%), Gaps = 9/203 (4%)

Query: 1   MDKKLNKIIKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIIT 60
           M + L++ ++    + ++ +L   +  +          YDL  +     +      L + 
Sbjct: 1   MPRILDRALRPAATALAMLMLAFAAGCAGNGAALSNVRYDLGPAASVVTAGTGP-ALKVL 59

Query: 61  EPITEKILNSEDIIVRSS---PIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVK 117
           +      L+++  + R +            S+W+    +++  +L     + G    V++
Sbjct: 60  DVAAPDALDTDKFVYRLTYADAQRTAVYRDSRWTAPPAQLLTQRLRGALSSRG---AVLE 116

Query: 118 PNQGIYADYQIISAIRSFEINIDRH-CAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDN 176
            + G+ A   +   +  FE   D    +   ++ +     D  ++GQ+ F         +
Sbjct: 117 GSDGVRAP-TLKVDLNEFEQVFDGESQSHGAVTARATLMQDGKVLGQRTFIARAPSSTPD 175

Query: 177 KLHFIQSLNRAFSRISSEIIDWT 199
                ++L  A   + S+I  W 
Sbjct: 176 AAGGARALAAASDELVSQIAAWV 198


>gi|170703965|ref|ZP_02894627.1| ABC-type uncharacterized transport system auxiliary component-like
           protein [Burkholderia ambifaria IOP40-10]
 gi|170131128|gb|EDS99793.1| ABC-type uncharacterized transport system auxiliary component-like
           protein [Burkholderia ambifaria IOP40-10]
          Length = 207

 Score = 68.8 bits (167), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 28/203 (13%), Positives = 73/203 (35%), Gaps = 9/203 (4%)

Query: 1   MDKKLNKIIKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIIT 60
           M + L++ ++    + ++ +L   +  +          YDL  +     +      L + 
Sbjct: 1   MPRILDRALRPAATALAMLMLAFAAGCAGNGAALSNVRYDLGPAASVVTAGTGP-ALKVL 59

Query: 61  EPITEKILNSEDIIVRSS---PIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVK 117
           +      L+++  + R +            S+W+    +++  +L     + G    V++
Sbjct: 60  DVAAPDALDTDKFVYRLTYADAQRTAVYRDSRWTAPPAQLLTQRLRGALSSRG---AVLE 116

Query: 118 PNQGIYADYQIISAIRSFEINIDRH-CAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDN 176
            + G+ A   +   +  FE   D    +   ++ +     D  ++GQ+ F         +
Sbjct: 117 GSDGVRAP-TLKVDLNEFEQVFDGQSQSHGAVTARATLMQDGKVLGQRTFVARAPSSTPD 175

Query: 177 KLHFIQSLNRAFSRISSEIIDWT 199
                ++L  A   + S+I  W 
Sbjct: 176 AAGGARALAAASDELVSQIAAWV 198


>gi|294338720|emb|CAZ87052.1| putative ABC-type uncharacterized transport system, auxiliary
           component [Thiomonas sp. 3As]
          Length = 206

 Score = 68.5 bits (166), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 23/185 (12%), Positives = 64/185 (34%), Gaps = 3/185 (1%)

Query: 27  SSCFFHNNPVN-IYDLTESTKYDESVQRHIQLIITEPITEKILNSEDIIVRSSPIEIQYL 85
            +   +  PV   Y LT +      + +   + +          S  ++   SP  ++  
Sbjct: 22  CALPVNRAPVQQTYRLTATEIRTAPLPQATVIQLLPVRASAGFQSPAMMYSRSPDTLEPY 81

Query: 86  IGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFEINIDRHCAI 145
             S+W     +++   +         IS V +    + A + +   +   E ++  +   
Sbjct: 82  RDSRWLAPPAQLVGEAIARTLSRQPWISAVQQQAVLVNAPWTLHCKLNRLEHDVHANQGT 141

Query: 146 ITMSL--KIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEIIDWTLSSL 203
           + + L   + N   + +     F   + +  ++  HF Q       +    I++ T +++
Sbjct: 142 VHLDLVCDLANQRTSRIAAHWHFDGSQTIAVNDAAHFAQGAQTLLDQALKGIVENTRAAV 201

Query: 204 PLSDN 208
             + +
Sbjct: 202 AAAQS 206


>gi|15641759|ref|NP_231391.1| hypothetical protein VC1755 [Vibrio cholerae O1 biovar El Tor str.
           N16961]
 gi|121585825|ref|ZP_01675619.1| lipoprotein, putative [Vibrio cholerae 2740-80]
 gi|121729804|ref|ZP_01682239.1| lipoprotein, putative [Vibrio cholerae V52]
 gi|147673513|ref|YP_001217297.1| putative lipoprotein [Vibrio cholerae O395]
 gi|153212078|ref|ZP_01947895.1| lipoprotein, putative [Vibrio cholerae 1587]
 gi|153819625|ref|ZP_01972292.1| lipoprotein, putative [Vibrio cholerae NCTC 8457]
 gi|227081902|ref|YP_002810453.1| putative lipoprotein [Vibrio cholerae M66-2]
 gi|229508141|ref|ZP_04397646.1| hypothetical protein VCF_003375 [Vibrio cholerae BX 330286]
 gi|229511620|ref|ZP_04401099.1| hypothetical protein VCE_003029 [Vibrio cholerae B33]
 gi|229518759|ref|ZP_04408202.1| hypothetical protein VCC_002784 [Vibrio cholerae RC9]
 gi|229529225|ref|ZP_04418615.1| hypothetical protein VCG_002318 [Vibrio cholerae 12129(1)]
 gi|229607717|ref|YP_002878365.1| hypothetical protein VCD_002629 [Vibrio cholerae MJ-1236]
 gi|254285306|ref|ZP_04960271.1| lipoprotein, putative [Vibrio cholerae AM-19226]
 gi|254848871|ref|ZP_05238221.1| conserved hypothetical protein [Vibrio cholerae MO10]
 gi|255744829|ref|ZP_05418779.1| putative lipoprotein [Vibrio cholera CIRS 101]
 gi|262161888|ref|ZP_06030906.1| putative lipoprotein [Vibrio cholerae INDRE 91/1]
 gi|262169756|ref|ZP_06037447.1| putative lipoprotein [Vibrio cholerae RC27]
 gi|298498174|ref|ZP_07007981.1| conserved hypothetical protein [Vibrio cholerae MAK 757]
 gi|9656277|gb|AAF94905.1| conserved hypothetical protein [Vibrio cholerae O1 biovar El Tor
           str. N16961]
 gi|121549963|gb|EAX59981.1| lipoprotein, putative [Vibrio cholerae 2740-80]
 gi|121628456|gb|EAX60947.1| lipoprotein, putative [Vibrio cholerae V52]
 gi|124116874|gb|EAY35694.1| lipoprotein, putative [Vibrio cholerae 1587]
 gi|126509829|gb|EAZ72423.1| lipoprotein, putative [Vibrio cholerae NCTC 8457]
 gi|146315396|gb|ABQ19935.1| putative lipoprotein [Vibrio cholerae O395]
 gi|150424578|gb|EDN16514.1| lipoprotein, putative [Vibrio cholerae AM-19226]
 gi|227009790|gb|ACP06002.1| putative lipoprotein [Vibrio cholerae M66-2]
 gi|227013657|gb|ACP09867.1| putative lipoprotein [Vibrio cholerae O395]
 gi|229332999|gb|EEN98485.1| hypothetical protein VCG_002318 [Vibrio cholerae 12129(1)]
 gi|229343448|gb|EEO08423.1| hypothetical protein VCC_002784 [Vibrio cholerae RC9]
 gi|229351585|gb|EEO16526.1| hypothetical protein VCE_003029 [Vibrio cholerae B33]
 gi|229355646|gb|EEO20567.1| hypothetical protein VCF_003375 [Vibrio cholerae BX 330286]
 gi|229370372|gb|ACQ60795.1| hypothetical protein VCD_002629 [Vibrio cholerae MJ-1236]
 gi|254844576|gb|EET22990.1| conserved hypothetical protein [Vibrio cholerae MO10]
 gi|255737300|gb|EET92695.1| putative lipoprotein [Vibrio cholera CIRS 101]
 gi|262021990|gb|EEY40700.1| putative lipoprotein [Vibrio cholerae RC27]
 gi|262028620|gb|EEY47275.1| putative lipoprotein [Vibrio cholerae INDRE 91/1]
 gi|297542507|gb|EFH78557.1| conserved hypothetical protein [Vibrio cholerae MAK 757]
          Length = 192

 Score = 68.1 bits (165), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 24/173 (13%), Positives = 73/173 (42%), Gaps = 7/173 (4%)

Query: 28  SCFFHNNP-VNIYDLTESTKYDES-VQRHIQLIITEPITEKI-LNSEDIIVRSSPIEIQY 84
            C     P V+ Y L  + +  E    + + L++ +P+     L+++ I+ R S  ++  
Sbjct: 15  GCGGTPQPKVSFYLLPNNPELSEHIQPKTLPLLVVQPVELAAYLDTQGIVYRQSETQVIQ 74

Query: 85  LIGSQWSDKLPRMIQLKLIANFEN--NGKISTVVKPNQGIYADYQIISAIRSFEINIDRH 142
              +QW+ +L   +  ++  +     +      +  +      +++   ++ F      +
Sbjct: 75  ARQNQWAQRLSPQLTQRITNDLRRKQSRYWPAPLNASSIQQEHWKLQVRLQRFNGVYTGN 134

Query: 143 CAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEI 195
            A +  + +++N    S++  + F  +  L+       +++L+    ++S++I
Sbjct: 135 -AEVAGNWELLNPKGESML-NQEFSFQVPLKDTGYPALVEALSAGVDQLSTQI 185


>gi|153802180|ref|ZP_01956766.1| lipoprotein, putative [Vibrio cholerae MZO-3]
 gi|229515138|ref|ZP_04404598.1| hypothetical protein VCB_002795 [Vibrio cholerae TMA 21]
 gi|229523837|ref|ZP_04413242.1| hypothetical protein VCA_001414 [Vibrio cholerae bv. albensis
           VL426]
 gi|124122315|gb|EAY41058.1| lipoprotein, putative [Vibrio cholerae MZO-3]
 gi|229337418|gb|EEO02435.1| hypothetical protein VCA_001414 [Vibrio cholerae bv. albensis
           VL426]
 gi|229347843|gb|EEO12802.1| hypothetical protein VCB_002795 [Vibrio cholerae TMA 21]
          Length = 192

 Score = 67.7 bits (164), Expect = 8e-10,   Method: Composition-based stats.
 Identities = 25/173 (14%), Positives = 74/173 (42%), Gaps = 7/173 (4%)

Query: 28  SCFFHNNP-VNIYDLTESTKYDE-SVQRHIQLIITEPITEKI-LNSEDIIVRSSPIEIQY 84
            C     P V+ Y L  + +  E +  + + L++ +P+     L+++ I+ R S  ++  
Sbjct: 15  GCGGTPQPKVSFYLLPNNPELSELTQPKTLPLLVVQPVELAAYLDTQGIVYRQSETQVIQ 74

Query: 85  LIGSQWSDKLPRMIQLKLIANFEN--NGKISTVVKPNQGIYADYQIISAIRSFEINIDRH 142
              +QW+ +L   +  ++  +     +      +  +      +++   ++ F      +
Sbjct: 75  ARQNQWAQRLSPQLTQRITNDLRRKQSRYWPAPLNASSIQQEHWKLQVRLQRFNGVYTGN 134

Query: 143 CAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEI 195
            A +  S +++N    S++  + F  +  L+       +++L+    ++S++I
Sbjct: 135 -AEVAGSWELLNPKGESML-NQEFSFQVPLKDTGYPALVEALSAGVDQLSTQI 185


>gi|296160364|ref|ZP_06843181.1| protein of unknown function DUF330 [Burkholderia sp. Ch1-1]
 gi|295889345|gb|EFG69146.1| protein of unknown function DUF330 [Burkholderia sp. Ch1-1]
          Length = 208

 Score = 67.7 bits (164), Expect = 9e-10,   Method: Composition-based stats.
 Identities = 35/206 (16%), Positives = 76/206 (36%), Gaps = 16/206 (7%)

Query: 1   MDKKLNKIIKKKIISCSLAVLLCTSLSSCFFHNNPVNI----YDLTESTKYDESVQRHIQ 56
           M + +++++     S +LAVLL   + +      P  I    YD         +      
Sbjct: 1   MSRSIHRLLSS---SAALAVLLAFGVLATGCAGTPAAISDIRYDFGPPAPAASAGTSP-A 56

Query: 57  LIITEPITEKILNSEDIIVRSS---PIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKIS 113
           + + +     +L S+ ++ R S     +      S W+    +++  +L     + G   
Sbjct: 57  VKVLDVTAPDVLESDKLMYRLSYADAQQTASYANSHWTMMPSQLLTQRLRGALSSRG--- 113

Query: 114 TVVKPNQGIYADYQIISAIRSFEINID-RHCAIITMSLKIINAHDNSLVGQKVFHVEEKL 172
           TV+    G+ A   +   +  FE   D R  +   ++ +      + ++GQ+ F      
Sbjct: 114 TVLTGADGVSAPV-LKVELSEFEQVFDSRSESHAAVTARATLTQGSRVIGQRTFIARAPS 172

Query: 173 EKDNKLHFIQSLNRAFSRISSEIIDW 198
              +     Q+L  A   + ++I  W
Sbjct: 173 SSGDAAGGAQALATASDDLVAQIGAW 198


>gi|153827987|ref|ZP_01980654.1| putative lipoprotein [Vibrio cholerae 623-39]
 gi|148876568|gb|EDL74703.1| putative lipoprotein [Vibrio cholerae 623-39]
          Length = 192

 Score = 67.7 bits (164), Expect = 9e-10,   Method: Composition-based stats.
 Identities = 24/173 (13%), Positives = 74/173 (42%), Gaps = 7/173 (4%)

Query: 28  SCFFHNNP-VNIYDLTESTKYDE-SVQRHIQLIITEPITEKI-LNSEDIIVRSSPIEIQY 84
            C     P V+ Y L  + +  E +  + + L++ +P+     L+++ I+ R S  ++  
Sbjct: 15  GCGGTPQPKVSFYLLPNNPELSELTQPKTLPLLVVQPVELAAYLDTQGIVYRQSETQVIQ 74

Query: 85  LIGSQWSDKLPRMIQLKLIANFEN--NGKISTVVKPNQGIYADYQIISAIRSFEINIDRH 142
              +QW+ +L   +  ++  +     +      +  +      +++   ++ F      +
Sbjct: 75  ARQNQWAQRLSPQLTQRITNDLRRKQSRYWPAPLNASSIQQEHWKLQVRLQRFNGVYTGN 134

Query: 143 CAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEI 195
            A +  + +++N    S++  + F  +  L+       +++L+    ++S++I
Sbjct: 135 -AEVAGNWELLNPKGESML-NQEFSFQVPLKDTGYPALVEALSAGVDQLSTQI 185


>gi|83594243|ref|YP_427995.1| ABC-type transport system auxiliary component-like [Rhodospirillum
           rubrum ATCC 11170]
 gi|83577157|gb|ABC23708.1| ABC-type uncharacterized transport system auxiliary component-like
           [Rhodospirillum rubrum ATCC 11170]
          Length = 203

 Score = 67.7 bits (164), Expect = 9e-10,   Method: Composition-based stats.
 Identities = 28/197 (14%), Positives = 65/197 (32%), Gaps = 7/197 (3%)

Query: 8   IIKKKIISCSLAVLLCTSLSSCFFHN-NPVNI-YDLTESTKYDE--SVQRHIQLIITEPI 63
           I+ +     +        L+ C      P +  Y L  +          +   + +T  +
Sbjct: 2   ILSRISRPLAALFAAGVLLAGCTAAPPAPTDTFYRLDAAEGVMPVLGQPQPRVVEVTRFL 61

Query: 64  TEKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIY 123
              +L    +   S+   ++      W +  P ++Q +L+         + VV P     
Sbjct: 62  AAGVLADRPVAHTSTGRVLEQYAYDFWIETPPVLLQQQLVEYLRAANVFTQVVTPELRAR 121

Query: 124 ADYQIISAIRSFEINIDRHCA---IITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHF 180
            D  I   I  FE  +    A    +++ L +I+   + +     +      +  + L  
Sbjct: 122 TDLTIRGRILRFEHLLPPSGAAGVAVSIELSLIDTATDDVKLLGTYVETVPADNTSVLAA 181

Query: 181 IQSLNRAFSRISSEIID 197
             ++  A +RI +  + 
Sbjct: 182 TSAMREAVARIYARFVA 198


>gi|300692710|ref|YP_003753705.1| hypothetical protein RPSI07_3094 [Ralstonia solanacearum PSI07]
 gi|299079770|emb|CBJ52447.1| conserved exported protein of unknown function [Ralstonia
           solanacearum PSI07]
          Length = 211

 Score = 67.7 bits (164), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 28/183 (15%), Positives = 58/183 (31%), Gaps = 14/183 (7%)

Query: 32  HNNPVNIYDLTESTKYDESVQRHIQLIITEPITEKILNSEDIIVRS---SPIEIQYLIGS 88
              P  +YD   +       +    L + E +    ++   I  R         +    S
Sbjct: 27  PTAPAAVYDFGLAPAAAGGSRLPTALRVAEVVGPGWMDGNAIYYRLAYAQGQRTELYAAS 86

Query: 89  QWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFEINIDRH---CAI 145
           +W +    +   +L       G++     P         +   +  F    DR      +
Sbjct: 87  RWVESPVNLFDARLRNAVAARGQVIGYGLPEVP-----TLRIELVDFSQVFDRPDTSRGV 141

Query: 146 ITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEIIDWTLS-SLP 204
           + +   +  A    LV Q+V   +      +    + +L +A  R   E++DW    +LP
Sbjct: 142 VRLRASVFMARG--LVAQRVVQADVPAPSADAAGGVSALAQASDRAIGEVLDWVAGLALP 199

Query: 205 LSD 207
            + 
Sbjct: 200 AAA 202


>gi|296134759|ref|YP_003642001.1| protein of unknown function DUF330 [Thiomonas intermedia K12]
 gi|295794881|gb|ADG29671.1| protein of unknown function DUF330 [Thiomonas intermedia K12]
          Length = 212

 Score = 67.3 bits (163), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 22/185 (11%), Positives = 63/185 (34%), Gaps = 3/185 (1%)

Query: 27  SSCFFHNNPVN-IYDLTESTKYDESVQRHIQLIITEPITEKILNSEDIIVRSSPIEIQYL 85
            +   +  PV   Y L  +      + +   + +          S  ++   SP  ++  
Sbjct: 28  CALPVNRAPVQQTYRLAATEIRTAPLPQATVIQLLPVRAAAGFQSPAMMYSRSPDTLEPY 87

Query: 86  IGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFEINIDRHCAI 145
             S+W     +++   +         +S V +    + A + +   +   E ++  +   
Sbjct: 88  RDSRWLAPPAQLVGEAIDRTLSRQPWVSAVQQQAVLVNAPWTLHCKLNRLEHDVHANQGT 147

Query: 146 ITMSL--KIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEIIDWTLSSL 203
           + + L   + N   + +     F   + +  ++  HF Q       +    I++ T S++
Sbjct: 148 VHLDLVCDLANQRTSRIAAHWHFDGRQPIAVNDAAHFAQGAQTLLDQALKGIMENTRSAV 207

Query: 204 PLSDN 208
             + +
Sbjct: 208 AAAQS 212


>gi|34558307|ref|NP_908122.1| hypothetical protein WS2020 [Wolinella succinogenes DSM 1740]
 gi|34484026|emb|CAE11022.1| hypothetical protein WS2020 [Wolinella succinogenes]
          Length = 191

 Score = 67.3 bits (163), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 29/174 (16%), Positives = 64/174 (36%), Gaps = 11/174 (6%)

Query: 27  SSCFFHNNPVN-IYDLTESTKYDESV-QRHIQLIITEPITEKILNSEDIIVRSSPIEIQY 84
             C         +Y+LT      +S      +L I  P     ++  +I   +    + Y
Sbjct: 17  GGCLAKEAQAPKLYELTYKPSAPQSSCASKKRLGIATPSALGKVDRVEIPY-NEGSRVGY 75

Query: 85  LIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFEINI---DR 141
            +  +W D    M+Q  L+    ++      + P   +     + S I + E+ +     
Sbjct: 76  YVEHRWVDLPSSMLQKLLLDAL-SSSCFEPFLPPFSAVLPPLVLQSKILTLEVRLRPEGG 134

Query: 142 HCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEI 195
             A+  ++  +     +      V   +E LE+      I+++NRA +++  E+
Sbjct: 135 AVAVAEVAFSLAGEKSH----SWVIRHQEPLERIEASLAIEAMNRALNKVVQEL 184


>gi|327484342|gb|AEA78749.1| probable lipoprotein protein YPO1422 [Vibrio cholerae LMA3894-4]
          Length = 185

 Score = 67.3 bits (163), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 26/173 (15%), Positives = 76/173 (43%), Gaps = 9/173 (5%)

Query: 29  CFFHNNP-VNIYDLTESTKYDES-VQRHIQLIITEPITEKI-LNSEDIIVRSSPIEIQYL 85
           C     P V+ Y L  + +  E    + + L++ +P+     L+++ I+ R S  ++   
Sbjct: 9   CGGTPQPKVSFYLLPNNPELSEHIQPKTLPLLVVQPVELAAYLDTQGIVYRQSETQVIQA 68

Query: 86  IGSQWSDKL-PRMIQLKLIANFEN--NGKISTVVKPNQGIYADYQIISAIRSFEINIDRH 142
             +QW+ +L P++ Q ++  +     +      +  +      +++   ++ F      +
Sbjct: 69  RQNQWAQRLSPQLTQ-RITNDLRRKQSRYWPAPLNASSIQQEHWKLQVRLQRFNGVYTGN 127

Query: 143 CAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEI 195
            A +  + +++N    S++  + F  +  L+       +++L+    ++S++I
Sbjct: 128 -AEVAGNWELLNPKGESML-NQEFSFQVPLKDTGYPALVEALSAGVDQLSTQI 178


>gi|238028749|ref|YP_002912980.1| ABC transporterauxiliary component-like protein [Burkholderia
           glumae BGR1]
 gi|237877943|gb|ACR30276.1| ABC-type uncharacterized transport system auxiliary component-like
           protein [Burkholderia glumae BGR1]
          Length = 214

 Score = 67.3 bits (163), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 27/212 (12%), Positives = 71/212 (33%), Gaps = 10/212 (4%)

Query: 1   MDKKLNKIIKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTE--STKYDESVQRHIQLI 58
           M +      ++  ++ +  VL   +  +          YDL     + +  +      L 
Sbjct: 6   MSRFTVVYARRAALAGTAFVLALLAGCASDAARMSDIRYDLGPIDPSAFVAAPASGTVLT 65

Query: 59  ITEPITEKILNSEDIIVRS---SPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTV 115
           + +       +++    R        I     S+W+    +++  +L A   ++G   TV
Sbjct: 66  VPDMRAPDAFDTDKFAYRLAYADAQRIAAYRDSRWTAPPAQLLTQRLRAALASHG---TV 122

Query: 116 VKPNQGIYADYQIISAIRSFEINIDRH-CAIITMSLKIINAHDNSLVGQKVFHVEEKLEK 174
           +     + A   +   +  FE   D    +   ++++       +++GQ+ F        
Sbjct: 123 LDGGDAVRAPV-LHVELDEFEQVFDGQDQSHGEVAVRATLTRQGTVLGQRSFVSRAPART 181

Query: 175 DNKLHFIQSLNRAFSRISSEIIDWTLSSLPLS 206
            +      +L  A + +  +++ W       S
Sbjct: 182 PDAAGGAAALAAASNELVGQLVAWLAVQASAS 213


>gi|229520654|ref|ZP_04410077.1| hypothetical protein VIF_001179 [Vibrio cholerae TM 11079-80]
 gi|229342209|gb|EEO07204.1| hypothetical protein VIF_001179 [Vibrio cholerae TM 11079-80]
          Length = 192

 Score = 67.3 bits (163), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 24/173 (13%), Positives = 74/173 (42%), Gaps = 7/173 (4%)

Query: 28  SCFFHNNP-VNIYDLTESTKYDE-SVQRHIQLIITEPITEKI-LNSEDIIVRSSPIEIQY 84
            C     P V+ Y L  + +  E +  + + L++ +P+     L+++ I+ R S  ++  
Sbjct: 15  GCAGTPQPKVSFYLLPNNPELSELTQPKTLPLLVVQPVELAAYLDTQGIVYRQSETQVIQ 74

Query: 85  LIGSQWSDKLPRMIQLKLIANFEN--NGKISTVVKPNQGIYADYQIISAIRSFEINIDRH 142
              +QW+ +L   +  ++  +     +      +  +      +++   ++ F      +
Sbjct: 75  ARQNQWAQRLSPQLTQRITNDLRRKQSRYWPAPLNTSSIQQEHWKLQVRLQRFNGVYTGN 134

Query: 143 CAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEI 195
            A +  + +++N    S++  + F  +  L+       +++L+    ++S++I
Sbjct: 135 -AEVAGNWELLNPKGESML-NQEFSFQVPLKDTGYPALVEALSAGVDQLSTQI 185


>gi|153826262|ref|ZP_01978929.1| lipoprotein, putative [Vibrio cholerae MZO-2]
 gi|149740027|gb|EDM54202.1| lipoprotein, putative [Vibrio cholerae MZO-2]
          Length = 192

 Score = 67.3 bits (163), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 24/173 (13%), Positives = 74/173 (42%), Gaps = 7/173 (4%)

Query: 28  SCFFHNNP-VNIYDLTESTKYDE-SVQRHIQLIITEPITEKI-LNSEDIIVRSSPIEIQY 84
            C     P V+ Y L  + +  E +  + + L++ +P+     L+++ I+ R S  ++  
Sbjct: 15  GCGGTPQPKVSFYLLPNNPELSELTQPKTLPLLVVQPVELAAYLDTQGIVYRQSETQVIQ 74

Query: 85  LIGSQWSDKLPRMIQLKLIANFEN--NGKISTVVKPNQGIYADYQIISAIRSFEINIDRH 142
              +QW+ +L   +  ++  +     +      +  +      +++   ++ F      +
Sbjct: 75  ARQNQWAQRLSPQLTQRITNDLRRKQSRYWPAPLNASSIQQEHWKLQVRLQRFNGVYTGN 134

Query: 143 CAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEI 195
            A +  + +++N    S++  + F  +  L+       +++L+    ++S++I
Sbjct: 135 -AEVAGNWELLNPKGESML-NQEFSFQVPLKNTGYPALVEALSAGVDQLSTQI 185


>gi|308272471|emb|CBX29075.1| hypothetical protein N47_J00560 [uncultured Desulfobacterium sp.]
          Length = 200

 Score = 66.9 bits (162), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 29/195 (14%), Positives = 72/195 (36%), Gaps = 6/195 (3%)

Query: 16  CSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIITEPITEKILNSEDIIV 75
            +   L+ +            + Y L         +     +I  +     + NS+ I  
Sbjct: 2   LACVFLMLSGCGGFGGSETKTDFYTLEYDPPKLAGLNTLPFIIKVDRFKSPLYNSDKISY 61

Query: 76  RSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSF 135
           R +  +    +  +W     R++   L  + +N+G    V     G  A + +   +  F
Sbjct: 62  RKNDFQTDEYLYHRWETDPARLVSYFLFRDIKNSGLFKGVFTYEAGFPATHSVSGTVDEF 121

Query: 136 EINIDRHC--AIITMSLKIINAH----DNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFS 189
             +       A++++ + ++  +       ++ QK +   ++  K N     +++++A  
Sbjct: 122 FEDDRGKTWEAVLSLDIVLMAENEPDLSKKILFQKKYSTRKECAKKNPKALAEAMSKAMQ 181

Query: 190 RISSEIIDWTLSSLP 204
            +S +II+    SLP
Sbjct: 182 ELSGQIINDIYKSLP 196


>gi|255020879|ref|ZP_05292935.1| Probable lipoprotein [Acidithiobacillus caldus ATCC 51756]
 gi|254969670|gb|EET27176.1| Probable lipoprotein [Acidithiobacillus caldus ATCC 51756]
          Length = 161

 Score = 66.9 bits (162), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 22/148 (14%), Positives = 59/148 (39%), Gaps = 7/148 (4%)

Query: 57  LIITEPITEKILNSEDIIVR---SSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKIS 113
           L + E      L+S   + R     P  ++Y   ++W+    +M++   + + E +G   
Sbjct: 2   LQVAEVEAPAWLDSSHYLYRLDYRDPEALRYYGDARWAAAPAQMLRAAAVTSLEQSGDWQ 61

Query: 114 TVVKPNQGIYADYQIISAIRSFEINIDRH---CAIITMSLKIINAHDNSLVGQKVFHVEE 170
            V+   +     +++   +++F +N        A +  +  +++    S+V Q+ F    
Sbjct: 62  AVLTRGEAKKR-FRLELRLQNFMLNFSGPDSGQAELAYTATLVDTQSFSVVAQREFLQRV 120

Query: 171 KLEKDNKLHFIQSLNRAFSRISSEIIDW 198
            L +        ++  A +   +++  W
Sbjct: 121 PLRQIGPQGGAAAMAEATAASMAQLRSW 148


>gi|187922501|ref|YP_001894143.1| hypothetical protein Bphyt_0494 [Burkholderia phytofirmans PsJN]
 gi|187713695|gb|ACD14919.1| conserved hypothetical protein [Burkholderia phytofirmans PsJN]
          Length = 208

 Score = 66.9 bits (162), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 28/203 (13%), Positives = 66/203 (32%), Gaps = 10/203 (4%)

Query: 1   MDKKLNKIIKKKIISCSLAVLLCTSLSSCFFHNNPVNI-YDLTESTKYDESVQRHIQLII 59
           M + +++ +        L      +           +I YD    +    +      + +
Sbjct: 1   MSRSIHRFLPTSAALAVLLAFGVLAAGCAGTPAALSDIRYDFGPPSPAASAGTSP-AVKV 59

Query: 60  TEPITEKILNSEDIIVRSS---PIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVV 116
            +     +L S+ ++ R S     +      S W+    +++  +L     + G   TV+
Sbjct: 60  LDVSAPDVLESDKLMYRLSYADAQQTAAYANSHWTMTPSQLLTQRLRGALSSRG---TVL 116

Query: 117 KPNQGIYADYQIISAIRSFEINIDRH-CAIITMSLKIINAHDNSLVGQKVFHVEEKLEKD 175
               G+ A   +   +  FE   D    +   ++ +        ++ Q+ F         
Sbjct: 117 TGADGVAAPV-LKVDLSEFEQVFDSQSESHAAVTARATLTQSGKVLSQRTFIARAPSRSA 175

Query: 176 NKLHFIQSLNRAFSRISSEIIDW 198
           +     Q+L  A   + S+I  W
Sbjct: 176 DAAGGAQALATASDDLVSQIGAW 198


>gi|167892585|ref|ZP_02479987.1| putative lipoprotein [Burkholderia pseudomallei 7894]
          Length = 180

 Score = 66.9 bits (162), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 27/180 (15%), Positives = 61/180 (33%), Gaps = 9/180 (5%)

Query: 1   MDKKLNKIIKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIIT 60
           M   L++  +  +      V+   S  +          YDL  +     S      L + 
Sbjct: 6   MSGSLSRRGRPALALAVALVMASASGCAGTPAALANIRYDLGPAQPAASSGTGP-ALKVL 64

Query: 61  EPITEKILNSEDIIVR---SSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVK 117
           +      LN++  + R   S    I     S+W+    +++  +L      +G+   V+ 
Sbjct: 65  DVSAPDALNTDRFVYRLAYSDAQRIAAYRDSKWTAPPAQLLTQRLRGAL--SGR-GAVLA 121

Query: 118 PNQGIYADYQIISAIRSFEINIDR-HCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDN 176
            + G+ A   +   +  FE   D    +   ++ +     +  ++GQ+ F         +
Sbjct: 122 ADDGVRAPV-LKVELSEFEQVFDGRSESHAAVTARATLTQEGKVLGQRTFVSRAPASTPD 180


>gi|187476648|ref|YP_784671.1| hypothetical protein BAV0133 [Bordetella avium 197N]
 gi|115421234|emb|CAJ47739.1| putative exported protein [Bordetella avium 197N]
          Length = 196

 Score = 66.5 bits (161), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 27/193 (13%), Positives = 69/193 (35%), Gaps = 6/193 (3%)

Query: 17  SLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIITEPITEKILNSEDIIVR 76
           ++AV+L  +  S          +DL         +   + + ++      + ++  I   
Sbjct: 7   AMAVVLTLAGCSVGRVAPQAARFDLGLEAPAQRQLPARVPITLSYSAVPTLNDTGVIWRV 66

Query: 77  SSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFE 136
           +     +   G +W++    +++ +L       G    V+  +    A  Q+   +  FE
Sbjct: 67  ADSTAPKAYAGFRWNEAPASLVRQRLQERLSREG---AVLSDSASPGAP-QLRVELTRFE 122

Query: 137 INI--DRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSE 194
                D   +   + L+ +   +  L+GQ+ F  +      +    + +L +A    + +
Sbjct: 123 QVFAPDGRSSQGQVVLQALVLQNGKLLGQRRFARQADAPTQDAAGGVTALRQATDGAAED 182

Query: 195 IIDWTLSSLPLSD 207
           +  W    LP + 
Sbjct: 183 LAAWLADLLPQAA 195


>gi|33594882|ref|NP_882525.1| hypothetical protein BPP0164 [Bordetella parapertussis 12822]
 gi|33599157|ref|NP_886717.1| hypothetical protein BB0166 [Bordetella bronchiseptica RB50]
 gi|33564958|emb|CAE39905.1| putative exported protein [Bordetella parapertussis]
 gi|33575203|emb|CAE30666.1| putative exported protein [Bordetella bronchiseptica RB50]
          Length = 201

 Score = 65.8 bits (159), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 24/192 (12%), Positives = 61/192 (31%), Gaps = 4/192 (2%)

Query: 17  SLAVLLCTSLSSCFFH--NNPVNIYDLTESTKYDESVQRHIQLIITEPITEKILNSEDII 74
           ++ VL    L+ C       P  ++DL        ++     +++       + ++  I 
Sbjct: 6   AIIVLSALLLAGCGAGRMAAPPALFDLGADVAATPALPARQPIVLAFEAVPYLSDTGVIW 65

Query: 75  VRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRS 134
                        S+W+     +++ +L+    + G +               +    + 
Sbjct: 66  RVGDSASPHAYARSRWASAPAELVRQRLVERLSHQGPVLGAGMGAGLAQVQVTLTRFEQV 125

Query: 135 FEINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSE 194
           F  +       + M   ++   D  +VGQ     E      +    +Q+L +A    + E
Sbjct: 126 FAADGQASVGHVAMQAVLL--QDRQVVGQVRIAREAPAATQDAAGGVQALRQATDAAADE 183

Query: 195 IIDWTLSSLPLS 206
           +  W    +  +
Sbjct: 184 LAGWLAGRVAAA 195


>gi|170734241|ref|YP_001766188.1| ABC-type uncharacterized transport system auxiliary component-like
           protein [Burkholderia cenocepacia MC0-3]
 gi|169817483|gb|ACA92066.1| ABC-type uncharacterized transport system auxiliary component-like
           protein [Burkholderia cenocepacia MC0-3]
          Length = 221

 Score = 65.4 bits (158), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 27/165 (16%), Positives = 59/165 (35%), Gaps = 9/165 (5%)

Query: 39  YDLTESTKYDESVQRHIQLIITEPITEKILNSEDIIVRS---SPIEIQYLIGSQWSDKLP 95
           YDL  ++    +      L + +      L+S+    R        +     S+W+    
Sbjct: 53  YDLGPASSVTTTGSGP-ALKVLDVAAPDALDSDKFAYRLAYADAQHVAVYRDSRWTAPPA 111

Query: 96  RMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFEINIDRH-CAIITMSLKIIN 154
           +++  +L     + G   TV++   G+ A   +   +  FE   D    +   ++ +   
Sbjct: 112 QLLTQRLRGALSSRG---TVLEGADGVRAP-TLKVDLSEFEQVFDGQSQSHGAVTARATL 167

Query: 155 AHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEIIDWT 199
             D  ++GQ+ F         +     ++L  A   + S+I  W 
Sbjct: 168 MLDGKVLGQRTFVARAPSSTPDAAGGARALAAASDELVSQIAAWV 212


>gi|327399068|ref|YP_004339937.1| hypothetical protein Hipma_0908 [Hippea maritima DSM 10411]
 gi|327181697|gb|AEA33878.1| hypothetical protein Hipma_0908 [Hippea maritima DSM 10411]
          Length = 187

 Score = 65.4 bits (158), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 30/186 (16%), Positives = 67/186 (36%), Gaps = 9/186 (4%)

Query: 18  LAVLLCTSLSSCFFHN-NPVNIYDLT-ESTKYDESVQRHIQLIITEPITEKILNSEDIIV 75
           L +++   L  C FH   P+  Y L  +   +    +    +++++       +S  I  
Sbjct: 4   LILIVFLFLVGCSFHKLPPLREYTLNLKPIAFKLDRKVRKTIVVSDVDCGAPFDSTFIFF 63

Query: 76  RSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSF 135
           +    E       +W   +  M +  +                   +  +Y++   I  F
Sbjct: 64  KKGKFEFDRYGNVRWIKPVCLMYKTSIEHVLNKTHLFV----SGDILRPNYRLSYVIYDF 119

Query: 136 E--INIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISS 193
           E     +R  AI  +  ++ + ++  +     F    K+  ++    I SLN  F+   S
Sbjct: 120 EPLFLANRTYAICNIEFRLKDENNGKIY-IHAFSKSIKINGNSFDDVISSLNDLFNLSLS 178

Query: 194 EIIDWT 199
           ++I+W 
Sbjct: 179 DLINWI 184


>gi|167844081|ref|ZP_02469589.1| putative lipoprotein [Burkholderia pseudomallei B7210]
          Length = 175

 Score = 65.4 bits (158), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 27/175 (15%), Positives = 60/175 (34%), Gaps = 9/175 (5%)

Query: 1   MDKKLNKIIKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIIT 60
           M   L++  +  +      V+   S  +          YDL  +     S      L + 
Sbjct: 6   MSGSLSRRGRPALALAVALVMASASGCAGTPAALANIRYDLGPAQPAASSGTGP-ALKVL 64

Query: 61  EPITEKILNSEDIIVR---SSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVK 117
           +      LN++  + R   S    I     S+W+    +++  +L      +G+   V+ 
Sbjct: 65  DVSAPDALNTDRFVYRLAYSDAQRIAVYRDSKWTAPPAQLLTQRLRGAL--SGR-GAVLA 121

Query: 118 PNQGIYADYQIISAIRSFEINIDR-HCAIITMSLKIINAHDNSLVGQKVFHVEEK 171
            + G+ A   +   +  FE   D    +   ++ +     +  ++GQ+ F     
Sbjct: 122 GDDGVRAPV-LKVELSEFEQVFDGRSESHAAVTARATLTQEGKVLGQRTFVSRAP 175


>gi|33591359|ref|NP_879003.1| hypothetical protein BP0101A [Bordetella pertussis Tohama I]
 gi|33571001|emb|CAE40480.1| putative exported protein [Bordetella pertussis Tohama I]
          Length = 200

 Score = 65.4 bits (158), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 24/184 (13%), Positives = 59/184 (32%), Gaps = 5/184 (2%)

Query: 17  SLAVLLCTSLSSCFFH--NNPVNIYDLTESTKYDESVQRHIQLIITEPITEKILNSEDII 74
           ++ VL    L+ C       P  ++DL        ++     +++       + ++  I 
Sbjct: 6   AIIVLSALLLAGCGAGRMAAPPALFDLGADVAATPALPARQPIVLAFEAVPYLSDTGVIW 65

Query: 75  VRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRS 134
                        S+W+     +++ +L+    + G +               +    + 
Sbjct: 66  RVGDSASPHAYARSRWASAPAELVRQRLVERLSHQGPVLGAGMGAGLAQVQVTLTFE-QV 124

Query: 135 FEINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSE 194
           F  +       + M   ++   D  +VGQ     E      +    +Q+L +A    + E
Sbjct: 125 FAADGQASVGHVAMQAVLL--QDRQVVGQVRIAREAPAATQDAAGGVQALRQATDAAADE 182

Query: 195 IIDW 198
           +  W
Sbjct: 183 LAGW 186


>gi|94263141|ref|ZP_01286959.1| hypothetical protein MldDRAFT_1501 [delta proteobacterium MLMS-1]
 gi|93456512|gb|EAT06626.1| hypothetical protein MldDRAFT_1501 [delta proteobacterium MLMS-1]
          Length = 211

 Score = 65.4 bits (158), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 30/188 (15%), Positives = 71/188 (37%), Gaps = 8/188 (4%)

Query: 25  SLSSCFFHNNPV--NIYDLTESTKYDESVQRHIQLI-ITEPITEKILNSEDIIVRSSPIE 81
           + ++C     P   N + L  +   D       +++ + +         ++I+ R    +
Sbjct: 19  ATAACAPQKQPPERNFFVLEAARAVDNHWHEPQKILSVRDFEVSPGFRGKEIVYRKGRGQ 78

Query: 82  IQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFEINIDR 141
            +    +Q+      M+         ++G    V+       ADY +  A+ S   +   
Sbjct: 79  SEADFYNQYFIPPGAMLTDATREWLADSGMFEAVIPMGSHKEADYLLEGAVISLYGDFQE 138

Query: 142 ---HCAIITMSLKII--NAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEII 196
                A++ M   ++  +  D  L+  + +  +  L      H +Q LN+A +RI +++ 
Sbjct: 139 RREPAAVLRMQFLLLEDDGPDYRLLMHRTYREQVSLPGTGAGHVVQGLNKALTRILTQLE 198

Query: 197 DWTLSSLP 204
               S++P
Sbjct: 199 KDMASAIP 206


>gi|254224892|ref|ZP_04918507.1| lipoprotein, putative [Vibrio cholerae V51]
 gi|297579330|ref|ZP_06941258.1| conserved hypothetical protein [Vibrio cholerae RC385]
 gi|125622580|gb|EAZ50899.1| lipoprotein, putative [Vibrio cholerae V51]
 gi|297536924|gb|EFH75757.1| conserved hypothetical protein [Vibrio cholerae RC385]
          Length = 192

 Score = 65.4 bits (158), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 24/173 (13%), Positives = 74/173 (42%), Gaps = 7/173 (4%)

Query: 28  SCFFHNNP-VNIYDLTESTKYDE-SVQRHIQLIITEPITEKI-LNSEDIIVRSSPIEIQY 84
            C     P V+ Y L  + +  E +  + + L++ +P+     L+++ ++ R S  ++  
Sbjct: 15  GCGGTPQPKVSFYLLPNNPELSELTQPKGLPLLVVQPVELAAYLDTQGVVYRQSETQVIQ 74

Query: 85  LIGSQWSDKLPRMIQLKLIANFE--NNGKISTVVKPNQGIYADYQIISAIRSFEINIDRH 142
              +QW+ +L   +  ++  +     +      +  +      +++   ++ F      +
Sbjct: 75  ARQNQWAQRLSPQLTQRITNDLRHKQSRYWPAPLNASSIQQEHWKLQVRLQRFNGVYTGN 134

Query: 143 CAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEI 195
            A +  S +++N    S++  + F  +  L+       +++L+    ++S++I
Sbjct: 135 -AEVAGSWELLNPKGESML-NQEFSFQVPLKDTGYPALVEALSAGIDQLSTQI 185


>gi|218780627|ref|YP_002431945.1| ABC transporter [Desulfatibacillum alkenivorans AK-01]
 gi|218762011|gb|ACL04477.1| ABC-type transport system auxiliary component-like protein
           [Desulfatibacillum alkenivorans AK-01]
          Length = 212

 Score = 65.0 bits (157), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 31/195 (15%), Positives = 70/195 (35%), Gaps = 10/195 (5%)

Query: 8   IIKKKIISCSLAVLLCTSLSSCF---FHNNPVNIYDLT-ESTKYDESVQRHIQLIITEPI 63
           +   +II      L+  +L +C        P+  Y L  ES K +++      ++I    
Sbjct: 1   MKPGRIIPIICTALMLGALPACNISRTAATPITHYTLEYESPKMEKAEVLPYVIMIKRFS 60

Query: 64  TEKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIY 123
                N   II R            +W      +    L  +F+     + V+  +  + 
Sbjct: 61  VSPDYNMLPIIYRDKAFVRNTYSYHRWRANPGDLATYYLARDFKAQSAFTAVLSYDSNLR 120

Query: 124 ADYQIISAIRSFEINIDRH--CAIITMSLKIINAH----DNSLVGQKVFHVEEKLEKDNK 177
             + +   +  F          A++  S+ ++  H       +V QK + + +K ++ N 
Sbjct: 121 MTHTLEGVVEEFYERDGEDSWEAVLGFSVTLVKMHEPDVTRQIVFQKQYRLTQKADEKNP 180

Query: 178 LHFIQSLNRAFSRIS 192
               +++++A  + S
Sbjct: 181 ESIAKAMSQAMEKAS 195


>gi|239904660|ref|YP_002951398.1| hypothetical protein DMR_00210 [Desulfovibrio magneticus RS-1]
 gi|239794523|dbj|BAH73512.1| hypothetical protein [Desulfovibrio magneticus RS-1]
          Length = 211

 Score = 65.0 bits (157), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 32/204 (15%), Positives = 65/204 (31%), Gaps = 16/204 (7%)

Query: 11  KKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIITEPITEKILNS 70
             +   +L  LL  SL+ CF    P   Y      +         Q  +  PI  K L +
Sbjct: 5   SLLGRVALTGLLAVSLAGCFGKPPPEQRYLRVALGETPCPGSASQQHRL--PIAFKPLKT 62

Query: 71  ----EDIIVRSSPI-----EIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQG 121
               +   V ++        +QY     W      ++   L    E      T V     
Sbjct: 63  MENLDRTSVMTAQNNVLTASLQYY----WEGAPQDVVGAALRQGLECQSSAVTPVDYQPR 118

Query: 122 IYADYQIISAIRSFEINI-DRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHF 180
           +     +   + +F ++  D    ++++ L + +    + +    F+    L        
Sbjct: 119 VDRSAVLSGELTAFNVDYTDGGRFVVSLRLDLWSKDMGTRLSSGEFNAYAPLTDFKGSTI 178

Query: 181 IQSLNRAFSRISSEIIDWTLSSLP 204
             + + A  R+  +++ W    LP
Sbjct: 179 AAAASDALGRVVPKVVVWMDQGLP 202


>gi|237749355|ref|ZP_04579835.1| lipoprotein [Oxalobacter formigenes OXCC13]
 gi|229380717|gb|EEO30808.1| lipoprotein [Oxalobacter formigenes OXCC13]
          Length = 205

 Score = 65.0 bits (157), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 25/203 (12%), Positives = 70/203 (34%), Gaps = 19/203 (9%)

Query: 10  KKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIITEPITEKILN 69
            +  ++  L+V L     +      P  +YD                 +I   +      
Sbjct: 11  FRLFVAAILSVFLL-GACALGDGRPPATLYDFGPLKTNGLVQLPDDMPVIRTRVHSPEWM 69

Query: 70  SEDIIVRS----SPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIY-- 123
           SE+++       +  ++++   S W+    ++ + +L      +  +++      G    
Sbjct: 70  SENLMYYRLNYVNDQQVRFYTESSWNTNPAKLFKNRL------DSYLASAGSTVTGFRTT 123

Query: 124 -ADYQIISAIRSFEINIDRHCA---IITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLH 179
                +   I  F  +     A    +++   +    D  L+ QK F  +      +   
Sbjct: 124 SPTLTVRVYIEDFGQHFTSPSASVGHVSLRASLFRGKD--LIAQKSFTRDIPATTADAAG 181

Query: 180 FIQSLNRAFSRISSEIIDWTLSS 202
            ++++ +A   +  +I++W ++S
Sbjct: 182 GVRAMAQATDAVIGDILNWMVAS 204


>gi|91776721|ref|YP_546477.1| putative lipoprotein [Methylobacillus flagellatus KT]
 gi|91710708|gb|ABE50636.1| putative lipoprotein [Methylobacillus flagellatus KT]
          Length = 198

 Score = 65.0 bits (157), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 27/204 (13%), Positives = 66/204 (32%), Gaps = 27/204 (13%)

Query: 12  KIISCSLAVLLCTSL-SSCFFHNNPVNIYDLTESTKYDESVQRHIQLIITEPITEKILNS 70
            + +  + VL  ++  SS      P++ YD       D   +    L + +      +  
Sbjct: 6   SMAALLMTVLSLSACMSSIKPDTKPLDFYDF---GLQDADNRISFTLPLEKLDATDAIQH 62

Query: 71  EDIIVR---SSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQ 127
            +I  R     P ++     S+WS     +++ K+                 Q +     
Sbjct: 63  SNIRYRLHYKHPSQVFAYAESRWSTLPVDLLRQKVANA--------------QPLNTTCG 108

Query: 128 IISAIRSFEI---NIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSL 184
           +   I +F+    +      ++ +  ++ +     L+   +       +  +    + +L
Sbjct: 109 LKIQIVTFDQVFDDASSSQGVVQLQAELTDRRSRKLLASTLISARHAAQSADARGGVAAL 168

Query: 185 NRAFSRISSEIIDW---TLSSLPL 205
           N A +    +  DW   T  + P 
Sbjct: 169 NIASTEALQQAADWARETSQAAPA 192


>gi|134297084|ref|YP_001120819.1| ABC transporter auxiliary component-like protein [Burkholderia
           vietnamiensis G4]
 gi|134140241|gb|ABO55984.1| ABC-type uncharacterized transport system auxiliary component-like
           protein [Burkholderia vietnamiensis G4]
          Length = 207

 Score = 64.2 bits (155), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 30/203 (14%), Positives = 69/203 (33%), Gaps = 9/203 (4%)

Query: 1   MDKKLNKIIKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIIT 60
           M + L + ++    + +L  L   +  +          YDL  +     +      L + 
Sbjct: 1   MPRILERALRPAATALALLTLALAAGCAGNSAALSNVRYDLGPAATVGSTGTGS-ALKVL 59

Query: 61  EPITEKILNSEDIIVRS---SPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVK 117
           +      L+S+  + R              S+W+    +++  +L A   + G    V++
Sbjct: 60  DIAAPDALDSDKFVYRLAYADAQRTAVYRDSRWTAPPAQLLTQRLRAALSSRG---AVLE 116

Query: 118 PNQGIYADYQIISAIRSFEINIDRH-CAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDN 176
            + G+ A   +   +  FE   D    +   ++ +     D  ++GQ  F         +
Sbjct: 117 GSDGVRAP-TLKVDLTEFEQVFDGQSQSHGAVTARATLMQDGKVLGQHTFVSRAPSSTPD 175

Query: 177 KLHFIQSLNRAFSRISSEIIDWT 199
                 +L  A   + ++I  W 
Sbjct: 176 AAGGASALAAASDELVAQIAAWV 198


>gi|221069466|ref|ZP_03545571.1| protein of unknown function DUF330 [Comamonas testosteroni KF-1]
 gi|220714489|gb|EED69857.1| protein of unknown function DUF330 [Comamonas testosteroni KF-1]
          Length = 227

 Score = 64.2 bits (155), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 36/211 (17%), Positives = 73/211 (34%), Gaps = 28/211 (13%)

Query: 12  KIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIITEPITEKILNSE 71
           +++  S  VL   + S           YDL  +     +       +   P+    + + 
Sbjct: 15  RLLGTSSLVLALAACSGLPTAPTQPVRYDLGVADLAAPAANAAAASVAPVPLVLAEVQAP 74

Query: 72  -----------DIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQ 120
                       +    S  +++    ++WS    +M++ +L       G    V+    
Sbjct: 75  GLPEGLTAMFYRLNYSDS-QQLRAYQNARWSLPPSQMVEQRLRMRL---GLERPVLSGKD 130

Query: 121 GIY---AD----YQIISAIRSFEINIDRHC---AIITMSLKII---NAHDNSLVGQKVFH 167
            +    AD     Q+   +  F    D      A++ +S  +I    +  N L+GQKVF 
Sbjct: 131 NVRPLLADKRSIAQLRVTVDEFNQVFDSASSSRALLRLSASLIGAGESAGNQLLGQKVFT 190

Query: 168 VEEKLEKDNKLHFIQSLNRAFSRISSEIIDW 198
           VE      +     Q++ RA    ++++  W
Sbjct: 191 VEVPSSSADAAGGAQAMARAVDEAAAQLSRW 221


>gi|187927279|ref|YP_001897766.1| putative lipoprotein [Ralstonia pickettii 12J]
 gi|309780021|ref|ZP_07674774.1| lipoprotein [Ralstonia sp. 5_7_47FAA]
 gi|187724169|gb|ACD25334.1| putative lipoprotein [Ralstonia pickettii 12J]
 gi|308921191|gb|EFP66835.1| lipoprotein [Ralstonia sp. 5_7_47FAA]
          Length = 221

 Score = 63.8 bits (154), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 30/210 (14%), Positives = 72/210 (34%), Gaps = 15/210 (7%)

Query: 5   LNKIIKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIITEPIT 64
           L+ + ++     +L  L   +  S      P  +YD   +       +    L + +   
Sbjct: 4   LSAVFRRACALPALMALSLLAACSSAPVA-PAALYDFGLAPAASAGARLPTALRVADVAG 62

Query: 65  EKILNSEDIIVRS---SPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQG 121
              ++   I  R              S+W +    +   +L       G+   +  P   
Sbjct: 63  PGWMDGNAIYYRLAYAQGQRTDAYANSRWVESPVSLFDARLRNA--AAGRGQVIGYPTPD 120

Query: 122 IYADYQIISAIRSFEINIDRHCA---IITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKL 178
           + +   +   +  F    DR  A   ++ +   +  A    ++ Q+V   +      +  
Sbjct: 121 VPS---LRVELVDFSQVFDRPDASRGVVRLRATVSLARG--VIDQRVVQADAPAPSPDAA 175

Query: 179 HFIQSLNRAFSRISSEIIDWTLSSLPLSDN 208
             + +L +A  +   E++DW ++ LPL+ +
Sbjct: 176 GGVAALTQASDKAIGEVLDW-VAGLPLAAS 204


>gi|113866162|ref|YP_724651.1| ABC-type transporter, auxiliary component [Ralstonia eutropha H16]
 gi|113524938|emb|CAJ91283.1| ABC-type transporter, auxiliary component [Ralstonia eutropha H16]
          Length = 229

 Score = 63.8 bits (154), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 28/205 (13%), Positives = 62/205 (30%), Gaps = 19/205 (9%)

Query: 6   NKIIKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDES-----VQRHIQLIIT 60
           + I + +      A  L  S  +    N+P   YDL                R  +L + 
Sbjct: 27  SAISRLQAALLLAAAGLALSGCALTRGNDPTVTYDLGPPAATTPGNGNPAPARLPKLRVA 86

Query: 61  EPITEKILNSEDIIVRSS---PIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVK 117
           +      L+   +  R        +Q     +W     R+   +L       G +S    
Sbjct: 87  QTDGPNWLDGNALFYRLQYAQAQRLQAYATQRWVMSPTRLFDERLREAVAARGTLSWFGD 146

Query: 118 PNQGIYADYQIISAIRSFEINIDR---HCAIITMSLKIINAHDNSLVGQKVFHVEEKLEK 174
            +        +   +  F+   D       ++ +   +       ++GQ+ F        
Sbjct: 147 SSVP-----ALKVDLIEFDQVFDSATTSEGVVRLRATVFQHG---MLGQQTFEARRPAAS 198

Query: 175 DNKLHFIQSLNRAFSRISSEIIDWT 199
            +    +++L  A   + + ++DW 
Sbjct: 199 ADGAGGVKALAEASDAVIAALLDWI 223


>gi|107023830|ref|YP_622157.1| ABC-type uncharacterized transport system auxiliary component-like
           [Burkholderia cenocepacia AU 1054]
 gi|116690916|ref|YP_836539.1| ABC-type uncharacterized transport system auxiliary component-like
           protein [Burkholderia cenocepacia HI2424]
 gi|206559098|ref|YP_002229858.1| putative lipoprotein [Burkholderia cenocepacia J2315]
 gi|105894019|gb|ABF77184.1| ABC-type uncharacterized transport system auxiliary component-like
           protein [Burkholderia cenocepacia AU 1054]
 gi|116649005|gb|ABK09646.1| ABC-type uncharacterized transport system auxiliary component-like
           protein [Burkholderia cenocepacia HI2424]
 gi|198035135|emb|CAR51009.1| putative lipoprotein [Burkholderia cenocepacia J2315]
          Length = 207

 Score = 63.8 bits (154), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 27/165 (16%), Positives = 59/165 (35%), Gaps = 9/165 (5%)

Query: 39  YDLTESTKYDESVQRHIQLIITEPITEKILNSEDIIVRS---SPIEIQYLIGSQWSDKLP 95
           YDL  ++    +      L + +      L+S+    R        +     S+W+    
Sbjct: 39  YDLGPASSVTTTGSGP-ALKVLDVAAPDALDSDKFAYRLAYADAQHVAVYRDSRWTAPPA 97

Query: 96  RMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFEINIDRH-CAIITMSLKIIN 154
           +++  +L     + G   TV++   G+ A   +   +  FE   D    +   ++ +   
Sbjct: 98  QLLTQRLRGALSSRG---TVLEGADGVRAP-TLKVDLSEFEQVFDGQSQSHGAVTARATL 153

Query: 155 AHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEIIDWT 199
             D  ++GQ+ F         +     ++L  A   + S+I  W 
Sbjct: 154 MLDGKVLGQRTFVARAPSSTPDAAGGARALAAASDELVSQIAAWV 198


>gi|119897985|ref|YP_933198.1| hypothetical protein azo1694 [Azoarcus sp. BH72]
 gi|119670398|emb|CAL94311.1| conserved hypothetical protein [Azoarcus sp. BH72]
          Length = 216

 Score = 63.8 bits (154), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 24/193 (12%), Positives = 56/193 (29%), Gaps = 14/193 (7%)

Query: 10  KKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTK-YDESVQRHIQLIITEPITEKIL 68
           ++ I    LAV L T   S       V  ++L                + +  P   +  
Sbjct: 14  RRLIPGVLLAVALVTGCGSIGKPPRSVASFELGAIEARVLPPGAVPAAVEVRAPSWLESA 73

Query: 69  NSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQI 128
             +  +    P + +    S+W      M+   L    +  G      +          +
Sbjct: 74  QMQYRLAWVEPQQRRSFADSRWIAPPREMLAQALERGLKGAGTAGGSCR----------L 123

Query: 129 ISAIRSFEINIDRHCA---IITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLN 185
              +  F  + D   A    + +    + A   +++  + F +       +     ++  
Sbjct: 124 RVELDEFVQDFDSASASTVTLGVRASRLPARGGAVLASRAFQISVPAPSADAAGGARAHR 183

Query: 186 RAFSRISSEIIDW 198
            A  ++  +I  W
Sbjct: 184 AATQQLVDDIGRW 196


>gi|330818437|ref|YP_004362142.1| ABC-type uncharacterized transport system auxiliary component-like
           protein [Burkholderia gladioli BSR3]
 gi|327370830|gb|AEA62186.1| ABC-type uncharacterized transport system auxiliary component-like
           protein [Burkholderia gladioli BSR3]
          Length = 214

 Score = 63.4 bits (153), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 31/200 (15%), Positives = 75/200 (37%), Gaps = 12/200 (6%)

Query: 7   KIIKKKIISCSLAVLLCTSLSSCFFHNNPVNI--YDLTE--STKYDESVQRHIQLIITEP 62
             +  +  +   A+LL T L+ C      ++   YDL    ++    +      + + + 
Sbjct: 10  SFLSARRAAALGAMLLFTLLAGCAGDAARMSNIRYDLGPLDTSSLALAPASGSVIKVLDV 69

Query: 63  ITEKILNSEDIIVRS---SPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPN 119
                 +++    R        I     S+W+    +++  +L A     G   TV++  
Sbjct: 70  RAPDAFDTDKFAYRLAYADAQRIATYRDSRWTAPPAQLLTQRLRAALAARG---TVLEGG 126

Query: 120 QGIYADYQIISAIRSFEINIDRHC-AIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKL 178
             + A   +   + +FE   D    +   ++++    HD +++GQ+ F         +  
Sbjct: 127 DAVRASV-LHVELNTFEQVFDGQAQSHGEVAVRATLTHDGAVLGQRSFVARAPASTPDAA 185

Query: 179 HFIQSLNRAFSRISSEIIDW 198
               +L  A + + ++I+ W
Sbjct: 186 GGASALAAASNELVAQIVAW 205


>gi|53802471|ref|YP_112895.1| putative lipoprotein [Methylococcus capsulatus str. Bath]
 gi|53756232|gb|AAU90523.1| putative lipoprotein [Methylococcus capsulatus str. Bath]
          Length = 201

 Score = 63.4 bits (153), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 37/194 (19%), Positives = 72/194 (37%), Gaps = 11/194 (5%)

Query: 9   IKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYD---ESVQRHIQLIITEPITE 65
           ++   ++ SL  LL   L+ C    +    Y L+   +        +R I L +      
Sbjct: 6   MRSTFLTASLGALL---LTGCGTSPD-TRFYVLSAVQEPARALAGQEREIALGVGPVELP 61

Query: 66  KILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPN--QGIY 123
           + L+   I+ R  P E+Q     +W++ L   +   L  N         VV     +   
Sbjct: 62  EYLDRPQIVTRRDPNELQLAEFDKWAESLKDGVTQVLAENLATRLPSRKVVTYPWKRSAQ 121

Query: 124 ADYQIISAIRSFEINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQS 183
            DYQ++  +  FE +       +  S+   +     LV  +     E     +    + +
Sbjct: 122 VDYQLVVKVTRFEGSGGEAVLSVRWSVSSGDGKTELLV--RESRYAEPAAGTDYRATVAA 179

Query: 184 LNRAFSRISSEIID 197
           +NRA +R S ++ +
Sbjct: 180 MNRALARFSRDVAE 193


>gi|311109428|ref|YP_003982281.1| hypothetical protein AXYL_06273 [Achromobacter xylosoxidans A8]
 gi|310764117|gb|ADP19566.1| hypothetical protein AXYL_06273 [Achromobacter xylosoxidans A8]
          Length = 200

 Score = 63.4 bits (153), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 24/194 (12%), Positives = 65/194 (33%), Gaps = 6/194 (3%)

Query: 12  KIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIITEPITEKILNSE 71
           K+ S  L + L  +         P +++DL   ++   ++     + +       + ++ 
Sbjct: 3   KMRSAVLILTLALAGCGIGRVAAPPSVFDLGLDSRPAPALPARETIALVFQAVPSLSDTG 62

Query: 72  DIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISA 131
            I         +     +W+     +++ +L       G    V+     +    Q+  +
Sbjct: 63  VIWRVGDSAAPKAYASYRWASPPADLVRQRLTERLSRQGP---VLDERVTLQTP-QLQVS 118

Query: 132 IRSFEI--NIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFS 189
           +  FE     D   +   + L+ +     S++GQ            +    + +L  A  
Sbjct: 119 LSQFEQVFAADGQSSEGRVLLQAVLLSGRSVLGQTRIEARAPAPTQDAQGGVTALRLATD 178

Query: 190 RISSEIIDWTLSSL 203
             + ++  W  ++L
Sbjct: 179 DAADQLAQWLATTL 192


>gi|241661800|ref|YP_002980160.1| hypothetical protein Rpic12D_0178 [Ralstonia pickettii 12D]
 gi|240863827|gb|ACS61488.1| protein of unknown function DUF330 [Ralstonia pickettii 12D]
          Length = 221

 Score = 63.4 bits (153), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 27/201 (13%), Positives = 65/201 (32%), Gaps = 14/201 (6%)

Query: 5   LNKIIKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIITEPIT 64
           L+ + ++     +L  L   +  S      P  +YD   +       +    L + +   
Sbjct: 4   LSAVFRRASALPALMALSLLAACSSAPVA-PAALYDFGLAPAASAGARLPTALRVADVAG 62

Query: 65  EKILNSEDIIVRS---SPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQG 121
              ++   I  R              S+W +    +   +L       G+   +  P   
Sbjct: 63  PGWMDGNAIYYRLAYAQGQRTDAYANSRWVESPVSLFDARLRNA--AAGRGQVIGYPTPD 120

Query: 122 IYADYQIISAIRSFEINIDRHCA---IITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKL 178
           + +   +   +  F    DR  A   ++ +   +  A    ++ Q+V   +      +  
Sbjct: 121 VPS---LRVELVDFSQVFDRPDASRGVVRLRATVSLARG--VIDQRVVQADAPAPSPDAA 175

Query: 179 HFIQSLNRAFSRISSEIIDWT 199
             + +L +A  +   E++DW 
Sbjct: 176 GGVAALTQASDKAIGEVLDWV 196


>gi|307545042|ref|YP_003897521.1| hypothetical protein HELO_2452 [Halomonas elongata DSM 2581]
 gi|307217066|emb|CBV42336.1| K09857 hypothetical protein [Halomonas elongata DSM 2581]
          Length = 196

 Score = 63.1 bits (152), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 35/190 (18%), Positives = 71/190 (37%), Gaps = 6/190 (3%)

Query: 12  KIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQ-LIITEPITEKI-LN 69
           ++ +   A L    LS C     P   Y L ++   D+++    + L++  PI     L+
Sbjct: 3   RLANLFAASLAALWLSGCATGGTPPTHYTLPDAPLADDAIDASTERLLVIRPIRLARYLD 62

Query: 70  SEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYAD--YQ 127
            E I+ +   I +Q   G QW++ L R ++  L          + ++        D    
Sbjct: 63  VEGIVFQLDDITVQQAKGHQWAEPLGRQLERGLRDRLATRLPDTRIMLDGDTARGDAPLS 122

Query: 128 IISAIRSFEINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRA 187
           +   +  F+   D   A+     ++       L+    F +   LE D     +Q+L + 
Sbjct: 123 LRLEMDRFQGRHDG-MAVAEGRWQL-RDASGELLALTPFSLTTPLEADGYPALVQALGQD 180

Query: 188 FSRISSEIID 197
             R++  +  
Sbjct: 181 LDRLADRLAT 190


>gi|189426290|ref|YP_001953467.1| hypothetical protein Glov_3241 [Geobacter lovleyi SZ]
 gi|189422549|gb|ACD96947.1| protein of unknown function DUF330 [Geobacter lovleyi SZ]
          Length = 199

 Score = 63.1 bits (152), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 30/193 (15%), Positives = 75/193 (38%), Gaps = 11/193 (5%)

Query: 9   IKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHI-QLIITEPITEKI 67
           +K  + +    +     L+ C         Y LT         +     + I      ++
Sbjct: 3   VKPLLAAIVYGLTGLLVLAGCGRSPQ-TTFYTLTPLVAEMTIPRVTGPSIAIASVTLPEL 61

Query: 68  LNSEDIIVRSSPIEIQYLIGSQWSDKL----PRMIQLKLIANFENNGKISTVVKPNQGIY 123
           ++   ++V  +   +  L   +W++ L    PR++    I+   N+ ++S   +      
Sbjct: 62  IDRPQLVVPDAGTRVAILESHRWAEPLKSAIPRLLADN-ISRLMNSDRVSAYPQHAAN-S 119

Query: 124 ADYQIISAIRSFEINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQS 183
           ADY++   ++ FE+    +  ++    +I +A D   V  +   + E +   +    +  
Sbjct: 120 ADYRLFVDLQRFELT--GNTVVVDALWEIRSAKDTRPVTGRS-KMVETIGSADYEAVVAG 176

Query: 184 LNRAFSRISSEII 196
            +RA + +S E++
Sbjct: 177 YSRAVAALSKEMV 189


>gi|34498001|ref|NP_902216.1| hypothetical protein CV_2546 [Chromobacterium violaceum ATCC 12472]
 gi|34103857|gb|AAQ60217.1| conserved hypothetical protein [Chromobacterium violaceum ATCC
           12472]
          Length = 197

 Score = 62.7 bits (151), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 27/181 (14%), Positives = 65/181 (35%), Gaps = 5/181 (2%)

Query: 19  AVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIITEPITEKILNSEDIIVRSS 78
           AV L  +L+ C         Y L          Q   ++++        L+   +++   
Sbjct: 8   AVFLAAALAGCASPQ--SRFYGLDAPAAPQAQAQFGKRVLLGPVSLPAALDRPQLVLDMG 65

Query: 79  PIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGI--YADYQIISAIRSFE 136
             E++     +WS  L R++  +L         +++V    Q      + +I   +R   
Sbjct: 66  GGELKLQEFDRWSAPLDRLLAQRLSLGVARASGVASVYAYPQPGMDGGELRIAVDVRGLS 125

Query: 137 INIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEII 196
           +   +  A +  + ++ NA D  ++ +  F   + +  D     +  L      ++++I 
Sbjct: 126 LKPGQGAA-LEAAWQLQNAADGRILARGGFSRSQPVASDQPGALLAGLQTLLDGLAADIA 184

Query: 197 D 197
            
Sbjct: 185 A 185


>gi|300115317|ref|YP_003761892.1| hypothetical protein Nwat_2813 [Nitrosococcus watsonii C-113]
 gi|299541254|gb|ADJ29571.1| protein of unknown function DUF330 [Nitrosococcus watsonii C-113]
          Length = 209

 Score = 62.7 bits (151), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 33/184 (17%), Positives = 67/184 (36%), Gaps = 10/184 (5%)

Query: 20  VLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQ---LIITEPITEKILNSEDIIVR 76
           +     L +C   +    +Y LT +T    S + H+    LI+      + L    I+  
Sbjct: 1   MAAVFMLGACATTHPQPWLYSLTTATSPAPSNETHVARTALIMNPIHAAEFLQHAGIVYE 60

Query: 77  SSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADY---QIISAIR 133
           ++P  +      +W+D L   +   +  +     ++  V        A     Q+     
Sbjct: 61  TAPHRLNVARQHRWADPLTVQLHQYIYNSLTR--QLPAVAVYPNTGNAPLKAWQLTVEFN 118

Query: 134 SFEINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISS 193
           SF    D   A++    ++    D  +V Q  F+    L +D     + +L++  +RI+ 
Sbjct: 119 SFHGRFDGK-ALVAGGWRL-RNGDGGVVAQGSFNQAIPLTEDGYEALVAALSKGLARIAD 176

Query: 194 EIID 197
            I  
Sbjct: 177 SIAG 180


>gi|261211868|ref|ZP_05926155.1| putative lipoprotein [Vibrio sp. RC341]
 gi|260839218|gb|EEX65850.1| putative lipoprotein [Vibrio sp. RC341]
          Length = 192

 Score = 62.7 bits (151), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 32/183 (17%), Positives = 74/183 (40%), Gaps = 7/183 (3%)

Query: 18  LAVLLCTSLSSCFFHNNPVNIYDLTESTKY--DESVQRHIQLIITEPITEKI-LNSEDII 74
           L +LL T    C     P N + L  +     D +  +++ L+I +P+     L+++ I+
Sbjct: 5   LLMLLATLFVGCSSTPQPKNHFYLLPNNPALSDVNQNKNLPLLIVQPVELAAYLDTQGIV 64

Query: 75  VRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGI--YADYQIISAI 132
            R S  ++     +QW+ +L   +  ++I     N         +  I      ++    
Sbjct: 65  YRKSETQVIQARQNQWAQRLSSQLTQRVINELRKNSTPYWPTALDTAIAQQKHARLQVRF 124

Query: 133 RSFEINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRIS 192
           + F  +   + A I  S  + NA     +  + F  +  L  +     +++L+   ++++
Sbjct: 125 QQFNGSYTGN-AEIAGSWVLFNAQGERSL-SQEFSFQIPLADEGYPALVEALSLGLAQLA 182

Query: 193 SEI 195
            +I
Sbjct: 183 VQI 185


>gi|254247081|ref|ZP_04940402.1| ABC transporter [Burkholderia cenocepacia PC184]
 gi|124871857|gb|EAY63573.1| ABC transporter [Burkholderia cenocepacia PC184]
          Length = 212

 Score = 62.3 bits (150), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 27/165 (16%), Positives = 60/165 (36%), Gaps = 9/165 (5%)

Query: 39  YDLTESTKYDESVQRHIQLIITEPITEKILNSEDIIVRS---SPIEIQYLIGSQWSDKLP 95
           YDL  ++    +      L + +      L+S+    R        +     S+W+    
Sbjct: 44  YDLGPASSVTTTGSGP-ALKVLDVAAPDALDSDKFAYRLAYADAQHVAVYRDSRWTAPPA 102

Query: 96  RMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFEINIDRH-CAIITMSLKIIN 154
           +++  +L     + G   TV++   G+ A   +   +  FE   D    +   ++ +   
Sbjct: 103 QLLTQRLRGALSSRG---TVLEGADGVRAP-TLKVDLSEFEQVFDGQSQSHGAVTARATL 158

Query: 155 AHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEIIDWT 199
             D+ ++GQ+ F         +     ++L  A   + S+I  W 
Sbjct: 159 MLDSKVLGQRTFVARAPSSTPDAAGGARALAAASDELVSQIAAWV 203


>gi|237747197|ref|ZP_04577677.1| conserved hypothetical protein [Oxalobacter formigenes HOxBLS]
 gi|229378548|gb|EEO28639.1| conserved hypothetical protein [Oxalobacter formigenes HOxBLS]
          Length = 200

 Score = 62.3 bits (150), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 33/192 (17%), Positives = 70/192 (36%), Gaps = 20/192 (10%)

Query: 19  AVLLCTSLSSCFFHNN--PVNIYDLTESTKYDESV-QRHIQLIITEPITEKILNSEDIIV 75
            VL  + L++C F +   P  +YDL      + S     + +I T+    + +N   +  
Sbjct: 11  TVLAVSLLTACAFGDRRPPATLYDLGPLKTENLSRLPAGMPVISTKVHAPEWMNENLMFY 70

Query: 76  R---SSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIY---ADYQII 129
           R    +  ++++   S W+    R+ + +L      +  +        GI        + 
Sbjct: 71  RLDYVNDQQVRFYTESSWNSPPSRLFKNRL------DTYLVAAGSTVTGIRTSSPTLTLR 124

Query: 130 SAIRSFEINIDRH---CAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNR 186
             +  F  +        + I +   +    D  LV QK F  E      +     ++L +
Sbjct: 125 IYLEDFSQHFSSPSDNTSRIVLRASLFRGRD--LVAQKRFRKEVVSRTADAQGGARALAQ 182

Query: 187 AFSRISSEIIDW 198
           +   +  EI++W
Sbjct: 183 SSDELIVEIMNW 194


>gi|317401490|gb|EFV82122.1| hypothetical protein HMPREF0005_00961 [Achromobacter xylosoxidans
           C54]
          Length = 203

 Score = 61.9 bits (149), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 26/202 (12%), Positives = 64/202 (31%), Gaps = 8/202 (3%)

Query: 9   IKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDL--TESTKYDESVQRHIQLIITEPITEK 66
           ++  I + +LA+ L  +         P  ++DL            +  + L+        
Sbjct: 3   MRSAIQALALALTLALAGCGVGRVGAPPAVFDLGLDARPAPQLPAREPMALVF---SAVP 59

Query: 67  ILNSEDIIVRSSPIEI-QYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYAD 125
            L+   +I R       Q     +W+     +++ +LI      G +       Q     
Sbjct: 60  ALSGTGVIWRVGDSAAPQSYATYRWASSPSDLVRQRLIERLSRQGPVLAERASGQTPQLQ 119

Query: 126 YQIISAIRSFEINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLN 185
             +    + F  +       + +   ++N  +  +VGQ     +      +    + +L 
Sbjct: 120 VYLSQFEQVFTPDGSASEGRVLLQAVLLNGRN--VVGQVRIATQAPAPTQDAAGGVAALR 177

Query: 186 RAFSRISSEIIDWTLSSLPLSD 207
           +A    + ++  W  S    + 
Sbjct: 178 QATDDAADQLAQWLASQPKAAA 199


>gi|74316268|ref|YP_314008.1| putative lipoprotein [Thiobacillus denitrificans ATCC 25259]
 gi|74055763|gb|AAZ96203.1| putative lipoprotein [Thiobacillus denitrificans ATCC 25259]
          Length = 225

 Score = 61.9 bits (149), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 23/202 (11%), Positives = 68/202 (33%), Gaps = 14/202 (6%)

Query: 12  KIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQ----------RHIQLIITE 61
            + + +LA+  C S          ++ Y L +    D +                L++ +
Sbjct: 6   GVTALALALTGCISFDGRGSAAPTIH-YVLDDVVPADTAAPPAGRAADAGVTPRTLLVLD 64

Query: 62  PITEKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQG 121
             +    N++ ++   +P    Y   ++W+++  +     L +  +  G    V   +  
Sbjct: 65  TTSSGFYNNDQLVFSRTPGTRGYYQFARWTERPGKRFADLLRSRLDRLGGYR-VAAASGQ 123

Query: 122 IYADYQIISAIRSFEINIDRHCAII--TMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLH 179
           +  D  + + +  F  +       +   +   +++    +L+ ++VF     +   +   
Sbjct: 124 VRGDLLLDTELIEFYHDARSQPGEVHLLLRADLLDLKRRTLLDRRVFEQRVPVATYDAAG 183

Query: 180 FIQSLNRAFSRISSEIIDWTLS 201
              +   A      ++  W  S
Sbjct: 184 AAAASGVAVGHTLDQLAAWLAS 205


>gi|301059990|ref|ZP_07200864.1| conserved hypothetical protein [delta proteobacterium NaphS2]
 gi|300445869|gb|EFK09760.1| conserved hypothetical protein [delta proteobacterium NaphS2]
          Length = 207

 Score = 61.1 bits (147), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 30/203 (14%), Positives = 75/203 (36%), Gaps = 14/203 (6%)

Query: 6   NKIIKKKIISCSLAVLLCT---SLSSCFFHNNPVNIYDLT----ESTKYDESVQRHIQLI 58
            KI+K+   SCS+  ++C     L +C   N+P   Y L            + ++ + ++
Sbjct: 1   MKILKELGHSCSMWGMVCVLSVILVACAGTNSPSTFYMLRSMEGPQESLTSADEKSVSVL 60

Query: 59  ITEPITEKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFE---NNGKISTV 115
           +      + L+   ++  +   ++     ++W++ L       L+ +        ++   
Sbjct: 61  VGPISMPEYLDRNQMVTVAGKNQVDLDEFNRWAESLRESFYRVLLEDLSFLLKTPRVYRY 120

Query: 116 VKPNQGIYADYQIISAIRSFEINIDRHCAIITM-SLKIINAHDNSLVGQKVFHVEEKLEK 174
            +  +   ADYQ+   +  F+   +    +    ++   +   + +  + VF     +  
Sbjct: 121 DRSGED-DADYQVSVDVTRFDCAPEGDAVLTVFWTVHGKDKGTSGIAKKSVFRT--PVSS 177

Query: 175 DNKLHFIQSLNRAFSRISSEIID 197
                 + +LNR  S    EI  
Sbjct: 178 SGFPGMVDALNRTLSAFGREIAT 200


>gi|71906848|ref|YP_284435.1| putative lipoprotein [Dechloromonas aromatica RCB]
 gi|71846469|gb|AAZ45965.1| putative lipoprotein [Dechloromonas aromatica RCB]
          Length = 201

 Score = 61.1 bits (147), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 26/193 (13%), Positives = 70/193 (36%), Gaps = 15/193 (7%)

Query: 14  ISCSLAVLLCTSLSSCFFHNN-----PVNIYDLTES--TKYDESVQRHIQLIITEPITEK 66
           +   +AVLL   LS+CF         P+ IYD      +      ++ + L +  P+   
Sbjct: 1   MRWLVAVLLGLCLSACFTAGKRGGDTPLAIYDFGPPLSSLLPAPRKQPVALEVRAPLWFD 60

Query: 67  ILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADY 126
            L  +  +       ++    ++W+    ++IQ +L      + ++  V+          
Sbjct: 61  SLGIDYRLTYVEASRLREYAQARWAGPPAQLIQQRL------SQRLGYVMAGQGQTRCLV 114

Query: 127 QI-ISAIRSFEINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLN 185
           ++ I+         D    ++     +++      V +    +E+     +    +++L 
Sbjct: 115 RLEITEFSQLFAAADSSRGVLQGRAWLLD-RSRRQVAELALSLEKPAPSADARGGVEALT 173

Query: 186 RAFSRISSEIIDW 198
               +++ ++  W
Sbjct: 174 LTVEQLAIDLFAW 186


>gi|83593783|ref|YP_427535.1| hypothetical protein Rru_A2448 [Rhodospirillum rubrum ATCC 11170]
 gi|83576697|gb|ABC23248.1| Protein of unknown function DUF330 [Rhodospirillum rubrum ATCC
           11170]
          Length = 201

 Score = 60.8 bits (146), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 31/194 (15%), Positives = 68/194 (35%), Gaps = 9/194 (4%)

Query: 8   IIKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQ---LIITEPIT 64
               + +   +   +   L++C     P  +Y L +      +         + I     
Sbjct: 5   FTPSRRLRLLIVSAMALGLAACGLSGPPPTLYVLGQPQSVATAAPLGGDRPVIEIKPVRV 64

Query: 65  EKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGI-- 122
              L++ D++VR  P  I      +W+++L   +Q  L A+     ++  ++   Q    
Sbjct: 65  SDYLDTTDLVVR-GPDRIIPSQQGRWAERLSVGVQRALAASLGA--RLPGLILTTQPPID 121

Query: 123 YADYQIISAIRSFEINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQ 182
               Q++  +  FE  I+    I+T    I +      V      V   L        +Q
Sbjct: 122 RPARQLLVDVSGFEA-IEGGSVILTARWTIADGASRQSVVSNGAQVTVPLTTAGDAGVVQ 180

Query: 183 SLNRAFSRISSEII 196
           ++++A   ++  I 
Sbjct: 181 AMSKAVDELAGHIA 194


>gi|118578846|ref|YP_900096.1| hypothetical protein Ppro_0404 [Pelobacter propionicus DSM 2379]
 gi|118501556|gb|ABK98038.1| protein of unknown function DUF330 [Pelobacter propionicus DSM
           2379]
          Length = 203

 Score = 60.8 bits (146), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 35/196 (17%), Positives = 69/196 (35%), Gaps = 17/196 (8%)

Query: 12  KIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQ----RHIQLIITEPITEKI 67
            +    + V+    L+ C         Y L+              R + L I        
Sbjct: 6   NLPRTLILVIATIWLAGCARSPQ-ARFYTLSPLGPQAAKPPASAVRQVSLSIAPVEVPDY 64

Query: 68  LNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFE---NNGKISTVVKPNQGIYA 124
           LN   I+ RS   E++     +W+  LP  I   +  N      + ++    +  +   A
Sbjct: 65  LNRPQIVTRSGQNELKLAEFDRWAGSLPDNIAAVMAENLSLLLASDRVQAAPR-GRNEKA 123

Query: 125 DYQIISAIRSFEINIDRHCAIITMSLKI---INAHDNSLVGQKVFHVEEKLEKDNKLHFI 181
           DY +   I   +           +S+++   ++A D + V  +V    EKL+       +
Sbjct: 124 DYTLAMRILRLDCVPGDQ-----LSMRVQWTLSAADGTCVAARVSTCMEKLKDSRYDTLV 178

Query: 182 QSLNRAFSRISSEIID 197
            +++ A  ++S EI  
Sbjct: 179 AAVSSALGQVSREIAR 194


>gi|187478578|ref|YP_786602.1| lipoprotein [Bordetella avium 197N]
 gi|115423164|emb|CAJ49695.1| putative lipoprotein [Bordetella avium 197N]
          Length = 216

 Score = 60.8 bits (146), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 23/170 (13%), Positives = 67/170 (39%), Gaps = 7/170 (4%)

Query: 32  HNNPVNIYDLTESTKYDESVQRHIQLIITEPITEKI-LNSEDIIVRSSPIEIQYLIGSQW 90
            + P   Y L               ++   P+      +   I++R+    I  L   +W
Sbjct: 21  ASPPARYYTLQAPPAATPIKGDAGFMVEVLPVAVTPQADQPQIMLRTGTGSIAPLYSDRW 80

Query: 91  SDKLPRMIQLKLIANFENN-GKI-STVVKPNQGIYADYQIISAIRSFEINIDRHCAI-IT 147
           S  L   ++  L+     + G + + V++P  G    +++ + ++ F+++      + +T
Sbjct: 81  SAPLGDELRSALVDGLTRDLGALDAGVLRPPLG-TPLWRVQTDVQRFDMSDKGPTVLDVT 139

Query: 148 MSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEIID 197
             ++ ++    +L+ + V  V   +  ++    + +  +A + ++  I  
Sbjct: 140 WRVRPVSLKGGALLCRTV--VTMPVGAEDVASLVTAQQQAVALLARTIAS 187


>gi|251789295|ref|YP_003004016.1| hypothetical protein Dd1591_1684 [Dickeya zeae Ech1591]
 gi|247537916|gb|ACT06537.1| protein of unknown function DUF330 [Dickeya zeae Ech1591]
          Length = 186

 Score = 60.8 bits (146), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 28/177 (15%), Positives = 61/177 (34%), Gaps = 9/177 (5%)

Query: 22  LCTSLSSCFFHNNPVNIYDLTESTK---YDESVQRHIQLIITEPITEKILNSEDIIVRSS 78
           L   L +C         Y L  +        +     QL +        L    I+ ++S
Sbjct: 8   LVLLLGACSSPQKVY--YQLPVAVPNTHLSATSTDARQLWVAPVTLTDSLAGNGIVFQTS 65

Query: 79  PIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFEIN 138
            +       + W+  L + +Q  L A+  N      VV       A  ++   + +F+  
Sbjct: 66  AVRYTIASNNLWAGPLDQQLQQALAASLRNGLPGWHVVSQGAANAAASRLQVNVTAFQGR 125

Query: 139 IDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEI 195
            D   A+I     +    D   +  + F +E    +D     + +L + + +++ ++
Sbjct: 126 FDGK-AVIRGEWVL---QDGKRMTTQPFSIEVPQTEDGYDALVAALGKGWQQVAEQV 178


>gi|91786144|ref|YP_547096.1| putative lipoprotein [Polaromonas sp. JS666]
 gi|91695369|gb|ABE42198.1| putative lipoprotein [Polaromonas sp. JS666]
          Length = 237

 Score = 60.4 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 29/211 (13%), Positives = 65/211 (30%), Gaps = 26/211 (12%)

Query: 16  CSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIITEPITEKILNS----- 70
              A L+    SS         +YD            R   L    P+    + +     
Sbjct: 31  SVAATLVLGGCSSLPDKPTRATMYDFGPGALSLRPGTREAPL---PPLAIDDIGTSGGAL 87

Query: 71  EDIIVR-----SSPIEIQYLIGSQWSDKLPRMIQLKLIANFE------NNGKISTVVKPN 119
           +++ V      +   +++    ++WS    ++I+ +L           N G+ + + +  
Sbjct: 88  DNMAVLYRLGYADAQQLRPYSQARWSMPPAQLIRQRLREQLSQRRAVFNAGESAALNRTQ 147

Query: 120 QGIYADYQIISAIRSFEINIDRHCA---IITMSLKIINA--HDNSLVGQKVFHVEEKLEK 174
             +     +   +  F        A   +I +   ++        LV Q+   V+     
Sbjct: 148 NAVLPQL-LRLHLEEFSHLFTAPDASVGLIRLRATLVEVTPAGEKLVAQRHVIVQRPAPS 206

Query: 175 DNKLHFIQSLNRAFSRISSEIIDWTLSSLPL 205
            +    +++L  A      E+  W L   P 
Sbjct: 207 ADAPGGVRALTAATDAAIEELEQW-LQQAPA 236


>gi|186474977|ref|YP_001856447.1| hypothetical protein Bphy_0208 [Burkholderia phymatum STM815]
 gi|184191436|gb|ACC69401.1| protein of unknown function DUF330 [Burkholderia phymatum STM815]
          Length = 208

 Score = 60.0 bits (144), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 28/203 (13%), Positives = 71/203 (34%), Gaps = 10/203 (4%)

Query: 1   MDKKLNKI-IKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLII 59
           M + +N++   +  ++  L  L   +             YDL  +     +      + +
Sbjct: 1   MSRSINRLFTSRAALAAVLVALGALAGCVGNPAAISDYRYDLGPAPTPGSTGTMP-AIKV 59

Query: 60  TEPITEKILNSEDIIVRS---SPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVV 116
            +      LN++ ++ R       +      S W+    +++  +L     + G   TV+
Sbjct: 60  LDVTAPATLNTDKLVYRLPYADAQQTAAYANSHWTMPPAQLLTQRLRNALSSRG---TVL 116

Query: 117 KPNQGIYADYQIISAIRSFEINIDRH-CAIITMSLKIINAHDNSLVGQKVFHVEEKLEKD 175
             + G+ A   +   +  FE + D    +  +++ +        + GQ+ F         
Sbjct: 117 TGSDGVSAPV-LKVDLDVFEQDFDGQSQSHASVTARATLLVGGKVAGQRTFIARAPASSA 175

Query: 176 NKLHFIQSLNRAFSRISSEIIDW 198
           +     ++L  A   + ++I  W
Sbjct: 176 DAAGGARALAAASDELVAQISAW 198


>gi|118474113|ref|YP_891671.1| hypothetical protein CFF8240_0476 [Campylobacter fetus subsp. fetus
           82-40]
 gi|28974224|gb|AAO64225.1| hypothetical protein Cf0019 [Campylobacter fetus]
 gi|118413339|gb|ABK81759.1| conserved hypothetical protein [Campylobacter fetus subsp. fetus
           82-40]
          Length = 178

 Score = 60.0 bits (144), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 30/180 (16%), Positives = 68/180 (37%), Gaps = 18/180 (10%)

Query: 19  AVLLCTSLSSCFFHNNPVNIY-DLTESTKYDESVQRH--IQLIITEPITEKILNSEDIIV 75
           A+ +   LS C    +P   Y +L+   K      R   + + + +  +     + +II 
Sbjct: 6   AIFISILLSGCLAKQSPQTTYYELSTPKKELNRCDRRSDVFIHVQKIKSLSPYQTRNIIY 65

Query: 76  RSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSF 135
           +   +E+ YL   ++      MI   LI   + N  I           +D Q+   I   
Sbjct: 66  K-DGLELSYLQNVKFIAYPSDMIYKALILYLDQNCHIKE--------RSDAQVSLEITLL 116

Query: 136 EINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEI 195
           +I + ++ A I +  K+ +   + ++  K+   +            ++LN +   +  ++
Sbjct: 117 DIGVTQNTAYIEILAKLTD--KDKIILNKILSAKT----TTTSSVAEALNASLETVFGDL 170


>gi|307728304|ref|YP_003905528.1| hypothetical protein BC1003_0233 [Burkholderia sp. CCGE1003]
 gi|307582839|gb|ADN56237.1| protein of unknown function DUF330 [Burkholderia sp. CCGE1003]
          Length = 213

 Score = 60.0 bits (144), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 29/208 (13%), Positives = 73/208 (35%), Gaps = 15/208 (7%)

Query: 1   MDKKLNKIIKKKIISCSLAVL----LCTSLSSCFFHNNPVN--IYDLTESTKYDESVQRH 54
           M + + +++  ++   S A      +   ++ C      ++   YD         +  + 
Sbjct: 1   MSRSIRRLLSSRVTRASAACAALAAVGVLVAGCTSTPAALSDIRYDFGPPKPATPAGMQP 60

Query: 55  IQLIITEPITEKILNSEDIIVRSS---PIEIQYLIGSQWSDKLPRMIQLKLIANFENNGK 111
             + + +    + L S+ ++ R       ++     S W+     ++  +L     + G 
Sbjct: 61  -TVKVLDVSAPEALQSDKLVYRLGYADSQQVAAYANSHWTMPPSVLLTQRLRGALSSRG- 118

Query: 112 ISTVVKPNQGIYADYQIISAIRSFEINIDRH-CAIITMSLKIINAHDNSLVGQKVFHVEE 170
             TV+    G+ A   +   +  FE   D    +   ++ +     +  L+GQ+ F    
Sbjct: 119 --TVLTGADGVAAPV-LKIDLSEFEQVFDSQSQSHAAVTARATLMQNGKLIGQRTFISRA 175

Query: 171 KLEKDNKLHFIQSLNRAFSRISSEIIDW 198
                +     Q+L  A   + ++I  W
Sbjct: 176 PSRSADAAGGAQALAAASDDLVAQIGAW 203


>gi|152992582|ref|YP_001358303.1| hypothetical protein SUN_0989 [Sulfurovum sp. NBC37-1]
 gi|151424443|dbj|BAF71946.1| conserved hypothetical protein [Sulfurovum sp. NBC37-1]
          Length = 191

 Score = 59.6 bits (143), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 25/173 (14%), Positives = 60/173 (34%), Gaps = 11/173 (6%)

Query: 27  SSCFFHNNPVNIYDL-TESTKYDESVQRHIQLIITEPITEKILNSEDIIVRSSPIEIQYL 85
             C   +     Y L T              + + +    K L   +I V  S  ++ ++
Sbjct: 16  GGCGTSS----YYVLSTAPQPTTTYSHIRGAIGVEKVSVPKYLFKREIAVAKSNSQVTFI 71

Query: 86  IGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGI--YADYQIISAIRSFEINIDRHC 143
            G+ W++ +   +  +LI   +       V     G+      ++   I  F    DR  
Sbjct: 72  SGANWAEDVDEGLTQRLIGYLQKKFNKPEVYSYPWGVSSQPRIKVKVQISRFIAQGDR-- 129

Query: 144 AIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEII 196
             +  S+++ N   +     K+F         +    + ++++AF ++  ++ 
Sbjct: 130 VYLDASIRLENMQTSK-RKAKLFSTSVP-SGSSAASIVAAMDKAFDQLEEQVA 180


>gi|77166181|ref|YP_344706.1| hypothetical protein Noc_2723 [Nitrosococcus oceani ATCC 19707]
 gi|254435218|ref|ZP_05048725.1| conserved hypothetical protein [Nitrosococcus oceani AFC27]
 gi|76884495|gb|ABA59176.1| Protein of unknown function DUF330 [Nitrosococcus oceani ATCC
           19707]
 gi|207088329|gb|EDZ65601.1| conserved hypothetical protein [Nitrosococcus oceani AFC27]
          Length = 211

 Score = 59.2 bits (142), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 30/186 (16%), Positives = 68/186 (36%), Gaps = 9/186 (4%)

Query: 18  LAVLLCTSLSSCFFHNNPVNIYDLTESTKY----DESVQRHIQLIITEPITEKILNSEDI 73
           + V +   LS+C    +   +Y LT          E+      LI+ +    + L    I
Sbjct: 7   ILVAVAFILSACATTPHQPWLYSLTTPPAGTTPPSEARVARKALIVNQIYAAEFLQHSGI 66

Query: 74  IVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANF--ENNGKISTVVKPNQGIYADYQIISA 131
           + +++P  +      +W+  L   +   +      +           +  + A +Q+   
Sbjct: 67  VYKTAPNRLSVARQHRWAAPLTVQLHQYIYNRLTTQLPSIAVYPNTSSAPLKA-WQLTVE 125

Query: 132 IRSFEINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRI 191
             SF    D   A++  S ++    +  +V Q  F  +  L +D     + +L++  +R+
Sbjct: 126 FNSFHGRFDGK-AVVAGSWRL-RNGNGDVVAQSSFKQDTPLAEDGYEALVAALSKGLARV 183

Query: 192 SSEIID 197
           +  I  
Sbjct: 184 TDSIAS 189


>gi|261855959|ref|YP_003263242.1| hypothetical protein Hneap_1361 [Halothiobacillus neapolitanus c2]
 gi|261836428|gb|ACX96195.1| hypothetical protein Hneap_1361 [Halothiobacillus neapolitanus c2]
          Length = 218

 Score = 58.8 bits (141), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 25/197 (12%), Positives = 68/197 (34%), Gaps = 10/197 (5%)

Query: 11  KKIISCSLAVLLCTSLSSCFF---HNNPVNIYDLTESTKYDESVQRHIQ-----LIITEP 62
           K I S ++  +   +L+SC          N++          ++          + +  P
Sbjct: 8   KTIASLAMLSIFSATLASCSLPIRAPEQQNVFRFNSPNIQTPTIDSTSSESAFLIQMRTP 67

Query: 63  ITEKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGI 122
              +  N++ ++     + +     S+W      M+   +         ++ VV  +   
Sbjct: 68  RAAEGFNTQSMMYSRDALNLAPYRDSRWLATPAHMLGDVIEQTLLKQPWVAGVVPNSANA 127

Query: 123 YADYQIISAIRSFEINIDR--HCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHF 180
                +   +   E +ID     A + MS       ++ + G   F   + + +++   F
Sbjct: 128 PVAANLSCRLIRLEHDIDGSTGKAHLVMSCLWTTPANHEVQGHLRFDQTQAITRNDATGF 187

Query: 181 IQSLNRAFSRISSEIID 197
             +  +  ++  ++II+
Sbjct: 188 ATASQQLVNQAVTQIIN 204


>gi|260431687|ref|ZP_05785658.1| conserved hypothetical protein [Silicibacter lacuscaerulensis
           ITI-1157]
 gi|260415515|gb|EEX08774.1| conserved hypothetical protein [Silicibacter lacuscaerulensis
           ITI-1157]
          Length = 185

 Score = 58.4 bits (140), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 26/181 (14%), Positives = 61/181 (33%), Gaps = 6/181 (3%)

Query: 17  SLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIITEPITEKILNSEDIIVR 76
           ++ VL    LS+C   N+P   Y ++       +  R   + + +          DI+ +
Sbjct: 5   AILVLPIALLSACSGANDPR--YLISAPPGERTANLRSRTIEVRQVSLPAYAAGSDIVAQ 62

Query: 77  SSPIEIQYLIGSQWSDKLPRMIQLKLIANF-ENNGKISTVVKPNQGIYADYQIISAIRSF 135
                +     +QW+D   R +   L     E  G              D ++   +   
Sbjct: 63  GEGGALFTQDRAQWADDPARGMTSALARGLSERTGASVAAEPWPLNTGPDVRLDVRVDQA 122

Query: 136 EINIDRHCAIITMSLKIINAHDNSLVG-QKVFHVEEKLEKDNKLHFIQSLNRAFSRISSE 194
               D +  +       +++ + ++    + F++   +          +L RA + +S +
Sbjct: 123 YARADGNFELSGQYA--VSSPEGTVREFVRRFNIVTPIAGSGAPATADALGRALAELSRQ 180

Query: 195 I 195
           I
Sbjct: 181 I 181


>gi|303246828|ref|ZP_07333105.1| protein of unknown function DUF330 [Desulfovibrio fructosovorans
           JJ]
 gi|302491845|gb|EFL51725.1| protein of unknown function DUF330 [Desulfovibrio fructosovorans
           JJ]
          Length = 212

 Score = 58.1 bits (139), Expect = 7e-07,   Method: Composition-based stats.
 Identities = 33/198 (16%), Positives = 70/198 (35%), Gaps = 16/198 (8%)

Query: 19  AVLLCTSLSSCFFHNNPVNIY---DL-TESTKYDESVQRHIQLIITEPITEKILNSEDII 74
           +++L  SL+ CF    P   Y   DL         + Q+ + L I      + L+     
Sbjct: 14  SLILAASLAGCFGKPPPPQQYLRVDLGQGPCPGSANAQQRLPLGIKPLKALENLD--RTA 71

Query: 75  VRSSPI-----EIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQII 129
           V ++        +QY     W      ++   L    E      T V     +  D  + 
Sbjct: 72  VLTAHDNVLTASLQYY----WEGAPQDLVGQALRHGIECQSASLTPVDYQPRVTHDAVLT 127

Query: 130 SAIRSFEIN-IDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAF 188
             + +F ++  D    ++++ L + + +  + +    F+    L+  +      + + A 
Sbjct: 128 GQLTAFNVDETDGGRFVVSIHLDLWSRNLGTRISSGDFNAYAPLDNFSGDAVANAASDAL 187

Query: 189 SRISSEIIDWTLSSLPLS 206
            RI  +++ W    LP  
Sbjct: 188 GRIVPKVVAWLDGGLPRI 205


>gi|222823164|ref|YP_002574737.1| conserved hypothetical lipoprotein [Campylobacter lari RM2100]
 gi|222538385|gb|ACM63486.1| conserved hypothetical lipoprotein [Campylobacter lari RM2100]
          Length = 197

 Score = 58.1 bits (139), Expect = 7e-07,   Method: Composition-based stats.
 Identities = 36/197 (18%), Positives = 78/197 (39%), Gaps = 11/197 (5%)

Query: 14  ISCSLAVLLCTSLSSCFFHNN-PVNIY---DLTESTKYDESVQRHIQLIITEPITEKILN 69
           +  SL  +  ++ S        P N Y   DL E     ++  ++  ++++ P       
Sbjct: 4   LYISLIAIFFSACSLVSPSQTLPANKYFSIDL-EKLGQSQNKVKNSTIMVSLPKGLAY-- 60

Query: 70  SEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQII 129
           + +I  +     +       W +    MI+  L  + ++ G    V+  +    ADY + 
Sbjct: 61  TNEIFYK-KDHVVNAYAYHFWKENPALMIKAFLEFHLQDLGVFKAVLNQDSLASADYVLE 119

Query: 130 SAIRSFEINI-DRHCAIIT--MSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNR 186
           S +   E +  D   + I   ++L ++  +   L+  K F+ E++L  +N    IQ+ + 
Sbjct: 120 SKVDILEQDFSDEMHSKIKLGINLNLVQINTKKLIVSKYFYYEKELNDNNPQILIQNYDE 179

Query: 187 AFSRISSEIIDWTLSSL 203
            F   + +   W   +L
Sbjct: 180 VFLLFAKDFRVWIDQNL 196


>gi|331001494|ref|ZP_08325112.1| conserved domain protein [Parasutterella excrementihominis YIT
           11859]
 gi|329568223|gb|EGG50040.1| conserved domain protein [Parasutterella excrementihominis YIT
           11859]
          Length = 146

 Score = 58.1 bits (139), Expect = 8e-07,   Method: Composition-based stats.
 Identities = 21/133 (15%), Positives = 48/133 (36%), Gaps = 2/133 (1%)

Query: 67  ILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADY 126
             +S    V      I     +++S     +I   L    ++ G  + V+ PN      Y
Sbjct: 5   PYDSTRCYVLIKDNRIYNTDINRFSSNPGNLIGDGLREVIQDCGPWNIVLSPNSISTPAY 64

Query: 127 QIISAIRSFEINIDRHC--AIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSL 184
           Q+   +  F IN  +    A++ M + ++ +    LV  + +   +    D+    + + 
Sbjct: 65  QLTVFVSKFFINAVKKPFAAVVEMEVSVVASVSGKLVFHETYSQTQNTPTDDMPGAVSAF 124

Query: 185 NRAFSRISSEIID 197
           +     I   + +
Sbjct: 125 DVCLENIFKTLTN 137


>gi|307825465|ref|ZP_07655683.1| putative lipoprotein [Methylobacter tundripaludum SV96]
 gi|307733351|gb|EFO04210.1| putative lipoprotein [Methylobacter tundripaludum SV96]
          Length = 181

 Score = 58.1 bits (139), Expect = 8e-07,   Method: Composition-based stats.
 Identities = 35/197 (17%), Positives = 64/197 (32%), Gaps = 26/197 (13%)

Query: 14  ISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIITEPITEKILNSEDI 73
           + C L   L    + C        ++D   S     + Q    + I  P     L    I
Sbjct: 1   MRCLLIGWLVFLSAGCSVTVRQPVLHDFGVSVS-TATQQSKASVSINAPT---WLWDNRI 56

Query: 74  IVR---SSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIIS 130
             R   SSP ++++    +W    P M +  L                  G   DY +I 
Sbjct: 57  RYRLLFSSPSQVRFYGLDRWIASPPEMFEQLL---------------NLSGKTKDYALII 101

Query: 131 AIRSFEINIDRH---CAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRA 187
             + FE   D       ++  S++    ++   +G + F+++   +  +    I      
Sbjct: 102 RFQDFEQQFDAPDRARVVLRFSVEAYADNNKQKIGTQEFYLQRPTQTPDAAGAISGFIDL 161

Query: 188 FSRISSEIIDWTLSSLP 204
                  I DW ++ LP
Sbjct: 162 VHEAVENIRDW-VAGLP 177


>gi|283852495|ref|ZP_06369763.1| conserved hypothetical protein [Desulfovibrio sp. FW1012B]
 gi|283572103|gb|EFC20095.1| conserved hypothetical protein [Desulfovibrio sp. FW1012B]
          Length = 211

 Score = 58.1 bits (139), Expect = 8e-07,   Method: Composition-based stats.
 Identities = 35/200 (17%), Positives = 70/200 (35%), Gaps = 12/200 (6%)

Query: 15  SCSLAVLLCTSLSSCFFHNNPVNIY---DLTEST-KYDESVQRHIQLIITEPITEKILNS 70
             ++  LL  SLS CF    P   Y   DL E+      S Q  + L        + L+ 
Sbjct: 9   RLAIVALLAASLSGCFGKPPPPQRYLRVDLEETPCPGSNSQQHRLPLGFKPLTALENLDR 68

Query: 71  EDIIVRSSP---IEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQ 127
             ++          ++Y     W      ++   L    E      T V     +  D  
Sbjct: 69  TSVLTARDQVLSASLEYY----WEGAPQDVVGQALRRGIECQSTAVTPVDYQPRVEHDAV 124

Query: 128 IISAIRSFEIN-IDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNR 186
           +   + +F +   +    ++++ L + + +  + +    F+    LE  N     ++ + 
Sbjct: 125 LTGQVTAFNVEETEGGRFVVSVHLDLWSKNLGTRIATGEFNAYAPLENFNGDTIARAASN 184

Query: 187 AFSRISSEIIDWTLSSLPLS 206
           A  R+  +++DW    LP  
Sbjct: 185 ALGRVVPKVVDWLDVGLPKI 204


>gi|89902673|ref|YP_525144.1| putative lipoprotein [Rhodoferax ferrireducens T118]
 gi|89347410|gb|ABD71613.1| putative lipoprotein [Rhodoferax ferrireducens T118]
          Length = 234

 Score = 57.7 bits (138), Expect = 9e-07,   Method: Composition-based stats.
 Identities = 26/222 (11%), Positives = 73/222 (32%), Gaps = 32/222 (14%)

Query: 6   NKIIKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQ--------L 57
           ++    +  +  L V L  +  +         +YD            +  Q        L
Sbjct: 10  SRAYSTEARALFLVVFLALTGCALTRPTARPAVYDFGPGRLSSAPAPQAGQVAASALAPL 69

Query: 58  IITEPITEKILNSEDIIVR---SSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKIST 114
           ++ E      L+   ++ R   ++  +++    ++WS    ++++ +L       G+   
Sbjct: 70  VLDEVQASSALDGSAVLYRLAYTNAQQLRPYAQARWSMPPAQLVRQRLREQL---GQDRA 126

Query: 115 VVKPNQGIYA-------------DYQIISAIRSFEINIDRHCAII---TMSLKIINA--H 156
           +++P   + A                +   +  F    +   + +    +   +  A   
Sbjct: 127 LLEPGAVVSAARLSTPGALAGVTPITLRLELEEFSQLFEAPGSSVGLLRLRATLTQASPS 186

Query: 157 DNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEIIDW 198
              L+ Q++  V+      + +  +Q+L  A    + E+  W
Sbjct: 187 GAGLLAQRIIVVQRPAPSADAVGGVQALRLATDAAAQELAQW 228


>gi|217970675|ref|YP_002355909.1| hypothetical protein Tmz1t_2274 [Thauera sp. MZ1T]
 gi|217508002|gb|ACK55013.1| protein of unknown function DUF330 [Thauera sp. MZ1T]
          Length = 212

 Score = 57.7 bits (138), Expect = 9e-07,   Method: Composition-based stats.
 Identities = 24/196 (12%), Positives = 54/196 (27%), Gaps = 16/196 (8%)

Query: 11  KKIISCSLAVLLCTSLSSCFFHNNPVNIYDL-TESTKYDESVQRHIQLIITEPITEKILN 69
            ++ +C    LL  +             YDL T             ++ ++ P   +   
Sbjct: 13  PRLSACIATALLVAACQVLPERPRAAATYDLGTGERAALAHGLAPARVAVSSPPWLQTTT 72

Query: 70  SEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQII 129
                 R  P   +    ++W+   P M+ L L                  G     ++ 
Sbjct: 73  MHYRDARVDPGRRRAYADNRWAAPPPAMLGLVLERTL------------GAGEGGGCRLQ 120

Query: 130 SAIRSFEINI-DRHCAIITMSLK--IINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNR 186
             +  FE        +   +  +  ++     +++      V E     +      +   
Sbjct: 121 VQLDEFEQVFTAGERSEARLLARFALLPVRGAAVIASASLVVAEPATTADASGGASAFRA 180

Query: 187 AFSRISSEIIDWTLSS 202
           A  R++  I  W   +
Sbjct: 181 ATERLALAIAQWIAET 196


>gi|89076555|ref|ZP_01162865.1| hypothetical protein SKA34_10760 [Photobacterium sp. SKA34]
 gi|89047789|gb|EAR53387.1| hypothetical protein SKA34_10760 [Photobacterium sp. SKA34]
          Length = 190

 Score = 57.3 bits (137), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 29/186 (15%), Positives = 64/186 (34%), Gaps = 6/186 (3%)

Query: 16  CSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQ-RHIQLIITEPITEKI-LNSEDI 73
             L   +  + + C      +  Y L   T  + +    +  L+I  P+     L    +
Sbjct: 4   WLLIAAVVLAGTGCSSTETALKTYMLPMPTSANTAHNISNKSLLIVRPVEVAAHLAGTGL 63

Query: 74  IVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFEN--NGKISTVVKPNQGIYADYQIISA 131
           + ++SP EI     + W + L   +  ++  +         +T + P        ++   
Sbjct: 64  VYQTSPTEIVEAQQNLWGESLSTQLTRRITFDLRQKQTQFWATQLTPTLSTAGIPRLQVR 123

Query: 132 IRSFEINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRI 191
           I  F        A I     +IN  +  L     F     L KD     +++L++    +
Sbjct: 124 INQFNGVYSG-VAEIAGEWLLING-NGDLQTVHPFSFRVPLTKDGYSAQVEALSKGVDEL 181

Query: 192 SSEIID 197
           ++++  
Sbjct: 182 TTQLAR 187


>gi|77920342|ref|YP_358157.1| hypothetical protein Pcar_2752 [Pelobacter carbinolicus DSM 2380]
 gi|77546425|gb|ABA89987.1| conserved hypothetical protein [Pelobacter carbinolicus DSM 2380]
          Length = 215

 Score = 57.3 bits (137), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 23/179 (12%), Positives = 57/179 (31%), Gaps = 8/179 (4%)

Query: 25  SLSSCFF-HNNPV--NIYDLTESTKYDESVQRHIQLIITEP-ITEKILNSEDIIVRSSPI 80
            L  C      P     Y +T +     + +    ++   P       N    + R    
Sbjct: 18  LLPGCMRIGQRPPAKTSYVITANRPASAAERVGAAVLQVTPMRISPRFNGRSFVYRQGIS 77

Query: 81  EIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFEINI- 139
           + +    +++      ++Q +++     +G  +TV      +  DY +   I     +  
Sbjct: 78  QFRPDFYNKFLVAPANLVQEQVVRWLTASGLFATVSSSAGPLPPDYLLQGQITELYGDYR 137

Query: 140 -DRHCAIITMSLKIIN--AHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEI 195
             +  AI+ +    +   A D  +   + +  E  L        +++ + A   I   +
Sbjct: 138 DRQPVAILEIGFLFLQHAAADAPIRLNRSYRGEVPLTGHEPDALVEAWDTALINILENL 196


>gi|218961390|ref|YP_001741165.1| hypothetical protein; putative signal peptide [Candidatus
           Cloacamonas acidaminovorans]
 gi|167730047|emb|CAO80959.1| hypothetical protein; putative signal peptide [Candidatus
           Cloacamonas acidaminovorans]
          Length = 729

 Score = 57.3 bits (137), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 29/188 (15%), Positives = 69/188 (36%), Gaps = 9/188 (4%)

Query: 8   IIKKKIISCSLAVLLCTSLSSCFFHNN--PVNIYDLTESTKYDESVQRHIQ-----LIIT 60
           + +K +   S  + +   L+ C       PVN Y L      ++   R        L + 
Sbjct: 2   LKRKCLYIFSGFLAILLLLTGCLQKVERTPVNYYVLEYQPGTEKPELRRTTNTGKNLEVL 61

Query: 61  EPITEKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQ 120
           + +  +  +   I+V+ +   +++L    W+ +L   I   ++   +      TV +  Q
Sbjct: 62  DTVLNRTYDRSQIVVKENFYNVKFLQTDVWATRLRDAIPNLIVQRLKAYNIFGTVSRGEQ 121

Query: 121 GIY-ADYQIISAIRSFE-INIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKL 178
                 Y + + + + E I      A + M   + ++    +V         +L   + +
Sbjct: 122 LEKNPHYFLETKVYNIEKIAGTEPRAYLNMEFVLRDSTSERIVFSHKGERTMELIDPSMI 181

Query: 179 HFIQSLNR 186
           + +Q+ N 
Sbjct: 182 YLVQAFNE 189


>gi|295675324|ref|YP_003603848.1| protein of unknown function DUF330 [Burkholderia sp. CCGE1002]
 gi|295435167|gb|ADG14337.1| protein of unknown function DUF330 [Burkholderia sp. CCGE1002]
          Length = 208

 Score = 57.3 bits (137), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 27/203 (13%), Positives = 67/203 (33%), Gaps = 10/203 (4%)

Query: 1   MDKKLNKIIKKKIISCSLAVLLCTSLSSCFFHNNPVNI-YDLTESTKYDESVQRHIQLII 59
           M + +++++  +    +L      +           ++ YD     +   + +    + +
Sbjct: 1   MSRSIHRLLSSRAAFAALLAFGVLAAGCAGTSAVVSDVRYDFGPPPQAATASRLP-AVKV 59

Query: 60  TEPITEKILNSEDIIVRSS---PIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVV 116
            E     +L S+ +  R S     +      S W+    +++  +L       G   TV+
Sbjct: 60  LEVSAPSVLESDRLTYRLSYADAQQTAAYANSHWTMMPSQLLTQRLRNALSERG---TVL 116

Query: 117 KPNQGIYADYQIISAIRSFEINIDRHC-AIITMSLKIINAHDNSLVGQKVFHVEEKLEKD 175
               G+ A   +   +  FE        +   ++ +        +VGQ  F         
Sbjct: 117 TGADGVSAPV-LRVDLTEFEQVFASPTDSHGAITARATLMQGGKVVGQHTFVAHASAHSA 175

Query: 176 NKLHFIQSLNRAFSRISSEIIDW 198
           +     ++L  A   + ++I  W
Sbjct: 176 DAAGGARALAVASDDLVAQIATW 198


>gi|329905878|ref|ZP_08274261.1| putative lipoprotein [Oxalobacteraceae bacterium IMCC9480]
 gi|327547449|gb|EGF32270.1| putative lipoprotein [Oxalobacteraceae bacterium IMCC9480]
          Length = 195

 Score = 57.3 bits (137), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 31/181 (17%), Positives = 70/181 (38%), Gaps = 7/181 (3%)

Query: 28  SCFFHNNPVNIYDLTESTKYDESVQRHIQLIITEPITEKILNSEDIIVRS---SPIEIQY 84
            C     P   +DL       +  +    + I    +   L+   ++ R    +  + Q 
Sbjct: 15  GCATPAAPPAQFDLGPLPAASQVARVLPAVSIASATSSPFLDHPRMLYRLDYANSQQPQQ 74

Query: 85  LIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSF-EINIDRHC 143
              S+W+    ++I+ +L A     G    V+  + G      +  A+  F ++      
Sbjct: 75  FANSRWTMAPAQLIEQRLKARLGQAGS--AVLAASDGARNVPLLHVALDEFVQVFTTPAS 132

Query: 144 AIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEIIDWTLSSL 203
           +   +++++   ++  LV QK F  +      +     ++L  A   + +++IDW L +L
Sbjct: 133 STGQLTVRVAVFNERLLVAQKSFTQQRPAASADAAGGARALAGASDALITDVIDW-LGTL 191

Query: 204 P 204
           P
Sbjct: 192 P 192


>gi|317153921|ref|YP_004121969.1| hypothetical protein Daes_2217 [Desulfovibrio aespoeensis Aspo-2]
 gi|316944172|gb|ADU63223.1| protein of unknown function DUF330 [Desulfovibrio aespoeensis
           Aspo-2]
          Length = 205

 Score = 56.9 bits (136), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 26/179 (14%), Positives = 68/179 (37%), Gaps = 8/179 (4%)

Query: 25  SLSSCFF-HNNPVN--IYDLTESTKYD-ESVQRHIQLIITEPITEKILNSEDIIVRSSPI 80
             ++C      P++   Y L         + Q  I L +       + N+ +II + +  
Sbjct: 16  GCAACVKMGGKPLDKHYYRLAPVRAQSLPAPQDGIVLNVRRLAVSDLYNTREIIYQLADG 75

Query: 81  EIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFEINID 140
            ++    + +      M+  +L      +G+ S ++ P   +  D  +  A+ +   +  
Sbjct: 76  RMESDFYNLYFITPGSMLTSELRDWLAASGRFSHIITPGSMVVPDLILEGAVNTLYGDFS 135

Query: 141 --RHCAIITMSLKIINAH--DNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEI 195
                A+++M   +++    DN+++  K +     L +      +Q+L      I +++
Sbjct: 136 STPPAAVMSMQFFLVDESTPDNTILFSKNYTQRIPLSQPTAQELVQALTEGTRTIFTQL 194


>gi|254465324|ref|ZP_05078735.1| conserved hypothetical protein [Rhodobacterales bacterium Y4I]
 gi|206686232|gb|EDZ46714.1| conserved hypothetical protein [Rhodobacterales bacterium Y4I]
          Length = 185

 Score = 56.5 bits (135), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 19/159 (11%), Positives = 54/159 (33%), Gaps = 4/159 (2%)

Query: 39  YDLTESTKYDESVQRHIQLIITEPITEKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMI 98
           Y ++ +     +  R   + +          + +I+       +  L G+QW+D   R +
Sbjct: 25  YLISAAPGEKVANLRSRTIEVRLVSLPSYAAASEIVAEGDGGALFALGGAQWADDPARGM 84

Query: 99  QLKLIANF-ENNGKISTVVKPNQGIYADYQIISAIRSFEINIDRHCAIITMSLKIINAHD 157
              L     +  G  + V         D ++   +       D   A+       +++ +
Sbjct: 85  TAALARGLNQRTGAAAAVEPWPLNTGPDVRLDVRVDQAYARADGVFALTGQFA--VSSPE 142

Query: 158 NSLVG-QKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEI 195
            ++    + F +   +          +L+RA + ++ ++
Sbjct: 143 GTVREFVRPFDILVPVNGTGPSAAADALSRALAELARQV 181


>gi|307131469|ref|YP_003883485.1| hypothetical protein Dda3937_03521 [Dickeya dadantii 3937]
 gi|306528998|gb|ADM98928.1| conserved protein [Dickeya dadantii 3937]
          Length = 187

 Score = 56.5 bits (135), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 27/177 (15%), Positives = 62/177 (35%), Gaps = 9/177 (5%)

Query: 22  LCTSLSSCFFHNNPVNIYDLTEST---KYDESVQRHIQLIITEPITEKILNSEDIIVRSS 78
           L   L +C         Y L  +T       +     QL +        L    I+ ++S
Sbjct: 9   LVVLLGACSSPQKVY--YQLPAATQNTSVSVASTEGRQLWVAPVTLVDSLAGNGIVFQTS 66

Query: 79  PIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFEIN 138
            +       + W+  L + +Q  L+A+  N      V            +   + +F+  
Sbjct: 67  AVRYTIATNNLWASPLDQQLQQALVASLRNGLPGWHVAATGAASDNASSLQVNVTAFQGR 126

Query: 139 IDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEI 195
            D   A+I    + +      ++  + F++E    +D     I +L + + +++ ++
Sbjct: 127 FDGK-AVIR--GEWVLQGSKRVI-TQPFNIEVPQAEDGYDALIGALGKGWQQVAEQV 179


>gi|323524594|ref|YP_004226747.1| hypothetical protein BC1001_0222 [Burkholderia sp. CCGE1001]
 gi|323381596|gb|ADX53687.1| protein of unknown function DUF330 [Burkholderia sp. CCGE1001]
          Length = 213

 Score = 56.5 bits (135), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 28/208 (13%), Positives = 71/208 (34%), Gaps = 15/208 (7%)

Query: 1   MDKKLNKIIKKKIISCSLAVLLCTS--LSSCFFHNNPVNI----YDLTESTKYDESVQRH 54
           M + +++++  ++     A     +  L +    + P  +    YD         +  + 
Sbjct: 1   MSRSIHRLLSSRVTRAGAACAALVAVGLLAAGCTSTPAALSDIRYDFGPPKPASSAGTQP 60

Query: 55  IQLIITEPITEKILNSEDIIVRSS---PIEIQYLIGSQWSDKLPRMIQLKLIANFENNGK 111
             + + +    + L S+ ++ R       ++     S W+     ++  +L     + G 
Sbjct: 61  -AVKVLDVSAPEGLQSDKLVYRLGYADSQQVAAYANSHWTMPPSALLTQRLRGALSSRG- 118

Query: 112 ISTVVKPNQGIYADYQIISAIRSFEINIDRH-CAIITMSLKIINAHDNSLVGQKVFHVEE 170
             TV+    G+ A   +   +  FE   D    +   ++ +        ++GQ+ F    
Sbjct: 119 --TVLTGADGVAAPV-LKIELSEFEQVFDSQSQSHAAVTARATLTQSGKVIGQRTFISRA 175

Query: 171 KLEKDNKLHFIQSLNRAFSRISSEIIDW 198
                +     Q+L  A   +  +I  W
Sbjct: 176 PSRSADAAGGAQALAAASDELVDQIGAW 203


>gi|188534235|ref|YP_001908032.1| Putative lipoprotein protein [Erwinia tasmaniensis Et1/99]
 gi|188029277|emb|CAO97154.1| Putative lipoprotein protein [Erwinia tasmaniensis Et1/99]
          Length = 187

 Score = 56.1 bits (134), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 28/182 (15%), Positives = 66/182 (36%), Gaps = 8/182 (4%)

Query: 18  LAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQ--LIITEPITEKILNSEDIIV 75
           + V L  +LS+C         Y L   T         +   L +        L    ++ 
Sbjct: 5   IPVALALTLSACGSGPKTAY-YQLPTVTPSTAVSSSTLARPLWVERVTVPDYLAGSGVVY 63

Query: 76  RSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSF 135
           +S+ ++      +QW+  L + +Q  L++N         +     G   D  +   +  F
Sbjct: 64  QSNDVQYVIATNNQWASPLDQQLQQTLVSNLSATLPQVLISSTPLGQQHD-TLKVDVSGF 122

Query: 136 EINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEI 195
               D H  +   S + +  H+  L  ++ F +    + D     +++L   + +++ ++
Sbjct: 123 HGRYDGHAVV---SGEWVLEHNGELF-KQPFVIALPQKDDGYDALVRTLAAGWQQVADQV 178

Query: 196 ID 197
            +
Sbjct: 179 AN 180


>gi|182416426|ref|YP_001821492.1| hypothetical protein Oter_4622 [Opitutus terrae PB90-1]
 gi|177843640|gb|ACB77892.1| protein of unknown function DUF330 [Opitutus terrae PB90-1]
          Length = 214

 Score = 56.1 bits (134), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 35/204 (17%), Positives = 87/204 (42%), Gaps = 18/204 (8%)

Query: 4   KLNKIIKKKIISCSLAVLLCTSLSSCFFHNNPVNI---YDLTE---STKYDESVQRHIQL 57
           +++ + K  +    L  +    L+ C       ++   Y LT    + +  +  +   ++
Sbjct: 14  RMSSLWKPALAGSLLVGM----LTGCSLPEAQPDLTRFYVLTPTLAAAEMAKPAEAAPRV 69

Query: 58  IITEPITEKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVK 117
           ++   +  + L  + + VR S  E++Y+  ++W++ L   +Q  L  + E +G++  V +
Sbjct: 70  LLRGVMVPEFLRGKIMPVRLSDTELRYIDQARWAEPLEAGLQRTLKVDLERSGRVRVVGR 129

Query: 118 PNQGIYADYQIISAIRSFEINIDRHCAIITMSLKI---INAHDNSLVGQKVFHVEEKL-E 173
            ++    D++I   +R  E  +    A   ++ +I       +  LV Q  F  E    +
Sbjct: 130 GSEP--HDFEIALQVRQCEGVVPGRVA--RLAARIEVYSGDVEAKLVAQDEFTTEIAGWD 185

Query: 174 KDNKLHFIQSLNRAFSRISSEIID 197
             N     + L+ A ++++  + D
Sbjct: 186 GANHAELAKKLSEAAAQLAQRVAD 209


>gi|90577617|ref|ZP_01233428.1| hypothetical protein VAS14_11239 [Vibrio angustum S14]
 gi|90440703|gb|EAS65883.1| hypothetical protein VAS14_11239 [Vibrio angustum S14]
          Length = 190

 Score = 56.1 bits (134), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 28/186 (15%), Positives = 64/186 (34%), Gaps = 6/186 (3%)

Query: 16  CSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQ-RHIQLIITEPITEKI-LNSEDI 73
             L   +  + + C      +  Y L   T  + +    +  L+I  P+     L    +
Sbjct: 4   WLLIAAVALAGTGCSSTEPALKTYMLPMPTSANTAHNISNKSLLIVRPVEVAAHLAGTGL 63

Query: 74  IVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFEN--NGKISTVVKPNQGIYADYQIISA 131
           + ++SP EI     + W + L   +  ++  +         +T + P        ++   
Sbjct: 64  VYQTSPTEIVEAQQNLWGESLSTQLTRRITFDLRQKQTQFWATQLTPTLSTAGIPRLQVR 123

Query: 132 IRSFEINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRI 191
           I  F        A +     +IN  +  L     F     L KD     +++L++    +
Sbjct: 124 INQFNGVYSG-VAEVAGEWLLING-NGDLQTVHPFSFRVPLAKDGYSAQVEALSKGVDEL 181

Query: 192 SSEIID 197
           ++++  
Sbjct: 182 TTQLAR 187


>gi|330448139|ref|ZP_08311787.1| conserved hypothetical protein [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
 gi|328492330|dbj|GAA06284.1| conserved hypothetical protein [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
          Length = 190

 Score = 56.1 bits (134), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 29/185 (15%), Positives = 64/185 (34%), Gaps = 6/185 (3%)

Query: 16  CSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQR-HIQLIITEPITEKI-LNSEDI 73
             L   +    + C      +  Y L  ST  + +    +  L+I  P+     L    +
Sbjct: 4   WLLIAAVALVGTGCSSTEPVMTTYMLPMSTTANTAHNVSNKSLLIVRPVEVAAHLAGTGL 63

Query: 74  IVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFEN--NGKISTVVKPNQGIYADYQIISA 131
           + ++SP EI     + W + L + +  ++  +          T + P        ++   
Sbjct: 64  VYQTSPTEIVEAQQNLWGEALGKQLTRRITQDLRQKQTKFWPTQLTPTLSTAGVPRLQVR 123

Query: 132 IRSFEINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRI 191
           I  F        A +     +IN  +  L     F     L KD     +++L++    +
Sbjct: 124 INQFNGVYTG-VAEVAGEWLLING-NGDLQTVHPFTFRVPLAKDGYPAQVEALSKGVGEL 181

Query: 192 SSEII 196
           ++++ 
Sbjct: 182 TTQLA 186


>gi|188590868|ref|YP_001795468.1| hypothetical protein RALTA_A0073 [Cupriavidus taiwanensis LMG
           19424]
 gi|170937762|emb|CAP62746.1| conserved hypothetical protein [Cupriavidus taiwanensis LMG 19424]
          Length = 217

 Score = 55.7 bits (133), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 27/188 (14%), Positives = 54/188 (28%), Gaps = 24/188 (12%)

Query: 27  SSC-FFHNNPVNIYDLTES--------TKYDESVQRHIQLIITEPITEKILNSEDIIVRS 77
           S C      P   YDL  +        T          +L + +      L    +  R 
Sbjct: 33  SGCALTRGEPTITYDLGPALAGPAASATGNPAPAPLP-KLRVAQTDGPNWLEGNALFYRL 91

Query: 78  S---PIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRS 134
                  +Q     +W     R+   +L       G   T+     G      +   +  
Sbjct: 92  QYAQAQRLQAYATQRWVMSPTRLFDERLRDAVAARG---TLGWSGDGSVP--ALKVDLLE 146

Query: 135 FEINIDRHCA---IITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRI 191
           F+       A   ++ +   +       ++GQ+ F V       +    +++L  A    
Sbjct: 147 FDQVFHSATASEGVVRLRATVYRHG---MLGQQTFEVRRPAPSADGAGGVKALAEASDAA 203

Query: 192 SSEIIDWT 199
            + ++DW 
Sbjct: 204 IAALLDWI 211


>gi|53802516|ref|YP_112708.1| putative lipoprotein [Methylococcus capsulatus str. Bath]
 gi|53756277|gb|AAU90568.1| putative lipoprotein [Methylococcus capsulatus str. Bath]
          Length = 172

 Score = 55.7 bits (133), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 25/188 (13%), Positives = 67/188 (35%), Gaps = 22/188 (11%)

Query: 12  KIISCSLAVLLCTSLSSCFFHNNP-VNIYDLTESTKYDESVQRHIQLIITEPITEKILNS 70
           + +S +L + L TS  S      P   ++D   +     +    +   +  P   +    
Sbjct: 2   RRLSWTLMLSLATSACSLLPERPPQPALHDFGAAGAAAPAPWSSVD--VDAPEWLRNDRL 59

Query: 71  EDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIIS 130
           +  ++ + P E++     +W      +++ +L              +   G    Y++  
Sbjct: 60  QYRLLYAKPTELRSYTLDRWIAPPSELLEQRL-----------KAGRSANG----YRLHI 104

Query: 131 AIRSFEINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSR 190
            +++FE   +R  +    S  +I     +    + F  ++     +    +Q+  +A  R
Sbjct: 105 ELQAFEQVFERPGS----SHVMIRLRAETPADTETFQFDQPTASPDAAGAVQAFAQAVDR 160

Query: 191 ISSEIIDW 198
             +++  W
Sbjct: 161 AVAQLRAW 168


>gi|152982032|ref|YP_001354934.1| ABC-type uncharacterized transport system, auxiliary component
           [Janthinobacterium sp. Marseille]
 gi|151282109|gb|ABR90519.1| ABC-type uncharacterized transport system, auxiliary component
           [Janthinobacterium sp. Marseille]
          Length = 203

 Score = 55.4 bits (132), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 40/187 (21%), Positives = 73/187 (39%), Gaps = 13/187 (6%)

Query: 27  SSCFFHNNPVNIYDLTE--STKYDESVQRHIQLIITEPITEKILNSEDIIVRSS---PIE 81
           + C  +   + +YDL    + K D +V     L I E      L+++ +  R +     +
Sbjct: 20  TGCAGNAPALTLYDLGPLQAQKTDTTVNNLPALSIAEVAAPSWLDTQMMFYRLNYANNQQ 79

Query: 82  IQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFEINIDR 141
            +   GSQW+    ++++ +L A     G I  VV  + G      +   +  F  + D 
Sbjct: 80  PRPYAGSQWAMPPAQLLEQRLKARLSQAGGI--VVPADNGAANLPILRIEVDDFSQSFDS 137

Query: 142 ---HCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEIIDW 198
                  I M   + +  +  L  QK+F  +      +      +L  A   I +EI  W
Sbjct: 138 AQHSTINIAMRASLFDGRN--LRAQKMFSRQLPTVSADAQGGAAALASASDAIINEIAVW 195

Query: 199 TLSSLPL 205
            LS++P 
Sbjct: 196 -LSTVPT 201


>gi|322419713|ref|YP_004198936.1| hypothetical protein GM18_2200 [Geobacter sp. M18]
 gi|320126100|gb|ADW13660.1| protein of unknown function DUF330 [Geobacter sp. M18]
          Length = 198

 Score = 55.0 bits (131), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 33/191 (17%), Positives = 74/191 (38%), Gaps = 11/191 (5%)

Query: 12  KIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQR--HIQLIITEPITEKILN 69
           +  S  LA++    LSS    +  V  Y L   +    + Q      + +      +++N
Sbjct: 2   RRTSAPLAIVAALLLSSACSRSPRVTYYTLAPGSPVQSAPQLQQPAAVAVGPVTIPELVN 61

Query: 70  SEDIIVRSSPIEIQYLIGSQWSDKL----PRMIQLKLIANFENNGKISTVVKPNQGIYAD 125
              ++VR +P  +  L   +W++ L    PR++   L     ++   +       G    
Sbjct: 62  RPQLVVRVTPNRVAVLESHRWAEPLKTEIPRLMAQNLGQLLGSSRVSAY--GQGSGGEPR 119

Query: 126 YQIISAIRSFEINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLN 185
           Y+++  I   +     +   +T+    +     S   +    V+EK+        + +L+
Sbjct: 120 YRVLIDITRLDAVPGEN---VTVEASWLVRGVGSARREGRALVQEKVSGAGYEAVVAALS 176

Query: 186 RAFSRISSEII 196
           RA + +S+E+ 
Sbjct: 177 RALAGVSAEVA 187


>gi|300312723|ref|YP_003776815.1| hypothetical protein Hsero_3427 [Herbaspirillum seropedicae SmR1]
 gi|300075508|gb|ADJ64907.1| conserved hypothetical protein [Herbaspirillum seropedicae SmR1]
          Length = 212

 Score = 55.0 bits (131), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 26/169 (15%), Positives = 53/169 (31%), Gaps = 8/169 (4%)

Query: 35  PVNIYDLTESTKYDESVQRHIQ-----LIITEPITEKILNSEDIIVRSSPIEIQYLIGSQ 89
           P   Y L   T    + +   Q     + +      + L    ++VRS    +  L   +
Sbjct: 31  PTQFYTLAAPTDAGATARSAAQGPQTFIEVMPVAVPERLARPQLVVRSDATRVDVLEQER 90

Query: 90  WSDKLPRMIQLKLIANFENNGKISTVVKPNQGI-YADYQIISAIRSFEINIDRHCAIITM 148
           WS      ++  L A          V +  +      Y+I   +R F+  +       + 
Sbjct: 91  WSSPFNNELRDALAAGVAARLGAIDVSRGGRPADQPSYRINVELRDFDA-MRNGQVQASF 149

Query: 149 SLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEIID 197
              I  + D      ++  V E++        + +  +A  +    I D
Sbjct: 150 GWTITRSDDRRSAACRL-TVVERVAGSANADVVAATQKAVGQAVQAIAD 197


>gi|186474288|ref|YP_001861630.1| hypothetical protein Bphy_5507 [Burkholderia phymatum STM815]
 gi|184196620|gb|ACC74584.1| protein of unknown function DUF330 [Burkholderia phymatum STM815]
          Length = 201

 Score = 54.2 bits (129), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 21/197 (10%), Positives = 67/197 (34%), Gaps = 8/197 (4%)

Query: 6   NKIIKKKIISCSLAVLLCTSLSSC-FFHNNPVNIYDLTESTKYDES-VQRHIQLIITEPI 63
            K + +     +    LC +++        P + Y L+     + S       +++    
Sbjct: 1   MKPLTRTGCHAAALFSLCATVALLNGCKTPPSSFYTLSADPSLERSSHPLQGTVVVGPVT 60

Query: 64  TEKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFEN--NGKISTVVKPNQG 121
             ++++   ++ R S  E+     ++W + L   +   +  +       +  +V      
Sbjct: 61  IPELVDRPQLVTRVSGNEVALEEFARWGEPLKSGVAAAIAGDLARLLGSERVSVSSQTVA 120

Query: 122 IYADYQIISAIRSFEINIDRHCAIITMSLK-IINAHDNSLVGQKVFHVEEKLEKDNKLHF 180
               +++   +  F+         + +  +  ++A   + +      V E +        
Sbjct: 121 GTESWRVRIDLVQFD---SMPGEAVAIDARWTVHAAGRTTLLTGRSTVREPVAGAGYDAL 177

Query: 181 IQSLNRAFSRISSEIID 197
           + + +RA + +S +I  
Sbjct: 178 VAAHSRALATVSRDIAA 194


>gi|56479162|ref|YP_160751.1| putative lipoprotein [Aromatoleum aromaticum EbN1]
 gi|56315205|emb|CAI09850.1| hypothetical protein putative lipoprotein [Aromatoleum aromaticum
           EbN1]
          Length = 218

 Score = 53.8 bits (128), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 21/187 (11%), Positives = 59/187 (31%), Gaps = 6/187 (3%)

Query: 25  SLSSCFFHNNPVNIYDLTESTKYDESVQ-RHIQLIITEPITEKILNSEDIIVRSSPIEIQ 83
              +          +DL      + +++    ++ +  P        +  +    P + +
Sbjct: 23  GCGNLGVPAERFTFFDLGLVEPVETALEFPPTRVDVRAPSWLSTGAMQYRLDYRQPAQRE 82

Query: 84  YLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFEINIDRHC 143
               ++W  +   M+++ L      NG  +           + ++   +  F    D   
Sbjct: 83  AYSETRWVAEPAEMLRVALDRALTMNGTANRTANRTA--DGECRLRIELDEFVQVFDSEQ 140

Query: 144 ---AIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEIIDWTL 200
              A I     ++    ++ +  +   V E     +    + +  RA  R++ ++  W  
Sbjct: 141 SSHATIVARAALLAPRSDAELAHRTLVVSEPTPTPDAAGGVFAFRRAVQRLAHDVSFWLA 200

Query: 201 SSLPLSD 207
           S  P + 
Sbjct: 201 SLDPEAA 207


>gi|253700839|ref|YP_003022028.1| hypothetical protein GM21_2220 [Geobacter sp. M21]
 gi|251775689|gb|ACT18270.1| protein of unknown function DUF330 [Geobacter sp. M21]
          Length = 197

 Score = 53.8 bits (128), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 31/192 (16%), Positives = 70/192 (36%), Gaps = 11/192 (5%)

Query: 8   IIKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDL--TESTKYDESVQRHIQLIITEPITE 65
           + K  +   SLA+++  +       +   N Y L    +            + +      
Sbjct: 1   MRKPALCLISLALVMSITACGRSPRS---NFYTLVPQAAPPGQSLSPAAPSVSVGPVTIP 57

Query: 66  KILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYAD 125
           ++++   I+VR +   ++ L   +W++ L   I   +  +       S V    Q   AD
Sbjct: 58  ELVDRPQIVVRVAENRVEVLESHRWAEPLKSEIPRLMAQDLGRMLGSSRVSSYGQSAGAD 117

Query: 126 --YQIISAIRSFEINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQS 183
             Y+++  I   E       A    +L  +   +  + G+ +   +      +    I +
Sbjct: 118 ATYRVLVDIVRLE--AIPAEAATVQALWTVRRGNARIKGESLVREKVSAAGYD--QLISA 173

Query: 184 LNRAFSRISSEI 195
            +RA + +SS+I
Sbjct: 174 CSRALAGVSSDI 185


>gi|170691587|ref|ZP_02882752.1| conserved hypothetical protein [Burkholderia graminis C4D1M]
 gi|170143792|gb|EDT11955.1| conserved hypothetical protein [Burkholderia graminis C4D1M]
          Length = 213

 Score = 53.8 bits (128), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 27/208 (12%), Positives = 73/208 (35%), Gaps = 15/208 (7%)

Query: 1   MDKKLNKIIKKKIISCSLAVLLCTSLSSCFFH--NNPVNI----YDLTESTKYDESVQRH 54
           M + +++++  ++     A     +         + P  +    YD         +  + 
Sbjct: 1   MSRSIHRLLSSRVTRAGAACAALVAAGLLAAGCTSTPAALSDIRYDFGPPKPASSAGTQP 60

Query: 55  IQLIITEPITEKILNSEDIIVR---SSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGK 111
             + + +    ++L S+ ++ R   +   ++     S W+     ++  +L     + G 
Sbjct: 61  -AVKVLDVSAPEVLRSDKLVYRIGYADSQQVAAYANSHWTMPPSELLTQRLRGALSSRG- 118

Query: 112 ISTVVKPNQGIYADYQIISAIRSFEINIDRHC-AIITMSLKIINAHDNSLVGQKVFHVEE 170
             TV+    G+ A   +   +  FE   D    +   ++ +     +  ++GQ+ F    
Sbjct: 119 --TVLTGADGVPAPV-LKVDLNEFEQVFDSQAQSHAAVTARATLTQNGKVIGQRTFISRA 175

Query: 171 KLEKDNKLHFIQSLNRAFSRISSEIIDW 198
                +     Q+L  A   + ++I  W
Sbjct: 176 PSRSADAAGGAQALAAASDDLVAQIGAW 203


>gi|28898793|ref|NP_798398.1| hypothetical protein VP2019 [Vibrio parahaemolyticus RIMD 2210633]
 gi|153839716|ref|ZP_01992383.1| conserved hypothetical protein [Vibrio parahaemolyticus AQ3810]
 gi|260364134|ref|ZP_05776840.1| putative lipoprotein [Vibrio parahaemolyticus K5030]
 gi|260877217|ref|ZP_05889572.1| putative lipoprotein [Vibrio parahaemolyticus AN-5034]
 gi|260897837|ref|ZP_05906333.1| putative lipoprotein [Vibrio parahaemolyticus Peru-466]
 gi|260901534|ref|ZP_05909929.1| putative lipoprotein [Vibrio parahaemolyticus AQ4037]
 gi|28807012|dbj|BAC60282.1| conserved hypothetical protein [Vibrio parahaemolyticus RIMD
           2210633]
 gi|149746769|gb|EDM57757.1| conserved hypothetical protein [Vibrio parahaemolyticus AQ3810]
 gi|308087641|gb|EFO37336.1| putative lipoprotein [Vibrio parahaemolyticus Peru-466]
 gi|308090326|gb|EFO40021.1| putative lipoprotein [Vibrio parahaemolyticus AN-5034]
 gi|308110917|gb|EFO48457.1| putative lipoprotein [Vibrio parahaemolyticus AQ4037]
 gi|308115231|gb|EFO52771.1| putative lipoprotein [Vibrio parahaemolyticus K5030]
          Length = 192

 Score = 53.8 bits (128), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 31/187 (16%), Positives = 71/187 (37%), Gaps = 8/187 (4%)

Query: 17  SLAVLLCTSLSSCFFHNNPV-NIYDLTESTK--YDESVQRHIQLIITEPITEKI-LNSED 72
            LA  L T L+ C         +Y L ++     ++       L++  P      LN   
Sbjct: 6   LLATALVTGLTGCSSAPETTGALYLLPKAETKTSNQMSVAERPLLVIRPAQLASYLNDNS 65

Query: 73  IIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIY--ADYQIIS 130
           I+ R+S  +I      QW+  +   I  +++A           V+ N  +    + ++  
Sbjct: 66  IVYRTSDTQIVQAKRHQWAQSISEQITQRVVAELRQKQSDYWPVEMNNLLDQSGESKLQL 125

Query: 131 AIRSFEINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSR 190
            +  F  +   + A I     +I+A  N +   +V  +   L+ +     + +L+   ++
Sbjct: 126 TLNKFNGSYQGN-AEIEGEWLLIDASGNVVRSSQV-KILMPLQDEGYDALVDALSAGLNQ 183

Query: 191 ISSEIID 197
           ++ ++  
Sbjct: 184 LTDDMAA 190


>gi|312797429|ref|YP_004030351.1| transcriptional regulator [Burkholderia rhizoxinica HKI 454]
 gi|312169204|emb|CBW76207.1| Transcriptional regulator [Burkholderia rhizoxinica HKI 454]
          Length = 257

 Score = 53.8 bits (128), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 31/219 (14%), Positives = 69/219 (31%), Gaps = 31/219 (14%)

Query: 9   IKKKIISCSLAVLLCTSLSSCFFH----NNPVNIYDLTESTKYDESVQ------------ 52
           +  +I+   + +L   +   C       +   + YDL        S              
Sbjct: 27  MSSRIMGSLVVLLGVFTFGGCGTAGHRASPAAHRYDLGAPAIAVHSGPMSPNGVAPRAGA 86

Query: 53  ---RHIQLIITEPITEKILNSEDIIVRSS---PIEIQYLIGSQWSDKLPRMIQLKLIANF 106
                    + +      L+S+ I+ R +     + +    S+W     +++  +L    
Sbjct: 87  AAPAFGPFKLVDMGAPASLDSDGIVYRLAYAHAQQPRTYASSRWVATPAQLLTQRLRVLL 146

Query: 107 ENNGKISTVVKPNQGIYADYQIISAIRSFEINIDRHCA---IITMSLKIINAHDNSLVGQ 163
              G    VV P   + A   +   +  FE   D+  A   ++ +   ++         Q
Sbjct: 147 ---GARGAVVSPGDPVSAPV-LRVELLEFEQIFDKPGASRGVVALRATLL--RRGRQFTQ 200

Query: 164 KVFHVEEKLEKDNKLHFIQSLNRAFSRISSEIIDWTLSS 202
             F  +      +    +++L +A     S++ DW  S 
Sbjct: 201 ATFGADAPASSADASGGVRALAQASDVALSQLADWLASQ 239


>gi|328474648|gb|EGF45453.1| hypothetical protein VP10329_18135 [Vibrio parahaemolyticus 10329]
          Length = 192

 Score = 53.4 bits (127), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 31/187 (16%), Positives = 72/187 (38%), Gaps = 8/187 (4%)

Query: 17  SLAVLLCTSLSSCFFHNNPV-NIYDLTESTK--YDESVQRHIQLIITEPITEKI-LNSED 72
            LA  L T L+ C         +Y L ++     ++       L++  P      LN   
Sbjct: 6   LLATALITGLTGCSSAPEATGALYLLPKAETKTSNQMSVAERPLLVIRPAQLASYLNDNS 65

Query: 73  IIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIY--ADYQIIS 130
           I+ R+S  +I      QW+  +   I  +++A           V+ N  +    + ++  
Sbjct: 66  IVYRTSNTQIVQAKRHQWAQSISEQITQRIVAELRQKQSDYWPVEMNNLLDQSGESKLQL 125

Query: 131 AIRSFEINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSR 190
           ++  F  +   + A I     +I+A  N +   ++  +   L+ +     + +L+   ++
Sbjct: 126 SLNKFNGSYQGN-AEIEGEWLLIDASGNVVRSSQI-KILMPLQDEGYDALVDALSAGLNQ 183

Query: 191 ISSEIID 197
           ++ +I  
Sbjct: 184 LTDDIAA 190


>gi|186475418|ref|YP_001856888.1| hypothetical protein Bphy_0652 [Burkholderia phymatum STM815]
 gi|184191877|gb|ACC69842.1| protein of unknown function DUF330 [Burkholderia phymatum STM815]
          Length = 196

 Score = 53.4 bits (127), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 24/183 (13%), Positives = 68/183 (37%), Gaps = 3/183 (1%)

Query: 16  CSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDE-SVQRHIQLIITEPITEKILNSEDII 74
            SL V+    L++C       + Y L+  +  +       + +++      ++++   ++
Sbjct: 10  ASLCVVGMALLAACASPR--SSFYTLSPDSTLESVGAPLSVAVVVGPVTIPELVDRPQLV 67

Query: 75  VRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRS 134
            R S  E++    ++W + L   +   + A+         V   +Q +         +  
Sbjct: 68  TRVSGNEVRLDEFARWGEPLKSGVADVIAADLTRLLGSKQVSVSSQTVAGTEACRVRVDI 127

Query: 135 FEINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSE 194
            + +     A+   +L  +     + +      V E ++  ++   + + +RA + +S E
Sbjct: 128 VQFDSMPGEAVAVDALWTVRVAGRTTLLTGRSTVREPVQGTDEAALVAAHSRALAAVSRE 187

Query: 195 IID 197
           I  
Sbjct: 188 IAA 190


>gi|197118383|ref|YP_002138810.1| lipoprotein [Geobacter bemidjiensis Bem]
 gi|197087743|gb|ACH39014.1| lipoprotein of unknown function DUF330 [Geobacter bemidjiensis Bem]
          Length = 196

 Score = 53.4 bits (127), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 37/191 (19%), Positives = 75/191 (39%), Gaps = 10/191 (5%)

Query: 8   IIKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIITEPITEKI 67
           + K  +   SLA+++  +  S    +   + Y L        ++      +   P+T   
Sbjct: 1   MRKPALCLISLALVMSVTACSRSPRS---SFYTLVPQAAPPPALSPAAPSVSVGPVTIPE 57

Query: 68  L-NSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYAD- 125
           L +   I+VR +   ++ L   +W++ L   I   +  +       S V    Q   AD 
Sbjct: 58  LVDRPQIVVRVAENRVEVLESHRWAEPLKSEIPRLMAQDLGRMLGSSRVSSYGQSAGADA 117

Query: 126 -YQIISAIRSFEINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSL 184
            Y+++  I   E  +    A +  +L  +   +  + G+ +  V EK+        I + 
Sbjct: 118 TYRVLVDIVRLEA-VPGDAATVQ-ALWTVRRGNARIKGESL--VREKVSAPGYDQLISAC 173

Query: 185 NRAFSRISSEI 195
           +RA   +SS+I
Sbjct: 174 SRALGGVSSDI 184


>gi|320353200|ref|YP_004194539.1| hypothetical protein Despr_1076 [Desulfobulbus propionicus DSM
           2032]
 gi|320121702|gb|ADW17248.1| protein of unknown function DUF330 [Desulfobulbus propionicus DSM
           2032]
          Length = 211

 Score = 53.4 bits (127), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 34/198 (17%), Positives = 76/198 (38%), Gaps = 14/198 (7%)

Query: 9   IKKKIISCSLAVLLCTSL-SSCFFHNNPVNIYDLTESTKYDESV--QRHIQLIITEPITE 65
               +      +L+C  L   C        +Y L    +           +LI+  PI  
Sbjct: 3   TANNVGRSLGWLLVCALLLGGCLKPTTNNILYALQPVRQPPLGHDFTTSKELILLMPIQL 62

Query: 66  KI-LNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFEN---NGKISTVVKPNQG 121
              L    ++ + +  E +      W+  L + I  +++A+ ++     +++    P  G
Sbjct: 63  APHLQGRGLLTQRTSGEARASANHLWAGPLDQQISQQMVADLKDLLATDQVAAYPGPRYG 122

Query: 122 IYADYQIISAIRSFEINIDR--HCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLH 179
           +   YQ+   I  F  N  +    A+ T+S    ++   ++V +K F     ++K     
Sbjct: 123 V-IRYQLEVDINEFSGNGRQFITTAVYTLS----DSVRKTIVARKTFRQTRPIDKPEYSG 177

Query: 180 FIQSLNRAFSRISSEIID 197
           ++ S ++A + +S E+  
Sbjct: 178 YVDSGSQAVADLSREVAA 195


>gi|239813315|ref|YP_002942225.1| hypothetical protein Vapar_0296 [Variovorax paradoxus S110]
 gi|239799892|gb|ACS16959.1| protein of unknown function DUF330 [Variovorax paradoxus S110]
          Length = 227

 Score = 53.4 bits (127), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 18/133 (13%), Positives = 46/133 (34%), Gaps = 14/133 (10%)

Query: 63  ITEKILNSEDIIVRSS---PIEIQYLIGSQWSDKLPRMIQLKLIANF-ENNGKIS----T 114
            +   L+S  I+ R       E++    S+WS    ++++ +L     E    +      
Sbjct: 73  ESNTRLDSTQILYRLGYADANELRPYGQSRWSLAPAQLLRQRLRDALAERRTVLGPEESA 132

Query: 115 VVKPNQGIYADYQIISAIRSFE---INIDRHCAIITMSLKIINAHDN--SLVGQKVFHVE 169
            +   +G   D  +  ++  F     +      ++ +   +I        ++GQ+ F V 
Sbjct: 133 TIARAEGKVPD-TLRISLDEFSHYFESASSSAGLVRLRATLIRGTTGGDRVLGQRSFTVR 191

Query: 170 EKLEKDNKLHFIQ 182
                 +    ++
Sbjct: 192 RPAPSADAPGGVK 204


>gi|84394022|ref|ZP_00992760.1| hypothetical protein V12B01_03543 [Vibrio splendidus 12B01]
 gi|84375359|gb|EAP92268.1| hypothetical protein V12B01_03543 [Vibrio splendidus 12B01]
          Length = 167

 Score = 53.0 bits (126), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 25/178 (14%), Positives = 62/178 (34%), Gaps = 21/178 (11%)

Query: 18  LAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIITEPITEKILNSEDIIVRS 77
           +++++   L  C    +  N Y L EST   +     ++  +  P     L++  I  R 
Sbjct: 6   ISLVVSVGLLGCAAPTDGTNAYLLPEST--LDKPIFKVKTSVDLPD---YLDTIGIAYRK 60

Query: 78  SPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFEI 137
           S  E+       W++ L  +++ +             V   +     + ++      F  
Sbjct: 61  SENELVSARKHVWAENLEGLLEER-------------VNTSDTSGEPERELTITFEQFNG 107

Query: 138 NIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEI 195
           +   +     +    + +   S + +  F  +  L++      +++L      + SEI
Sbjct: 108 SYTGNA---EVKGTWVLSDQGSELARADFESKVPLKEAGYEALVEALGEGLDEVLSEI 162


>gi|194099087|ref|YP_002002170.1| Lipoprotein [Neisseria gonorrhoeae NCCP11945]
 gi|240017014|ref|ZP_04723554.1| Lipoprotein [Neisseria gonorrhoeae FA6140]
 gi|193934377|gb|ACF30201.1| Lipoprotein [Neisseria gonorrhoeae NCCP11945]
          Length = 172

 Score = 53.0 bits (126), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 28/189 (14%), Positives = 73/189 (38%), Gaps = 17/189 (8%)

Query: 9   IKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIITEPITEKIL 68
           ++   I+ +L +  C ++ S  +   P + Y         +  +  +++ + EP+    L
Sbjct: 1   MRLFPIAAALTLAACGTVQSTQYFVLPDSRYI----RPATQGGETAVEVRLAEPLKRGGL 56

Query: 69  NSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQI 128
                + ++ P  I       W+D L  M++  L   F       T V  ++    D + 
Sbjct: 57  -----VYQTDPYRINTAQNHVWADTLDDMLEAALSNAFNRLDSTRTFVPASRSGSTD-KW 110

Query: 129 ISAIRSFEINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAF 188
              I +F+ +      +I+    + +  +      + FH+E + + D       +L +  
Sbjct: 111 TVYIDAFQGSYTGKT-LISGYAVLPDGKN------RPFHIETEQQGDGYAAMTAALEQGL 163

Query: 189 SRISSEIID 197
            + + ++++
Sbjct: 164 KQAAQQMVE 172


>gi|303247227|ref|ZP_07333501.1| protein of unknown function DUF330 [Desulfovibrio fructosovorans
           JJ]
 gi|302491386|gb|EFL51274.1| protein of unknown function DUF330 [Desulfovibrio fructosovorans
           JJ]
          Length = 198

 Score = 52.7 bits (125), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 34/204 (16%), Positives = 76/204 (37%), Gaps = 13/204 (6%)

Query: 6   NKIIKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRH--IQLIITEPI 63
            +   + I +   A   C  L +    + P + + L+ + K + +        + I    
Sbjct: 1   MRRRPRTIAAVVAAAACCLPLLTGCGKSAPTHFFSLSTAAKENVAAPDGPCQSIGIGPVD 60

Query: 64  TEKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKI----STVVKP- 118
               L+   I+ R  P ++      QW++ L    Q  L    EN G +      V  P 
Sbjct: 61  FPAYLDRSQIVTRLGPNQMHLAEFDQWAEPLRDNFQRALA---ENLGALICAKPLVTYPW 117

Query: 119 NQGIYADYQIISAIRSFEINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKL 178
             G + D QI+  +  F+ ++ ++ A +  S  +++  D + +  +    +E        
Sbjct: 118 PVGGHPDKQIVIQVARFDGSLGQN-ATLRASWSVVDG-DGNNLAWRSVEYQEAATGPGYA 175

Query: 179 HFIQSLNRAFSRISSEIIDWTLSS 202
               + ++   + + ++ D TL  
Sbjct: 176 DLAAAQSKLVEKFAKDVAD-TLRQ 198


>gi|258543507|ref|YP_003188940.1| hypothetical protein APA01_24530 [Acetobacter pasteurianus IFO
           3283-01]
 gi|256634585|dbj|BAI00561.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-01]
 gi|256637641|dbj|BAI03610.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-03]
 gi|256640695|dbj|BAI06657.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-07]
 gi|256643750|dbj|BAI09705.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-22]
 gi|256646805|dbj|BAI12753.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-26]
 gi|256649858|dbj|BAI15799.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-32]
 gi|256652848|dbj|BAI18782.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-01-42C]
 gi|256655902|dbj|BAI21829.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-12]
          Length = 232

 Score = 52.7 bits (125), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 19/146 (13%), Positives = 41/146 (28%), Gaps = 15/146 (10%)

Query: 11  KKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIITEPITEKILNS 70
             +    +     T+ S         ++Y L  +    +       + +  P     L+ 
Sbjct: 23  SGVAGLGVMAFTLTACSGGSP-----SLYTLAVTPGQPQPG-GPRFVEVRLPTVASGLDR 76

Query: 71  EDIIVRSSPIEIQYLIGSQWSDKLP----RMIQLKLIANFENNGKISTVVKPNQGIYADY 126
           + I+   S  ++       WSD LP    R++   L       G    V         + 
Sbjct: 77  DRIVTADSGYKLTVSAADAWSDSLPAQISRVMAGDLAQRLPGTGVF--VENDTVATEPEA 134

Query: 127 QIISAIRSFEINIDRHCAIITMSLKI 152
            +  +I  F          + +   +
Sbjct: 135 YVDMSISRFST---GPSGNVELDATL 157


>gi|116749846|ref|YP_846533.1| hypothetical protein Sfum_2417 [Syntrophobacter fumaroxidans MPOB]
 gi|116698910|gb|ABK18098.1| protein of unknown function DUF330 [Syntrophobacter fumaroxidans
           MPOB]
          Length = 204

 Score = 52.7 bits (125), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 35/199 (17%), Positives = 62/199 (31%), Gaps = 14/199 (7%)

Query: 15  SCSLAVLLCTSLSSCFFHNNPVNIYDL-----TESTKYDESVQRHIQLIITEPITEKILN 69
           + ++  L    L+ C         Y L        +             I      + L+
Sbjct: 10  TLAVFGLFVFLLAGCAHTPQ-SRFYLLQSRVPPGMSGAVSPGADGAVFGIGPVKFPEYLD 68

Query: 70  SEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPN--QGIYADYQ 127
              I+ R+   EIQ     +W++ L       L  N       + VV           YQ
Sbjct: 69  RPQIVTRTGLNEIQLAEYHRWAEPLKDNFARVLTENLAALLPANGVVAFPWPGSARVRYQ 128

Query: 128 IISAIRSFEINIDRHCAIITMSLK--IINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLN 185
           ++  +  F+    R      +  +  I++   N+ V  K   +   +        + + N
Sbjct: 129 VMVEVTRFDGIAGREA---RLDAQWTIVDVAANTTVTTKKTGIARPVASPGHESLVAAQN 185

Query: 186 RAFSRISSEIIDWTLSSLP 204
            A     +EI D  L SLP
Sbjct: 186 EALGEFGAEIAD-ALKSLP 203


>gi|16759946|ref|NP_455563.1| lipoprotein [Salmonella enterica subsp. enterica serovar Typhi str.
           CT18]
 gi|16764424|ref|NP_460039.1| outer membrane protein [Salmonella enterica subsp. enterica serovar
           Typhimurium str. LT2]
 gi|29142282|ref|NP_805624.1| lipoprotein [Salmonella enterica subsp. enterica serovar Typhi str.
           Ty2]
 gi|56413938|ref|YP_151013.1| lipoprotein [Salmonella enterica subsp. enterica serovar Paratyphi
           A str. ATCC 9150]
 gi|161614741|ref|YP_001588706.1| hypothetical protein SPAB_02493 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|167993437|ref|ZP_02574531.1| putative lipoprotein [Salmonella enterica subsp. enterica serovar
           4,[5],12:i:- str. CVM23701]
 gi|168237117|ref|ZP_02662175.1| putative lipoprotein [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. SL480]
 gi|168243853|ref|ZP_02668785.1| putative lipoprotein [Salmonella enterica subsp. enterica serovar
           Heidelberg str. SL486]
 gi|168264745|ref|ZP_02686718.1| putative lipoprotein [Salmonella enterica subsp. enterica serovar
           Hadar str. RI_05P066]
 gi|168467504|ref|ZP_02701341.1| putative lipoprotein [Salmonella enterica subsp. enterica serovar
           Newport str. SL317]
 gi|194445877|ref|YP_002040268.1| putative lipoprotein [Salmonella enterica subsp. enterica serovar
           Newport str. SL254]
 gi|194448567|ref|YP_002045067.1| hypothetical protein SeHA_C1174 [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL476]
 gi|194736283|ref|YP_002114065.1| putative lipoprotein [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. CVM19633]
 gi|197248455|ref|YP_002145935.1| putative lipoprotein [Salmonella enterica subsp. enterica serovar
           Agona str. SL483]
 gi|197263115|ref|ZP_03163189.1| putative lipoprotein [Salmonella enterica subsp. enterica serovar
           Saintpaul str. SARA23]
 gi|197362861|ref|YP_002142498.1| lipoprotein [Salmonella enterica subsp. enterica serovar Paratyphi
           A str. AKU_12601]
 gi|200389299|ref|ZP_03215910.1| putative lipoprotein [Salmonella enterica subsp. enterica serovar
           Virchow str. SL491]
 gi|204929851|ref|ZP_03220872.1| putative lipoprotein [Salmonella enterica subsp. enterica serovar
           Javiana str. GA_MM04042433]
 gi|205352220|ref|YP_002226021.1| lipoprotein [Salmonella enterica subsp. enterica serovar Gallinarum
           str. 287/91]
 gi|207856410|ref|YP_002243061.1| lipoprotein [Salmonella enterica subsp. enterica serovar
           Enteritidis str. P125109]
 gi|213161912|ref|ZP_03347622.1| putative lipoprotein [Salmonella enterica subsp. enterica serovar
           Typhi str. E00-7866]
 gi|213417135|ref|ZP_03350279.1| putative lipoprotein [Salmonella enterica subsp. enterica serovar
           Typhi str. E01-6750]
 gi|213425906|ref|ZP_03358656.1| putative lipoprotein [Salmonella enterica subsp. enterica serovar
           Typhi str. E02-1180]
 gi|213611227|ref|ZP_03370053.1| putative lipoprotein [Salmonella enterica subsp. enterica serovar
           Typhi str. E98-2068]
 gi|213646603|ref|ZP_03376656.1| putative lipoprotein [Salmonella enterica subsp. enterica serovar
           Typhi str. J185]
 gi|213857694|ref|ZP_03384665.1| putative lipoprotein [Salmonella enterica subsp. enterica serovar
           Typhi str. M223]
 gi|224584428|ref|YP_002638226.1| lipoprotein [Salmonella enterica subsp. enterica serovar Paratyphi
           C strain RKS4594]
 gi|238911112|ref|ZP_04654949.1| putative lipoprotein [Salmonella enterica subsp. enterica serovar
           Tennessee str. CDC07-0191]
 gi|289826796|ref|ZP_06545731.1| putative lipoprotein [Salmonella enterica subsp. enterica serovar
           Typhi str. E98-3139]
 gi|25350775|pir||AD0626 probable lipoprotein STY1086 [imported] - Salmonella enterica
           subsp. enterica serovar Typhi (strain CT18)
 gi|16419580|gb|AAL19998.1| putative outer membrane protein [Salmonella enterica subsp.
           enterica serovar Typhimurium str. LT2]
 gi|16502240|emb|CAD08191.1| putative lipoprotein [Salmonella enterica subsp. enterica serovar
           Typhi]
 gi|29137912|gb|AAO69473.1| putative lipoprotein [Salmonella enterica subsp. enterica serovar
           Typhi str. Ty2]
 gi|56128195|gb|AAV77701.1| putative lipoprotein [Salmonella enterica subsp. enterica serovar
           Paratyphi A str. ATCC 9150]
 gi|161364105|gb|ABX67873.1| hypothetical protein SPAB_02493 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|194404540|gb|ACF64762.1| putative lipoprotein [Salmonella enterica subsp. enterica serovar
           Newport str. SL254]
 gi|194406871|gb|ACF67090.1| putative lipoprotein [Salmonella enterica subsp. enterica serovar
           Heidelberg str. SL476]
 gi|194711785|gb|ACF91006.1| putative lipoprotein [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. CVM19633]
 gi|195630028|gb|EDX48680.1| putative lipoprotein [Salmonella enterica subsp. enterica serovar
           Newport str. SL317]
 gi|197094338|emb|CAR59850.1| putative lipoprotein [Salmonella enterica subsp. enterica serovar
           Paratyphi A str. AKU_12601]
 gi|197212158|gb|ACH49555.1| putative lipoprotein [Salmonella enterica subsp. enterica serovar
           Agona str. SL483]
 gi|197241370|gb|EDY23990.1| putative lipoprotein [Salmonella enterica subsp. enterica serovar
           Saintpaul str. SARA23]
 gi|197289767|gb|EDY29128.1| putative lipoprotein [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. SL480]
 gi|199601744|gb|EDZ00290.1| putative lipoprotein [Salmonella enterica subsp. enterica serovar
           Virchow str. SL491]
 gi|204320845|gb|EDZ06046.1| putative lipoprotein [Salmonella enterica subsp. enterica serovar
           Javiana str. GA_MM04042433]
 gi|205272001|emb|CAR36845.1| putative lipoprotein [Salmonella enterica subsp. enterica serovar
           Gallinarum str. 287/91]
 gi|205328520|gb|EDZ15284.1| putative lipoprotein [Salmonella enterica subsp. enterica serovar
           4,[5],12:i:- str. CVM23701]
 gi|205337125|gb|EDZ23889.1| putative lipoprotein [Salmonella enterica subsp. enterica serovar
           Heidelberg str. SL486]
 gi|205346842|gb|EDZ33473.1| putative lipoprotein [Salmonella enterica subsp. enterica serovar
           Hadar str. RI_05P066]
 gi|206708213|emb|CAR32513.1| putative lipoprotein [Salmonella enterica subsp. enterica serovar
           Enteritidis str. P125109]
 gi|224468955|gb|ACN46785.1| putative lipoprotein [Salmonella enterica subsp. enterica serovar
           Paratyphi C strain RKS4594]
 gi|261246282|emb|CBG24090.1| putative lipoprotein [Salmonella enterica subsp. enterica serovar
           Typhimurium str. D23580]
 gi|267992816|gb|ACY87701.1| putative outer membrane protein [Salmonella enterica subsp.
           enterica serovar Typhimurium str. 14028S]
 gi|301157609|emb|CBW17101.1| putative lipoprotein [Salmonella enterica subsp. enterica serovar
           Typhimurium str. SL1344]
 gi|312912056|dbj|BAJ36030.1| putative lipoprotein [Salmonella enterica subsp. enterica serovar
           Typhimurium str. T000240]
 gi|322714056|gb|EFZ05627.1| putative lipoprotein [Salmonella enterica subsp. enterica serovar
           Choleraesuis str. A50]
 gi|323129333|gb|ADX16763.1| putative lipoprotein [Salmonella enterica subsp. enterica serovar
           Typhimurium str. 4/74]
 gi|326627265|gb|EGE33608.1| putative lipoprotein [Salmonella enterica subsp. enterica serovar
           Gallinarum str. 9]
          Length = 187

 Score = 52.7 bits (125), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 34/184 (18%), Positives = 76/184 (41%), Gaps = 11/184 (5%)

Query: 18  LAVLLCTSLSSCFFHNNPVNIYDLTESTK--YDESVQRHIQLIITEPITEKILNSEDIIV 75
           L V++   L+SC       + Y L  +       + Q +  L + +      L    ++ 
Sbjct: 5   LVVIMAFWLASCSSGGENKSYYQLPIAQSGVQSTASQGNRLLWVEQVSVPDYLAGNGVVY 64

Query: 76  RSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKIST--VVKPNQGIYADYQIISAIR 133
           ++S ++      + W+  L + ++  L+AN   + ++    V     G   D  +   + 
Sbjct: 65  QTSDVQYVIANNNLWASPLDQQLRNTLVANL--SARLPGWVVASQPLGTTQD-TLNVTVT 121

Query: 134 SFEINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISS 193
            F    D     + +S + +  H+  L+ ++ FH+E   +KD     ++ L  A+S+ ++
Sbjct: 122 GFHGRYDGK---VIVSGEWLLNHNGQLI-KRPFHIEASQQKDGYDEMVKVLASAWSQEAA 177

Query: 194 EIID 197
            I D
Sbjct: 178 AIAD 181


>gi|271500192|ref|YP_003333217.1| hypothetical protein Dd586_1646 [Dickeya dadantii Ech586]
 gi|270343747|gb|ACZ76512.1| protein of unknown function DUF330 [Dickeya dadantii Ech586]
          Length = 188

 Score = 52.7 bits (125), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 29/178 (16%), Positives = 62/178 (34%), Gaps = 10/178 (5%)

Query: 22  LCTSLSSCFFHNNPVNIYDLTESTKYDES----VQRHIQLIITEPITEKILNSEDIIVRS 77
           L   L++C         Y L   T+   S         QL +   I    L    I+ ++
Sbjct: 9   LVVVLAACSSPQKVY--YQLPAMTQGTASLSATPADSRQLWVAPVILTDSLAGNGIVFQT 66

Query: 78  SPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFEI 137
           S +       + W+  L + +Q  L ++         VV       +   +   + +F+ 
Sbjct: 67  SAVRYTIATNNLWASPLDQQLQQALASSLRARLPGWNVVTAGVAGASASSLQINVTAFQG 126

Query: 138 NIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEI 195
             D   A+I      +   +  +V  + F  E    +D     + +L + + +++ +I
Sbjct: 127 RFDGK-AVIQGD--WVLHSNKRIV-TQPFSFEVAQTEDGYDALVAALGKGWQQVAEQI 180


>gi|168821984|ref|ZP_02833984.1| putative lipoprotein [Salmonella enterica subsp. enterica serovar
           Weltevreden str. HI_N05-537]
 gi|205341480|gb|EDZ28244.1| putative lipoprotein [Salmonella enterica subsp. enterica serovar
           Weltevreden str. HI_N05-537]
 gi|320085279|emb|CBY95063.1| Uncharacterized lipoprotein ymbA Flags: Precursor [Salmonella
           enterica subsp. enterica serovar Weltevreden str.
           2007-60-3289-1]
          Length = 187

 Score = 52.3 bits (124), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 34/182 (18%), Positives = 73/182 (40%), Gaps = 7/182 (3%)

Query: 18  LAVLLCTSLSSCFFHNNPVNIYDLTESTK--YDESVQRHIQLIITEPITEKILNSEDIIV 75
           L V++   L+SC       + Y L  +       + Q +  L + +      L    ++ 
Sbjct: 5   LVVIMAFWLASCSSGGENKSYYQLPIAQSGVQSTASQGNRLLWVEQVSVPDYLAGNGVVY 64

Query: 76  RSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSF 135
           ++S ++      + W+  L + ++  L+AN         V     G   D  +   +  F
Sbjct: 65  QTSDVQYVIANNNLWASPLDQQLRNTLVANLSARLPSWVVASQPLGTTQD-TLNVTVTGF 123

Query: 136 EINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEI 195
               D     + +S + +  H+  L+ ++ FH+E   +KD     ++ L  A+S+ ++ I
Sbjct: 124 HGRYDGK---VIVSGEWLLNHNGQLI-KRPFHIEASQQKDGYDEMVKVLASAWSQEAAAI 179

Query: 196 ID 197
            D
Sbjct: 180 AD 181


>gi|294635640|ref|ZP_06714116.1| putative outer membrane protein [Edwardsiella tarda ATCC 23685]
 gi|291091023|gb|EFE23584.1| putative outer membrane protein [Edwardsiella tarda ATCC 23685]
          Length = 189

 Score = 52.3 bits (124), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 28/190 (14%), Positives = 73/190 (38%), Gaps = 8/190 (4%)

Query: 8   IIKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIITEPITEKI 67
           + +  I+  +L +  C+   S  ++  PV   +   S    ++  +  QL +       +
Sbjct: 2   MKRGMILLAALVLSACSGAGSKQYYQLPV---EPAVSRAVTQTAAQTHQLWVQPVNVADL 58

Query: 68  LNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQ 127
           L    ++ + S ++      + W+  L + +   L+A          V     G+  D  
Sbjct: 59  LGGMGVVYQQSDVQFVTASNNLWASPLSQQLTQSLVAGLGAAMPGWLVSTQPLGMSQD-S 117

Query: 128 IISAIRSFEINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRA 187
           +   I +F    D     + ++ + +  H   ++ Q+ FH+    + D     +++L +A
Sbjct: 118 LTVNINAFYGRYDGK---VVVAGEWLLTHQG-VLTQRAFHIVLPQQGDGYDALVRTLGQA 173

Query: 188 FSRISSEIID 197
           + +  + +  
Sbjct: 174 WQQEIAAMAG 183


>gi|226946439|ref|YP_002801512.1| hypothetical protein Avin_44160 [Azotobacter vinelandii DJ]
 gi|226721366|gb|ACO80537.1| Conserved hypothetical protein [Azotobacter vinelandii DJ]
          Length = 192

 Score = 52.3 bits (124), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 29/195 (14%), Positives = 71/195 (36%), Gaps = 14/195 (7%)

Query: 18  LAVLLCTSLSSCFFHNNPVN-IYDLTE-STKYDESVQRHIQLIITEPITEKILNSEDIIV 75
           LA +L  SL+     + PV   Y L+  +     +  R   + +      ++++   +++
Sbjct: 4   LARVLVASLTLGGCASAPVERFYTLSAVAVADPATQPRAYSVTVDPVGVPEMVDRPQLVL 63

Query: 76  RSSPIEIQYLIGSQWSDKL----PRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISA 131
           R     +  +   +W+  L     +++   L          +  +       +DY++   
Sbjct: 64  RLDANRVSIMEHERWATPLQSGIGQVVAANLTRLLGGAWVAAHPMSATT--ASDYRVTLD 121

Query: 132 IRSFEINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRI 191
           ++ FE       A + +   I +A    +   +   + E          + + +RA + +
Sbjct: 122 VQRFES-APGAAADLDVLWTIRSARGALVKAGRS-TLSEPPGGAGTEALVAAHDRALAAL 179

Query: 192 SSEIIDWTLSSLPLS 206
           S +I      +LP S
Sbjct: 180 SRDIA----RALPAS 190


>gi|261416604|ref|YP_003250287.1| protein of unknown function DUF330 [Fibrobacter succinogenes subsp.
           succinogenes S85]
 gi|261373060|gb|ACX75805.1| protein of unknown function DUF330 [Fibrobacter succinogenes subsp.
           succinogenes S85]
 gi|302325905|gb|ADL25106.1| putative lipoprotein [Fibrobacter succinogenes subsp. succinogenes
           S85]
          Length = 198

 Score = 52.3 bits (124), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 20/193 (10%), Positives = 71/193 (36%), Gaps = 4/193 (2%)

Query: 8   IIKKKIISCSLAVLLCTSLSSCFFHN-NPVNIYDLTESTKYDESVQRHIQLIITEPITEK 66
           + K   +    A+L   +L+ C   +  P   Y ++  +          ++ + +   + 
Sbjct: 1   MFKANRLLAVAALLSVFTLTGCLGGSTEPSRYYTVSAESISVAGATSDARIHVKKFTIDP 60

Query: 67  ILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADY 126
                +I+ R SP +  +     W+ +  +M+          +    +V     G   D+
Sbjct: 61  AYQRTNIVYRESPYDFMFYDLDLWATRPEQMLTQVAGEYLIKSNMFKSVDLKPMG-KPDF 119

Query: 127 QIISAIRSFEINIDRHCAIITMSLKIINAHDNSLVG--QKVFHVEEKLEKDNKLHFIQSL 184
           +++  + + E   +       +++++            +K +   + + K +     ++L
Sbjct: 120 ELLGNVDAIEEIDEGSSQEAHLAVQLTFRKVGEDAPLWEKRYDERQSMSKRDAHSAAEAL 179

Query: 185 NRAFSRISSEIID 197
           ++ +++   + ++
Sbjct: 180 SKLYAKYMQDALE 192


>gi|121607913|ref|YP_995720.1| putative lipoprotein [Verminephrobacter eiseniae EF01-2]
 gi|121552553|gb|ABM56702.1| putative lipoprotein [Verminephrobacter eiseniae EF01-2]
          Length = 228

 Score = 52.3 bits (124), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 20/132 (15%), Positives = 49/132 (37%), Gaps = 16/132 (12%)

Query: 81  EIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIY--------ADYQIISAI 132
           ++     ++WS    +   L      E  G+   V+K + G              +   +
Sbjct: 92  QLHPYSHARWSQPPAQ---LLQQQLREQIGRRRAVLKADDGAAQSRGATRSGHLLLRVEL 148

Query: 133 RSFEINIDRHC---AIITMSLKIINAH--DNSLVGQKVFHVEEKLEKDNKLHFIQSLNRA 187
             F    +       ++ +   ++       SL GQ+VF +++     +    + +L  A
Sbjct: 149 EEFSHLFNSPTQSAGVVRLRATMVERTPTGESLRGQRVFIMQKPARSTDAAGGVAALAEA 208

Query: 188 FSRISSEIIDWT 199
            ++++SE+ +W 
Sbjct: 209 STQLASELAEWV 220


>gi|298530602|ref|ZP_07018004.1| protein of unknown function DUF330 [Desulfonatronospira
           thiodismutans ASO3-1]
 gi|298509976|gb|EFI33880.1| protein of unknown function DUF330 [Desulfonatronospira
           thiodismutans ASO3-1]
          Length = 251

 Score = 52.3 bits (124), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 28/174 (16%), Positives = 62/174 (35%), Gaps = 10/174 (5%)

Query: 31  FHNNPV--NIYDL-TESTKYDESVQRHIQLIITEPITEKILNSEDIIVRSSPIEIQYLIG 87
               P   N + L T+    +   +    L +           ++I+ R+     Q    
Sbjct: 25  PKKKPPERNFFVLETKRQAGETWDEPRGILSVRGFDVSPGFRGKEIVYRTERGRSQSDFY 84

Query: 88  SQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRS----FEINIDRHC 143
           +Q+      M+        +++G    V+       ADY +  ++ S    F+   D   
Sbjct: 85  NQYFISPGPMLTDVSRQWLDDSGMFEAVISMGSHKEADYILEGSVTSLYGDFQ-EGDEPA 143

Query: 144 AIITMSLKIINAH--DNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEI 195
           +++ M   ++     D  ++  + +     L      H +Q LN+A +RI + +
Sbjct: 144 SVLRMQFLLLEDDRLDYHMLMHRTYKERVTLTGSGAEHVVQGLNKALTRILTRL 197


>gi|224418849|ref|ZP_03656855.1| hypothetical protein HcanM9_06195 [Helicobacter canadensis MIT
           98-5491]
 gi|253828162|ref|ZP_04871047.1| hypothetical protein HCAN_1522 [Helicobacter canadensis MIT
           98-5491]
 gi|313142367|ref|ZP_07804560.1| predicted protein [Helicobacter canadensis MIT 98-5491]
 gi|253511568|gb|EES90227.1| hypothetical protein HCAN_1522 [Helicobacter canadensis MIT
           98-5491]
 gi|313131398|gb|EFR49015.1| predicted protein [Helicobacter canadensis MIT 98-5491]
          Length = 183

 Score = 52.3 bits (124), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 22/82 (26%), Positives = 37/82 (45%), Gaps = 6/82 (7%)

Query: 27  SSCFFHNN-PVNIYDLTESTKYD--ESVQRHIQLIITEPITEKILNSEDIIVRSSPIEIQ 83
           S C      PV+ Y L    K    +S+Q +  L +      + +N++ I  R SP E+ 
Sbjct: 19  SGCISKEVLPVSYYQLEIPYKEVNCKSIQVYHWLGV---EAVEKINTQKIAYRQSPNEVA 75

Query: 84  YLIGSQWSDKLPRMIQLKLIAN 105
           Y   +QW + LP M+   ++  
Sbjct: 76  YFAKNQWIESLPDMLDSLMLKA 97


>gi|168233438|ref|ZP_02658496.1| putative lipoprotein [Salmonella enterica subsp. enterica serovar
           Kentucky str. CDC 191]
 gi|194470371|ref|ZP_03076355.1| putative lipoprotein [Salmonella enterica subsp. enterica serovar
           Kentucky str. CVM29188]
 gi|194456735|gb|EDX45574.1| putative lipoprotein [Salmonella enterica subsp. enterica serovar
           Kentucky str. CVM29188]
 gi|205332396|gb|EDZ19160.1| putative lipoprotein [Salmonella enterica subsp. enterica serovar
           Kentucky str. CDC 191]
          Length = 187

 Score = 51.9 bits (123), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 35/184 (19%), Positives = 77/184 (41%), Gaps = 11/184 (5%)

Query: 18  LAVLLCTSLSSCFFHNNPVNIYDLTESTKYDES--VQRHIQLIITEPITEKILNSEDIIV 75
           L V++   L+SC       + Y L  +    +S   Q +  L + +      L    ++ 
Sbjct: 5   LVVIMAFWLASCSSGGENKSYYQLPIAQSGVQSTTSQGNRLLWVEQVSVPDYLAGNGVVY 64

Query: 76  RSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKIST--VVKPNQGIYADYQIISAIR 133
           ++S ++      + W+  L + ++  L+AN   + ++    V     G   D  +   + 
Sbjct: 65  QTSDVQYVIANNNLWASPLDQQLRNTLVANL--SARLPGWVVASQPLGTTQD-TLNVTVT 121

Query: 134 SFEINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISS 193
            F    D     + +S + +  H+  L+ ++ FH+E   +KD     ++ L  A+S+ ++
Sbjct: 122 GFHGRYDGK---VIVSGEWLLNHNGQLI-KRPFHIEASQQKDGYDEMVKVLASAWSQEAA 177

Query: 194 EIID 197
            I D
Sbjct: 178 AIAD 181


>gi|62179587|ref|YP_216004.1| putative outer membrane protein [Salmonella enterica subsp.
           enterica serovar Choleraesuis str. SC-B67]
 gi|62127220|gb|AAX64923.1| putative outer membrane protein [Salmonella enterica subsp.
           enterica serovar Choleraesuis str. SC-B67]
          Length = 187

 Score = 51.9 bits (123), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 34/184 (18%), Positives = 75/184 (40%), Gaps = 11/184 (5%)

Query: 18  LAVLLCTSLSSCFFHNNPVNIYDLTESTK--YDESVQRHIQLIITEPITEKILNSEDIIV 75
           L V++   L+SC       + Y L  +       + Q +  L + +      L    ++ 
Sbjct: 5   LVVIMAFWLASCSSGGENKSYYQLPIAQSGVQSTASQGNRLLWVEQVSVPDYLAGNGVVY 64

Query: 76  RSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKIST--VVKPNQGIYADYQIISAIR 133
           ++S ++      + W+  L + ++  L+AN     ++    V     G   D  +   + 
Sbjct: 65  QTSDVQYVIANNNLWASPLDQQLRNTLVANLGA--RLPGWVVASQPLGTTQD-TLNVTVT 121

Query: 134 SFEINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISS 193
            F    D     + +S + +  H+  L+ ++ FH+E   +KD     ++ L  A+S+ ++
Sbjct: 122 GFHGRYDGK---VIVSGEWLLNHNGQLI-KRPFHIEASQQKDGYDEMVKVLASAWSQEAA 177

Query: 194 EIID 197
            I D
Sbjct: 178 AIAD 181


>gi|301629823|ref|XP_002944033.1| PREDICTED: hypothetical protein LOC100485307 [Xenopus (Silurana)
           tropicalis]
          Length = 204

 Score = 51.9 bits (123), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 29/203 (14%), Positives = 64/203 (31%), Gaps = 23/203 (11%)

Query: 18  LAVLLCTSLSSCFFHNNPV---NIYDLTESTKYDESVQRHI--QLIITEPITEK-ILNSE 71
           + V     +  C     P     +YDL        +        L + +        N  
Sbjct: 1   MVVFGAILVVGCGALPQPPARPQLYDLGPGPATAPATPGTGLPTLALADMDAPGGAGNGT 60

Query: 72  DIIVRS---SPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYAD--- 125
            ++ R       +++    ++WS     ++Q +L       G+   +V+P     A    
Sbjct: 61  AVVYRLAYADAQQLRPYQLARWSQPPTALVQQRLRERL---GEQRAIVQPQDRPLAPGSD 117

Query: 126 ---YQIISAIRSFEINIDRHC---AIITMSLKIINAHDN--SLVGQKVFHVEEKLEKDNK 177
                +   +  F            ++ +   +         L+GQ+VF V+      + 
Sbjct: 118 LPPVVLRLNLEEFSQVFASPERSNGMLRLRATLAEPVSGGERLLGQRVFVVQRPAPSADA 177

Query: 178 LHFIQSLNRAFSRISSEIIDWTL 200
              + +L  A  + ++E+  W L
Sbjct: 178 PGGVHALTEAADQAAAELAQWLL 200


>gi|260770296|ref|ZP_05879229.1| putative lipoprotein [Vibrio furnissii CIP 102972]
 gi|260615634|gb|EEX40820.1| putative lipoprotein [Vibrio furnissii CIP 102972]
          Length = 185

 Score = 51.9 bits (123), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 25/184 (13%), Positives = 64/184 (34%), Gaps = 8/184 (4%)

Query: 19  AVLLCTSLSSCFFHNNPVN-IYDLTESTKYDESVQR--HIQLIITEPITEKILNSED-II 74
             L    L+ C       + +Y L +     E+ +      L++  P+      +   I+
Sbjct: 1   MFLAAALLAGCSSAPETTSALYLLPQPESQTETPEAVTDRPLLVVRPVELASYLNNRGIV 60

Query: 75  VRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFEN--NGKISTVVKPNQGIYADYQIISAI 132
            R+S  ++     +QW+  L   I  ++IA+            V       +D ++  ++
Sbjct: 61  YRTSESQVIQAKHNQWAQNLSEQITQRVIADLRQKQTHYWPVTVHNLLDQSSDDKLQLSL 120

Query: 133 RSFEINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRIS 192
             F  N   +   +     +I   +  +  +    +   L+ +     +++L  +   ++
Sbjct: 121 NKFNGNYQGNT-EVEGEWMLI-EANGKVKRRAPVKISVPLQDEGYDALVEALAASLDDLT 178

Query: 193 SEII 196
             I 
Sbjct: 179 DAIA 182


>gi|322616439|gb|EFY13348.1| putative lipoprotein [Salmonella enterica subsp. enterica serovar
           Montevideo str. 315996572]
 gi|322619690|gb|EFY16565.1| putative lipoprotein [Salmonella enterica subsp. enterica serovar
           Montevideo str. 495297-1]
 gi|322622614|gb|EFY19459.1| putative lipoprotein [Salmonella enterica subsp. enterica serovar
           Montevideo str. 495297-3]
 gi|322629763|gb|EFY26538.1| putative lipoprotein [Salmonella enterica subsp. enterica serovar
           Montevideo str. 495297-4]
 gi|322632515|gb|EFY29261.1| putative lipoprotein [Salmonella enterica subsp. enterica serovar
           Montevideo str. 515920-1]
 gi|322636990|gb|EFY33693.1| putative lipoprotein [Salmonella enterica subsp. enterica serovar
           Montevideo str. 515920-2]
 gi|322641471|gb|EFY38109.1| putative lipoprotein [Salmonella enterica subsp. enterica serovar
           Montevideo str. 531954]
 gi|322646063|gb|EFY42579.1| putative lipoprotein [Salmonella enterica subsp. enterica serovar
           Montevideo str. NC_MB110209-0054]
 gi|322649635|gb|EFY46066.1| putative lipoprotein [Salmonella enterica subsp. enterica serovar
           Montevideo str. OH_2009072675]
 gi|322654064|gb|EFY50387.1| putative lipoprotein [Salmonella enterica subsp. enterica serovar
           Montevideo str. CASC_09SCPH15965]
 gi|322658596|gb|EFY54858.1| putative lipoprotein [Salmonella enterica subsp. enterica serovar
           Montevideo str. 19N]
 gi|322663453|gb|EFY59655.1| putative lipoprotein [Salmonella enterica subsp. enterica serovar
           Montevideo str. 81038-01]
 gi|322670189|gb|EFY66329.1| putative lipoprotein [Salmonella enterica subsp. enterica serovar
           Montevideo str. MD_MDA09249507]
 gi|322671425|gb|EFY67547.1| putative lipoprotein [Salmonella enterica subsp. enterica serovar
           Montevideo str. 414877]
 gi|322676781|gb|EFY72848.1| putative lipoprotein [Salmonella enterica subsp. enterica serovar
           Montevideo str. 366867]
 gi|322682705|gb|EFY78724.1| putative lipoprotein [Salmonella enterica subsp. enterica serovar
           Montevideo str. 413180]
 gi|322686385|gb|EFY82367.1| putative lipoprotein [Salmonella enterica subsp. enterica serovar
           Montevideo str. 446600]
 gi|323195122|gb|EFZ80304.1| putative lipoprotein [Salmonella enterica subsp. enterica serovar
           Montevideo str. 609458-1]
 gi|323199804|gb|EFZ84893.1| putative lipoprotein [Salmonella enterica subsp. enterica serovar
           Montevideo str. 556150-1]
 gi|323202797|gb|EFZ87833.1| putative lipoprotein [Salmonella enterica subsp. enterica serovar
           Montevideo str. 609460]
 gi|323209068|gb|EFZ94005.1| putative lipoprotein [Salmonella enterica subsp. enterica serovar
           Montevideo str. 507440-20]
 gi|323213658|gb|EFZ98446.1| putative lipoprotein [Salmonella enterica subsp. enterica serovar
           Montevideo str. 556152]
 gi|323217972|gb|EGA02687.1| putative lipoprotein [Salmonella enterica subsp. enterica serovar
           Montevideo str. MB101509-0077]
 gi|323222004|gb|EGA06391.1| putative lipoprotein [Salmonella enterica subsp. enterica serovar
           Montevideo str. MB102109-0047]
 gi|323226577|gb|EGA10782.1| putative lipoprotein [Salmonella enterica subsp. enterica serovar
           Montevideo str. MB110209-0055]
 gi|323229773|gb|EGA13896.1| putative lipoprotein [Salmonella enterica subsp. enterica serovar
           Montevideo str. MB111609-0052]
 gi|323232998|gb|EGA17094.1| putative lipoprotein [Salmonella enterica subsp. enterica serovar
           Montevideo str. 2009083312]
 gi|323240733|gb|EGA24775.1| putative lipoprotein [Salmonella enterica subsp. enterica serovar
           Montevideo str. 2009085258]
 gi|323243049|gb|EGA27070.1| putative lipoprotein [Salmonella enterica subsp. enterica serovar
           Montevideo str. 315731156]
 gi|323249788|gb|EGA33690.1| putative lipoprotein [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2009159199]
 gi|323252740|gb|EGA36578.1| putative lipoprotein [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2010008282]
 gi|323259153|gb|EGA42797.1| putative lipoprotein [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2010008283]
 gi|323259977|gb|EGA43605.1| putative lipoprotein [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2010008284]
 gi|323268023|gb|EGA51502.1| putative lipoprotein [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2010008285]
 gi|323269871|gb|EGA53320.1| putative lipoprotein [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2010008287]
          Length = 187

 Score = 51.9 bits (123), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 34/184 (18%), Positives = 75/184 (40%), Gaps = 11/184 (5%)

Query: 18  LAVLLCTSLSSCFFHNNPVNIYDLTESTK--YDESVQRHIQLIITEPITEKILNSEDIIV 75
           L V++   L+SC       + Y L          + Q +  L + +      L    ++ 
Sbjct: 5   LVVIMAFWLASCSSGGENKSYYQLPIVQSGVQSTASQGNRLLWVEQVSVPDYLAGNGVVY 64

Query: 76  RSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKIST--VVKPNQGIYADYQIISAIR 133
           ++S ++      + W+  L + ++  L+AN   + ++    V     G   D  +   + 
Sbjct: 65  QTSDVQYVIANNNLWASPLDQQLRNTLVANL--SARLPGWVVASQPLGTTQD-TLNVTVT 121

Query: 134 SFEINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISS 193
            F    D     + +S + +  H+  L+ ++ FH+E   +KD     ++ L  A+S+ ++
Sbjct: 122 GFHGRYDGK---VIVSGEWLLNHNGQLI-KRPFHIEASQQKDGYDEMVKVLASAWSQEAA 177

Query: 194 EIID 197
            I D
Sbjct: 178 AIAD 181


>gi|329113587|ref|ZP_08242367.1| Hypothetical protein APO_0361 [Acetobacter pomorum DM001]
 gi|326697109|gb|EGE48770.1| Hypothetical protein APO_0361 [Acetobacter pomorum DM001]
          Length = 232

 Score = 51.5 bits (122), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 19/142 (13%), Positives = 45/142 (31%), Gaps = 12/142 (8%)

Query: 15  SCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIITEPITEKILNSEDII 74
             +   ++  +L++C   +   ++Y L  +    +       + +  P     L+ + I+
Sbjct: 24  GVAGLGVMAVTLTACSGGS--PSLYTLAVTPGQPQPG-GPRFVEVRLPTVASGLDRDRIV 80

Query: 75  VRSSPIEIQYLIGSQWSDKLP----RMIQLKLIANFENNGKISTVVKPNQGIYADYQIIS 130
              S  ++       WSD LP    R++   L       G    V         +  +  
Sbjct: 81  TADSGYKLTVSSADAWSDSLPAQISRVMAGDLAQRLPGTGVF--VENDTVATEPEAYVDM 138

Query: 131 AIRSFEINIDRHCAIITMSLKI 152
           +I  F          + +   +
Sbjct: 139 SISRFST---GPSGNVELDATL 157


>gi|328954042|ref|YP_004371376.1| protein of unknown function DUF330 [Desulfobacca acetoxidans DSM
           11109]
 gi|328454366|gb|AEB10195.1| protein of unknown function DUF330 [Desulfobacca acetoxidans DSM
           11109]
          Length = 206

 Score = 51.5 bits (122), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 35/202 (17%), Positives = 70/202 (34%), Gaps = 17/202 (8%)

Query: 9   IKKKIISCSL---AVLLCTSLSSCFFHNNPVNIYDLTESTK-----YDESVQRHIQLIIT 60
           +++  +SC L    V++    S C   +     Y+L+   K       ES  ++  + I 
Sbjct: 1   MRETPLSCGLPIILVIVAIFCSGCLSRSQTPRFYNLSAMQKDQVLVKSESPAQNAVIGIG 60

Query: 61  EPITEKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPN- 119
                  L +  I+ R+S  ++      +W           L     N G +    + N 
Sbjct: 61  PVNLADYLETSQIVTRTSDNQVGKAEYDRWVGSFKDNFVNVLAD---NIGFLLPTERINL 117

Query: 120 ----QGIYADYQIISAIRSFEINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKD 175
                 ++ DYQ+   +   +  +    A +     I       LV      + E +   
Sbjct: 118 YPWRGNVFIDYQVTVDVVRCDGRL-GEAAWLESRWSIFTGPGKKLVQTMRSSISEPVTGA 176

Query: 176 NKLHFIQSLNRAFSRISSEIID 197
           +    + + +RA +R+S EI  
Sbjct: 177 DYSDLVAAQSRALARLSQEIAA 198


>gi|259908887|ref|YP_002649243.1| Putative lipoprotein protein [Erwinia pyrifoliae Ep1/96]
 gi|224964509|emb|CAX56019.1| Putative lipoprotein protein [Erwinia pyrifoliae Ep1/96]
 gi|283478880|emb|CAY74796.1| Uncharacterized lipoprotein ymbA precursor [Erwinia pyrifoliae DSM
           12163]
 gi|310767213|gb|ADP12163.1| Putative lipoprotein protein [Erwinia sp. Ejp617]
          Length = 186

 Score = 51.5 bits (122), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 31/181 (17%), Positives = 73/181 (40%), Gaps = 8/181 (4%)

Query: 18  LAVLLCTSLSSCFFHNNPVNIYDLT-ESTKYDESVQRHIQ-LIITEPITEKILNSEDIIV 75
           + + L   LS+C      V  Y L   +T    S    IQ + +        L    ++ 
Sbjct: 5   IPIALALILSACSGTPKTVY-YQLPMAATSAAVSSTSVIQPVWVERVTLPDYLAGNGVVY 63

Query: 76  RSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSF 135
           +S+ ++      +QW+  L + +Q  LI +       + +     G+  D  +  ++  F
Sbjct: 64  QSNDVQYVIAANNQWASPLDQQLQQTLIGSLSAALPGALISSAQPGLQHD-TLNVSVHDF 122

Query: 136 EINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEI 195
               D H A++    + I  H+  L  ++ F++    ++D     +++L   + +++ ++
Sbjct: 123 HGRYDGH-AVVR--GEWILEHNGKLF-KQPFNMALPQKEDGYDDLVRTLAAGWQQVAEQV 178

Query: 196 I 196
            
Sbjct: 179 A 179


>gi|59801672|ref|YP_208384.1| hypothetical protein NGO1321 [Neisseria gonorrhoeae FA 1090]
 gi|239999392|ref|ZP_04719316.1| hypothetical protein Ngon3_07897 [Neisseria gonorrhoeae 35/02]
 gi|240014569|ref|ZP_04721482.1| hypothetical protein NgonD_07969 [Neisseria gonorrhoeae DGI18]
 gi|240081351|ref|ZP_04725894.1| hypothetical protein NgonF_08594 [Neisseria gonorrhoeae FA19]
 gi|240113559|ref|ZP_04728049.1| hypothetical protein NgonM_08328 [Neisseria gonorrhoeae MS11]
 gi|240116091|ref|ZP_04730153.1| hypothetical protein NgonPID1_07581 [Neisseria gonorrhoeae PID18]
 gi|240118375|ref|ZP_04732437.1| hypothetical protein NgonPID_07918 [Neisseria gonorrhoeae PID1]
 gi|240121091|ref|ZP_04734053.1| hypothetical protein NgonPI_04839 [Neisseria gonorrhoeae PID24-1]
 gi|240123920|ref|ZP_04736876.1| hypothetical protein NgonP_08264 [Neisseria gonorrhoeae PID332]
 gi|240126120|ref|ZP_04739006.1| hypothetical protein NgonSK_07879 [Neisseria gonorrhoeae SK-92-679]
 gi|240128597|ref|ZP_04741258.1| hypothetical protein NgonS_08208 [Neisseria gonorrhoeae SK-93-1035]
 gi|254494112|ref|ZP_05107283.1| lipoprotein [Neisseria gonorrhoeae 1291]
 gi|260440099|ref|ZP_05793915.1| hypothetical protein NgonDG_03259 [Neisseria gonorrhoeae DGI2]
 gi|268595212|ref|ZP_06129379.1| lipoprotein [Neisseria gonorrhoeae 35/02]
 gi|268597452|ref|ZP_06131619.1| lipoprotein [Neisseria gonorrhoeae FA19]
 gi|268599622|ref|ZP_06133789.1| lipoprotein [Neisseria gonorrhoeae MS11]
 gi|268601759|ref|ZP_06135926.1| lipoprotein [Neisseria gonorrhoeae PID18]
 gi|268604088|ref|ZP_06138255.1| lipoprotein [Neisseria gonorrhoeae PID1]
 gi|268682545|ref|ZP_06149407.1| lipoprotein [Neisseria gonorrhoeae PID332]
 gi|268684708|ref|ZP_06151570.1| lipoprotein [Neisseria gonorrhoeae SK-92-679]
 gi|268686986|ref|ZP_06153848.1| lipoprotein [Neisseria gonorrhoeae SK-93-1035]
 gi|291043387|ref|ZP_06569110.1| lipoprotein [Neisseria gonorrhoeae DGI2]
 gi|293398691|ref|ZP_06642869.1| hypothetical protein NGNG_01356 [Neisseria gonorrhoeae F62]
 gi|59718567|gb|AAW89972.1| conserved hypothetical protein [Neisseria gonorrhoeae FA 1090]
 gi|226513152|gb|EEH62497.1| lipoprotein [Neisseria gonorrhoeae 1291]
 gi|268548601|gb|EEZ44019.1| lipoprotein [Neisseria gonorrhoeae 35/02]
 gi|268551240|gb|EEZ46259.1| lipoprotein [Neisseria gonorrhoeae FA19]
 gi|268583753|gb|EEZ48429.1| lipoprotein [Neisseria gonorrhoeae MS11]
 gi|268585890|gb|EEZ50566.1| lipoprotein [Neisseria gonorrhoeae PID18]
 gi|268588219|gb|EEZ52895.1| lipoprotein [Neisseria gonorrhoeae PID1]
 gi|268622829|gb|EEZ55229.1| lipoprotein [Neisseria gonorrhoeae PID332]
 gi|268624992|gb|EEZ57392.1| lipoprotein [Neisseria gonorrhoeae SK-92-679]
 gi|268627270|gb|EEZ59670.1| lipoprotein [Neisseria gonorrhoeae SK-93-1035]
 gi|291012993|gb|EFE04976.1| lipoprotein [Neisseria gonorrhoeae DGI2]
 gi|291611162|gb|EFF40259.1| hypothetical protein NGNG_01356 [Neisseria gonorrhoeae F62]
 gi|317164641|gb|ADV08182.1| hypothetical protein NGTW08_1214 [Neisseria gonorrhoeae
           TCDC-NG08107]
          Length = 172

 Score = 51.5 bits (122), Expect = 7e-05,   Method: Composition-based stats.
 Identities = 28/189 (14%), Positives = 73/189 (38%), Gaps = 17/189 (8%)

Query: 9   IKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIITEPITEKIL 68
           ++   I+ +L +  C ++ S  +   P + Y         +  +  +++ + EP+    L
Sbjct: 1   MRLFPIAAALTLAACGTVQSTQYFVLPDSRYI----RPATQGGETAVEVRLAEPLKRGGL 56

Query: 69  NSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQI 128
                + ++ P  I       W+D L  M++  L   F       T V  ++    D + 
Sbjct: 57  -----VYQTDPYRINTAQNHVWADTLDDMLEAALSNAFNRLDSTRTFVPASRSGSTD-KW 110

Query: 129 ISAIRSFEINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAF 188
              I +F+ +      +I+    + +  +      + FH+E + + D       +L +  
Sbjct: 111 TVYIDAFQGSYTGKT-LISGYAVLPDGTN------RPFHIETEQQGDGYAAMTAALEQGL 163

Query: 189 SRISSEIID 197
            + + ++++
Sbjct: 164 KQAAQQMVE 172


>gi|242310199|ref|ZP_04809354.1| predicted protein [Helicobacter pullorum MIT 98-5489]
 gi|239523496|gb|EEQ63362.1| predicted protein [Helicobacter pullorum MIT 98-5489]
          Length = 183

 Score = 51.5 bits (122), Expect = 7e-05,   Method: Composition-based stats.
 Identities = 28/182 (15%), Positives = 68/182 (37%), Gaps = 17/182 (9%)

Query: 12  KIISCSLAVLLCTSLSSCFFHN-NPVNIYDLTESTKYDESVQRHIQLIITEPITEKILNS 70
           K I   ++V++   LS C      P+N Y      K  +  +  +   +     E  +++
Sbjct: 2   KAIVWLISVIVSVLLSGCVGKEIAPINHYQFEMEHKEVKCAKMELYGWLGI-EAEAKIDT 60

Query: 71  EDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYA-DYQII 129
             I     P +++Y   ++W D LP ++ + ++           V + N  + A D Q +
Sbjct: 61  SKIAYIKEPNKVEYFAKNRWIDNLPNLLDVLVLK----------VARENCIVLAKDKQFL 110

Query: 130 SA---IRSFEINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNR 186
           +    +   +++ D +         +       +    +   +E + K      I+++N 
Sbjct: 111 TDTLRLYILDLHYDENLNSAVFEALLEQTKGEQIEQFWILETKE-VSKGGFEEIIRAMNE 169

Query: 187 AF 188
           + 
Sbjct: 170 SV 171


>gi|198244695|ref|YP_002214998.1| putative lipoprotein [Salmonella enterica subsp. enterica serovar
           Dublin str. CT_02021853]
 gi|197939211|gb|ACH76544.1| putative lipoprotein [Salmonella enterica subsp. enterica serovar
           Dublin str. CT_02021853]
          Length = 187

 Score = 51.5 bits (122), Expect = 7e-05,   Method: Composition-based stats.
 Identities = 34/184 (18%), Positives = 76/184 (41%), Gaps = 11/184 (5%)

Query: 18  LAVLLCTSLSSCFFHNNPVNIYDLTESTK--YDESVQRHIQLIITEPITEKILNSEDIIV 75
           L V++   L+SC       + Y L  +       + Q +  L + +      L    ++ 
Sbjct: 5   LVVIMAFWLASCSSGGENKSYYQLPIAQSGVQSTASQGNRLLWVEQVSVPDYLAGNGVVY 64

Query: 76  RSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKIST--VVKPNQGIYADYQIISAIR 133
           ++S ++      + W+  L + ++  L+AN   + ++    V     G   D  +   + 
Sbjct: 65  QASDVQYVIANNNLWASPLDQQLRNTLVANL--SARLPGWVVASQPLGTTQD-TLNVTVT 121

Query: 134 SFEINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISS 193
            F    D     + +S + +  H+  L+ ++ FH+E   +KD     ++ L  A+S+ ++
Sbjct: 122 GFHGRYDGK---VIVSGEWLLNHNGQLI-KRPFHIEASQQKDGYDEMVKVLASAWSQEAA 177

Query: 194 EIID 197
            I D
Sbjct: 178 AIAD 181


>gi|114798421|ref|YP_761596.1| putative lipoprotein [Hyphomonas neptunium ATCC 15444]
 gi|114738595|gb|ABI76720.1| putative lipoprotein [Hyphomonas neptunium ATCC 15444]
          Length = 206

 Score = 51.5 bits (122), Expect = 7e-05,   Method: Composition-based stats.
 Identities = 28/162 (17%), Positives = 55/162 (33%), Gaps = 9/162 (5%)

Query: 28  SCFFHNNPVN-IYDLTESTKYDESVQRHIQLIITEPITEKILNSEDIIVRSSPIEIQYLI 86
                 +P N +Y +      + + Q    + + EP   ++L    +        I+Y+ 
Sbjct: 22  GIIPQRDPANALYRIGP---LEPAHQLSASVTVREPEASRLLAGRFMSAEDETGAIRYVR 78

Query: 87  GSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQ-GIYADYQIISAIRSFEINIDRHCAI 145
             QWSD+   ++Q  ++      G    V  P Q G   +Y+    I      +  + A 
Sbjct: 79  SIQWSDRSTSLMQEAVLDLLNGEG--GNVALPAQAGAVTEYEFSWRISDL--TLKGNTAR 134

Query: 146 ITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRA 187
             +   I+   + S+  Q           +      Q+L  A
Sbjct: 135 CRLEGAILKGRERSIQRQTSISTSATASGNTDAARAQALVEA 176


>gi|311107308|ref|YP_003980161.1| hypothetical protein AXYL_04127 [Achromobacter xylosoxidans A8]
 gi|310761997|gb|ADP17446.1| hypothetical protein AXYL_04127 [Achromobacter xylosoxidans A8]
          Length = 238

 Score = 51.5 bits (122), Expect = 8e-05,   Method: Composition-based stats.
 Identities = 29/206 (14%), Positives = 70/206 (33%), Gaps = 5/206 (2%)

Query: 3   KKLNKIIKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIITEP 62
           +   ++  +     SL  L               +   +  +      V     LI  +P
Sbjct: 20  RSAGRLTPRLRPVLSLLALTAALAGCGSSAPVQYHTLQVPAAQAPGAGVAPANFLIEVQP 79

Query: 63  ITEKI-LNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENN-GKISTVVKPNQ 120
           +      +   ++VR+    +  L   +WS  L   ++  L    +   G +   +    
Sbjct: 80  VNISTQADQPQLMVRTGEGSLAALYSERWSSPLGDELRGALSDALKRELGALDVQLVKPG 139

Query: 121 GIYADYQIISAIRSFEINIDRHCAI-ITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLH 179
              A +++ + ++ FE+   R   +  T  ++ +N   + L+ + V  V E + ++    
Sbjct: 140 PGAAVWRVQTDVQRFELESGRMAQLDATWRVRPVNMKGSGLLCRSV--VTEPVTEEGVPA 197

Query: 180 FIQSLNRAFSRISSEIIDWTLSSLPL 205
            I +  RA   ++  +        P 
Sbjct: 198 LIAAQQRAVVSLAGAMASAIRGQTPA 223


>gi|91226895|ref|ZP_01261492.1| hypothetical protein V12G01_15962 [Vibrio alginolyticus 12G01]
 gi|91188858|gb|EAS75143.1| hypothetical protein V12G01_15962 [Vibrio alginolyticus 12G01]
          Length = 192

 Score = 51.5 bits (122), Expect = 8e-05,   Method: Composition-based stats.
 Identities = 24/186 (12%), Positives = 70/186 (37%), Gaps = 10/186 (5%)

Query: 18  LAVLLCTSLSSCFFHNNPV-NIYDLTESTKYDESVQRHIQ--LIITEPITEKILNSED-I 73
           L++ L   L+ C         +Y L ++     S     Q   ++  P+T     +++ I
Sbjct: 7   LSIALFVGLTGCSSAPQTKGAMYLLPKAEPVTLSSSDIAQRPTLVVRPVTLASYLNDNGI 66

Query: 74  IVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIY--ADYQIISA 131
           + R+S  ++     +QW+  +   I  +++A            + N  +    + ++   
Sbjct: 67  VYRTSETQVIQAKHNQWAHSISEQITQRVVAELRQKQSHYWPTEMNNLLDQSGEAKLQLT 126

Query: 132 IRSFEINIDRHCAIITMSLK-IINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSR 190
           +  F  +   +   I +  + ++   +  +       + + L+ +     + +L+     
Sbjct: 127 LNKFNGSYKGN---IEIEGEWLLINAEGKVENSAPIQISKPLQDEGYEALVNALSIGLES 183

Query: 191 ISSEII 196
           ++S+I 
Sbjct: 184 LTSDIA 189


>gi|134096151|ref|YP_001101226.1| putative lipoprotein [Herminiimonas arsenicoxydans]
 gi|133740054|emb|CAL63105.1| Conserved hypothetical protein; putative exported protein
           [Herminiimonas arsenicoxydans]
          Length = 194

 Score = 51.1 bits (121), Expect = 8e-05,   Method: Composition-based stats.
 Identities = 33/196 (16%), Positives = 64/196 (32%), Gaps = 13/196 (6%)

Query: 18  LAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHI--QLIITEPITEKILNSEDIIV 75
           LA      L+ C       +++DL        +        + I E      L+S+ +  
Sbjct: 2   LAFAGSILLTGCAVGPQSASLFDLGPLHTQGSAATETPLPAISIAEITAPVWLDSQMMFY 61

Query: 76  R---SSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAI 132
           R    +  + +    S+W+    ++  L+L +     G +               +    
Sbjct: 62  RLNYDNNQQPRAYATSKWTMAPAQLFLLRLKSRLSQAGGVVVPASDGAVNLP--VLRIEA 119

Query: 133 RSFEINID---RHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFS 189
             F    D   +  A I M   + +     L  QK+F  +      +      +L  A  
Sbjct: 120 DDFSQVFDSAHQSSAHIAMRASLFDGRT--LRAQKMFVKQLPAASADAQGGAAALALASD 177

Query: 190 RISSEIIDWTLSSLPL 205
            I +E+  W L++LP 
Sbjct: 178 AIINEMAVW-LATLPA 192


>gi|88812233|ref|ZP_01127484.1| hypothetical protein NB231_02498 [Nitrococcus mobilis Nb-231]
 gi|88790484|gb|EAR21600.1| hypothetical protein NB231_02498 [Nitrococcus mobilis Nb-231]
          Length = 208

 Score = 51.1 bits (121), Expect = 8e-05,   Method: Composition-based stats.
 Identities = 31/177 (17%), Positives = 60/177 (33%), Gaps = 11/177 (6%)

Query: 27  SSCFFHNN-PVNIYDLT-ESTKYDESVQRHIQLIITEPITEKILNSEDIIVRSSPIEIQY 84
           S C      P + Y L   S     +     +L I        L S+ I+++++ + I  
Sbjct: 22  SGCAGAPTVPEHRYLLGLTSRPAAPAASSEHRLWIASLQLAPFLRSDGIVMQTNDVAIHQ 81

Query: 85  LIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADY-----QIISAIRSFEINI 139
                W++ L   ++  L        K+  V   +    A       ++   +  F    
Sbjct: 82  GRDHLWAENLATQLRRSLREELAR--KLPRVQVLDDSESATTGEPLPRLEVEVDGFHGRY 139

Query: 140 DRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEII 196
           D     I +    +      L+  + F VE  L  D     ++SL  A+  ++ +I 
Sbjct: 140 DG--VAIVVGQWRLRDGTGRLLAARQFSVERPLPADGYQALVESLAAAWRGVADQIA 194


>gi|257094945|ref|YP_003168586.1| hypothetical protein CAP2UW1_3397 [Candidatus Accumulibacter
           phosphatis clade IIA str. UW-1]
 gi|257047469|gb|ACV36657.1| protein of unknown function DUF330 [Candidatus Accumulibacter
           phosphatis clade IIA str. UW-1]
          Length = 201

 Score = 51.1 bits (121), Expect = 9e-05,   Method: Composition-based stats.
 Identities = 30/186 (16%), Positives = 64/186 (34%), Gaps = 14/186 (7%)

Query: 18  LAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIITEPITEKILNSEDIIVRS 77
           L VLL  +L+ C   + P   Y L      D        + +       I++    +V+ 
Sbjct: 12  LTVLLAATLAGC--ASPPSRFYTLAAIAGPDGGAPAAYAVAVDSVSIPAIVDRPQFVVQK 69

Query: 78  SPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQG-----IYADYQIISAI 132
            P  +     ++W+  L   I   L AN    G +    +   G     +   Y++   +
Sbjct: 70  GPNRVGIDEFNRWAAPLAANIASTLAANL---GVLLGTSRVVAGPLAANVDPAYRVTVDV 126

Query: 133 RSFEINIDRHCAIITMSLK-IINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRI 191
           + FE         +++    ++     +        + E ++ +       + +RA + I
Sbjct: 127 QRFESV---PGETVSLDAVWLLRRPGAAATTGGRSTLREAVQGEGYEALAAAHSRALAGI 183

Query: 192 SSEIID 197
           S +I  
Sbjct: 184 SRDIAA 189


>gi|330901765|gb|EGH33184.1| hypothetical protein PSYJA_31261 [Pseudomonas syringae pv. japonica
           str. M301072PT]
          Length = 204

 Score = 51.1 bits (121), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 31/198 (15%), Positives = 61/198 (30%), Gaps = 16/198 (8%)

Query: 17  SLAVLLCTSLSSCFFHNNPVNIYDLTES---TKYDESVQRHIQLIITEPITEKILNSEDI 73
            + +     L +C   +   + Y L      T          Q  +   I    ++   +
Sbjct: 7   LMVLAAAVGLGAC--TSTQTHYYTLIAPMSATSTAAGKPMPFQFEMLPVIMPVQVDQPPL 64

Query: 74  IVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFE-NNGKISTVVKPNQGIYADYQIISAI 132
           +VR     +  L   +W   L       L    E   G       P         I + +
Sbjct: 65  VVRQGNGSLAILDTERWGSPLGDEFHDALTPQLEHRFGSRDMAGLPKNSDQPTLSIRTDV 124

Query: 133 RSFEINIDRHCAIITMSLKIINAHDNSLVGQKV-----FHVEEKLEKDNKLHFIQSLNRA 187
           R FE  +  + A+I +   +      +  G K        V  +   +   + I +  +A
Sbjct: 125 RRFES-MPGNYALIDVVWTLGLREAGATAGSKRRSLTCSSVIREQAGEGMENLIIAHQKA 183

Query: 188 FSRISSEII----DWTLS 201
            +R++ +I     +WT  
Sbjct: 184 VARLADKIAATATNWTAQ 201


>gi|66046277|ref|YP_236118.1| hypothetical protein Psyr_3046 [Pseudomonas syringae pv. syringae
           B728a]
 gi|63256984|gb|AAY38080.1| Protein of unknown function DUF330 [Pseudomonas syringae pv.
           syringae B728a]
          Length = 207

 Score = 50.7 bits (120), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 30/201 (14%), Positives = 61/201 (30%), Gaps = 16/201 (7%)

Query: 17  SLAVLLCTSLSSCFFHNNPVNIYDLTES---TKYDESVQRHIQLIITEPITEKILNSEDI 73
            + +     L +C   +   + Y L      T    S     Q  +   I    ++   +
Sbjct: 7   LMVLAAAVGLGAC--TSTQTHYYTLIAPMSATSTAASKPMPFQFEMLPVIMPVQVDQPPL 64

Query: 74  IVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFE-NNGKISTVVKPNQGIYADYQIISAI 132
           +VR     +  L   +W   L       L    E   G       P         + + +
Sbjct: 65  VVRQGNGSLAILDTERWGSPLGDEFHDALTPQLERRFGSRDMAGLPKNSDQPTLSLRTDV 124

Query: 133 RSFEINIDRHCAIITMSLKIINAHDNSLVGQKV-----FHVEEKLEKDNKLHFIQSLNRA 187
           R FE  +  + A+I +   +      +  G K        V  +   +   + I +  +A
Sbjct: 125 RRFES-MPGNYALIDVVWTLGLREAGATAGSKRQSLTCSSVIREQAGEGMENLIMAHQKA 183

Query: 188 FSRISSEIID----WTLSSLP 204
            ++++ +I      WT     
Sbjct: 184 VAQLADKIAATAASWTAQRAS 204


>gi|104783891|ref|YP_610389.1| hypothetical protein PSEEN4964 [Pseudomonas entomophila L48]
 gi|95112878|emb|CAK17606.1| conserved hypothetical protein [Pseudomonas entomophila L48]
          Length = 225

 Score = 50.7 bits (120), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 27/178 (15%), Positives = 63/178 (35%), Gaps = 6/178 (3%)

Query: 20  VLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIITEPITEKILNSEDIIVRSSP 79
           +     LS C  H  PV +Y L        S    + +++        L  E  + R + 
Sbjct: 1   MTGLLGLSGCSMHQ-PVALYQLDSGDPAQPSQAAGMAVVLGPVSVADYLQRETFLQRQTD 59

Query: 80  IEIQYLIGSQWSDKLPRMIQLKLIANFE-NNGKISTVVKP-NQGIYADYQIISAIRSFEI 137
             +      +W+  L   I   L+            V+ P + G   D Q++ +I   + 
Sbjct: 60  GSLTAATDGRWAGSLSSDIDQLLVRQLAWRLDSQRVVLAPASTGFTPDVQVLLSITRLDS 119

Query: 138 NIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEI 195
                 AI+    ++++     +   ++ H+E+          +Q+  +   +++ ++
Sbjct: 120 -GKNQPAILDAQWRLLDRR-GQVRDNRIVHLEQPHAGSE-SAQVQAQGQLLQKLAEQL 174


>gi|90413934|ref|ZP_01221919.1| hypothetical protein P3TCK_07711 [Photobacterium profundum 3TCK]
 gi|90324996|gb|EAS41511.1| hypothetical protein P3TCK_07711 [Photobacterium profundum 3TCK]
          Length = 197

 Score = 50.7 bits (120), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 29/185 (15%), Positives = 72/185 (38%), Gaps = 6/185 (3%)

Query: 16  CSLAVLLCTSLSSCFFHNNPVNIYDLTE-STKYDESVQRHIQLIITEP-ITEKILNSEDI 73
               V     L+ C    + VN Y L   +      +  +  L++  P    + L    +
Sbjct: 5   LLFMVAATAFLAGCSSQPDAVNSYLLPAGAQSITSQIGSNQPLLVIRPVEMAEHLAGTGL 64

Query: 74  IVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFEN--NGKISTVVKPNQGIYADYQIISA 131
           + + S  E+     + W++ + + +  ++  +  N  +   +T + P    Y   ++   
Sbjct: 65  VYQVSDTEVVQAQQNLWAESIGKQLTRRINQDLRNKQSQFWTTELTPALSTYNSPRLQVK 124

Query: 132 IRSFEINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRI 191
           I  F  +     A I+    ++   D  L G   F  +  L+++     +++L+   +R+
Sbjct: 125 IDEFNGHYSG-MAKISGEWMLVK-SDGDLNGVYPFKFQVPLQEEGYDAQVKALSEGINRL 182

Query: 192 SSEII 196
           +++I 
Sbjct: 183 TTQIA 187


>gi|294843018|ref|ZP_06787701.1| putative signal peptide [Acinetobacter sp. 6014059]
 gi|322507466|gb|ADX02920.1| putative signal peptid [Acinetobacter baumannii 1656-2]
          Length = 236

 Score = 50.7 bits (120), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 30/199 (15%), Positives = 79/199 (39%), Gaps = 25/199 (12%)

Query: 17  SLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIITEPITEK-ILNSEDIIV 75
           S  +L   ++++C     P N Y LT   K        +Q+I   P+     L+   +++
Sbjct: 21  SGVLLTAIAMTACSSSPTP-NYYTLTP--KVTPVSNSTVQVIEVLPVGIPDRLDRAPLVL 77

Query: 76  RSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYAD----YQIISA 131
           + S  +   L   +W+  L   ++  L A  +   K+  +   + G+  +    Y++ + 
Sbjct: 78  QESNGKSTVLDNERWTSTLGTQLRDTLSAGLQQ--KLGAIDSYSSGLSGNNQPLYRVSTD 135

Query: 132 IRSFEINIDRHCAI-ITMSLK------IINAHDNSLVGQK------VFHVEEKLEKD--N 176
              F+I  + +  + ++  +K       + + +  ++  +          ++ +++    
Sbjct: 136 FSHFDIVDNSNINVAVSWVVKRQIPPTQLESTNPKVISNRGAQLNCRIAFKQPIDQKAKK 195

Query: 177 KLHFIQSLNRAFSRISSEI 195
               + + N A S+I + I
Sbjct: 196 MEAIVSASNEAMSQIINTI 214


>gi|330939127|gb|EGH42554.1| hypothetical protein PSYPI_09145 [Pseudomonas syringae pv. pisi
           str. 1704B]
          Length = 207

 Score = 50.4 bits (119), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 31/199 (15%), Positives = 61/199 (30%), Gaps = 16/199 (8%)

Query: 17  SLAVLLCTSLSSCFFHNNPVNIYDLTES---TKYDESVQRHIQLIITEPITEKILNSEDI 73
            + +     L +C   +   + Y L      T    S     Q  +   I    ++   +
Sbjct: 7   LMVLAAAVGLGAC--TSTQTHYYTLIAPMSATSTAASKPMPFQFEMLPVIMPVQVDQPPL 64

Query: 74  IVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFE-NNGKISTVVKPNQGIYADYQIISAI 132
           +VR     +  L   +W   L       L    E   G       P         I + +
Sbjct: 65  VVRQGNGSLAILDTERWGSPLGDEFHDALTPQLERRFGSRDMAGLPKNSDQPTLSIRTDV 124

Query: 133 RSFEINIDRHCAIITMSLKIINAHDNSLVGQKV-----FHVEEKLEKDNKLHFIQSLNRA 187
           R FE  +  + A+I +   +      +  G K        V  +   +   + I +  +A
Sbjct: 125 RRFES-MPGNYALIDVVWTLGLREAGATAGSKRQSLTCSSVIREEAGEGMENLIIAHQKA 183

Query: 188 FSRISSEIID----WTLSS 202
            ++++ +I      WT   
Sbjct: 184 VAQLADKIAATAASWTAQR 202


>gi|330980815|gb|EGH78918.1| hypothetical protein PSYAP_19941 [Pseudomonas syringae pv. aptata
           str. DSM 50252]
          Length = 207

 Score = 50.4 bits (119), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 31/201 (15%), Positives = 61/201 (30%), Gaps = 16/201 (7%)

Query: 17  SLAVLLCTSLSSCFFHNNPVNIYDLTES---TKYDESVQRHIQLIITEPITEKILNSEDI 73
            + +     L +C   +   + Y L      T    S     Q  +   I    ++   +
Sbjct: 7   LMVLAAAVGLGAC--TSTQTHYYTLIAPMSATSTAASKPMPFQFEMLPVIMPVQVDQPPL 64

Query: 74  IVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFE-NNGKISTVVKPNQGIYADYQIISAI 132
           +VR     +  L   +W   L       L    E   G       P         I + +
Sbjct: 65  VVRQGNGSLAILDTERWGSPLGDEFHDALTPQLERRFGSRDMAGLPKNSDQPTLSIRTDV 124

Query: 133 RSFEINIDRHCAIITMSLKIINAHDNSLVGQKV-----FHVEEKLEKDNKLHFIQSLNRA 187
           R FE  +  + A+I +   +      +  G K        V  +   +   + I +  +A
Sbjct: 125 RRFES-MPGNYALIDVVWTLGLREAGATAGSKRQSLTCSSVIREEAGEGMENLIIAHQKA 183

Query: 188 FSRISSEI----IDWTLSSLP 204
            ++++ +I      WT     
Sbjct: 184 VAQLADKIAVTAASWTAQRAS 204


>gi|330969874|gb|EGH69940.1| hypothetical protein PSYAR_05220 [Pseudomonas syringae pv. aceris
           str. M302273PT]
          Length = 207

 Score = 50.4 bits (119), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 30/201 (14%), Positives = 60/201 (29%), Gaps = 16/201 (7%)

Query: 17  SLAVLLCTSLSSCFFHNNPVNIYDLTES---TKYDESVQRHIQLIITEPITEKILNSEDI 73
            + +     L +C   +   + Y L      T    S     Q  +   I    ++   +
Sbjct: 7   LMVLAAAVGLGAC--TSTQTHYYTLIAPMSATSTAASKPMPFQFEMLPVIMPVQVDQPPL 64

Query: 74  IVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFE-NNGKISTVVKPNQGIYADYQIISAI 132
           +VR     +  L   +W   L       L    E   G       P         + + +
Sbjct: 65  VVRQGNGSLAILDTERWGSPLGDEFHDALTPQLERRFGSRDMAGLPKNSDQPTLSLRTDV 124

Query: 133 RSFEINIDRHCAIITMSLKIINAHDNSLVGQKV-----FHVEEKLEKDNKLHFIQSLNRA 187
           R FE  +  + A+I +   +      +  G K        V  +   +   + I +  +A
Sbjct: 125 RRFES-MPGNYALIDVVWTLGLREAGATAGSKRQSLTCSSVIREQAGEGMENLIMAHQKA 183

Query: 188 FSRISSEIID----WTLSSLP 204
            ++++  I      WT     
Sbjct: 184 VAQLADRIAATAASWTAQRAS 204


>gi|156975125|ref|YP_001446032.1| hypothetical protein VIBHAR_02852 [Vibrio harveyi ATCC BAA-1116]
 gi|156526719|gb|ABU71805.1| hypothetical protein VIBHAR_02852 [Vibrio harveyi ATCC BAA-1116]
          Length = 189

 Score = 50.4 bits (119), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 28/184 (15%), Positives = 71/184 (38%), Gaps = 8/184 (4%)

Query: 20  VLLCTSLSSCFFHNNPV-NIYDLTESTKY---DESVQRHIQLIITEPITEKILNSEDIIV 75
           +L+   L+ C         +Y L E++     D ++ +  QL++        L    I+ 
Sbjct: 6   LLISALLAGCSSAPEDSGALYVLPEASSTKVSDTAIAQRPQLVVRPVELASYLADSGIVY 65

Query: 76  RSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIY--ADYQIISAIR 133
           R+S  +I     +QW+  +   I  ++I    +       V+ N  +    + +++ ++ 
Sbjct: 66  RTSETKIVQAKHNQWAHNISEQITQRIIDELRSKQSQYWPVEVNNQLDQSGENKLLLSLS 125

Query: 134 SFEINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISS 193
            F  +   + A I     I++  +  +       +   L+ D     + +L+   + ++ 
Sbjct: 126 KFNGSYQGN-AEIEGEWLIVDE-NGKVKNSAPVKINMPLQDDGYDALVDALSVGLNNLTD 183

Query: 194 EIID 197
           +I  
Sbjct: 184 QIAA 187


>gi|120609012|ref|YP_968690.1| putative lipoprotein [Acidovorax citrulli AAC00-1]
 gi|120587476|gb|ABM30916.1| putative lipoprotein [Acidovorax citrulli AAC00-1]
          Length = 220

 Score = 50.4 bits (119), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 29/194 (14%), Positives = 60/194 (30%), Gaps = 23/194 (11%)

Query: 9   IKKKIISCSLAVLLCTSLSSCFFHNNP-VNIYDLTESTKYDESVQRHIQLI-ITEPI--- 63
            + + +  +LA     +  S      P  ++YD    T      +R   L  I  P    
Sbjct: 8   TRARGLWTALAAAALMAGCSALPAPPPRADVYDFGPGTLAQAPGERGAPLPPIALPEVAV 67

Query: 64  TEKILNSEDIIVR---SSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQ 120
              +  S  ++ R     P  ++    ++WS    +++Q  L       G    V+   +
Sbjct: 68  AGPVEGSTAVLYRLAYDDPRHLRPYGQARWSQPPAQLVQQALRDQL---GLRRAVLMGEE 124

Query: 121 GIY-------ADYQIISAIRSFEINIDRHCA---IITMSLKIINA--HDNSLVGQKVFHV 168
           G             +   I  F        A   ++ +   + ++      LV Q+VF +
Sbjct: 125 GAAQLVDTGKPPAVLRVEIEEFSQVFQAPKASTGVLRLRASLADSTQAGEKLVAQRVFVI 184

Query: 169 EEKLEKDNKLHFIQ 182
           +      +      
Sbjct: 185 QRPAPTPDARGGTH 198


>gi|83312111|ref|YP_422375.1| hypothetical protein amb3012 [Magnetospirillum magneticum AMB-1]
 gi|82946952|dbj|BAE51816.1| Uncharacterized protein conserved in bacteria [Magnetospirillum
           magneticum AMB-1]
          Length = 206

 Score = 50.0 bits (118), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 22/171 (12%), Positives = 55/171 (32%), Gaps = 7/171 (4%)

Query: 32  HNNPVNIYDLTESTKYDESVQRHIQLIITEPITE-KILNSEDIIVRSSPIEIQYLIGSQW 90
            + P+  + L+       +      L+   PI   + +N E++++     +++   G +W
Sbjct: 23  ASTPLRYHALSSGPTAPLASGSAALLVEVLPIAVPERINREELVLSGPGGQLEVRAGDRW 82

Query: 91  SDKLPR----MIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFEINIDRHCAII 146
           +  L      ++   L  +          +         Y++   +   E    R  A+ 
Sbjct: 83  AAPLADEMRQLVDESLWRHLRAADIYVAPLAITGSGLPQYRLALRLERLEATPGRQ-AVA 141

Query: 147 TMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEIID 197
             S  +           +     E L   +    +  L RA +R++  +  
Sbjct: 142 EASWTVRRLPQGQPAICRT-GATEPLPDASTEAAVAGLARASARLAEAVAA 191


>gi|315181365|gb|ADT88278.1| hypothetical lipoprotein [Vibrio furnissii NCTC 11218]
          Length = 185

 Score = 50.0 bits (118), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 24/184 (13%), Positives = 63/184 (34%), Gaps = 8/184 (4%)

Query: 19  AVLLCTSLSSCFFHNNPVN-IYDLTESTKYDESVQR--HIQLIITEPITEKILNSED-II 74
             L    L+ C       + +Y L +     ++ +      L++  P+      +   I+
Sbjct: 1   MFLAAALLAGCSSAPETTSALYLLPQPESQTQTAEAVTDRPLLVVRPVELASYLNNRGIV 60

Query: 75  VRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFEN--NGKISTVVKPNQGIYADYQIISAI 132
            R+S  ++     +QW+  L   I  ++IA+            V        D ++  ++
Sbjct: 61  YRTSESQVIQAKHNQWAQNLSEQITQRVIADLRQKQTHYWPVTVHNLLDQSNDDKLQLSL 120

Query: 133 RSFEINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRIS 192
             F  N   +   +     +I   +  +  +    +   L+ +     +++L  +   ++
Sbjct: 121 NKFNGNYQGNT-EVEGEWMLI-EANGKVKRRAPVKISVPLQDEGYDALVEALAASLDDLT 178

Query: 193 SEII 196
             I 
Sbjct: 179 DAIA 182


>gi|302185703|ref|ZP_07262376.1| hypothetical protein Psyrps6_05138 [Pseudomonas syringae pv.
           syringae 642]
          Length = 207

 Score = 50.0 bits (118), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 31/201 (15%), Positives = 61/201 (30%), Gaps = 16/201 (7%)

Query: 17  SLAVLLCTSLSSCFFHNNPVNIYDLTES---TKYDESVQRHIQLIITEPITEKILNSEDI 73
            + +     L +C   +   + Y L      T    S     Q  +   I    ++   +
Sbjct: 7   LMVLAAALGLGAC--TSTQTHYYTLIAPMGATSTAASKPMPFQFEMLPVIMPVQVDQPPL 64

Query: 74  IVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFE-NNGKISTVVKPNQGIYADYQIISAI 132
           +VR     +  L   +W   L       L    E   G       P         I + +
Sbjct: 65  VVRQGNGSLAILDTERWGSPLGDEFHDALTPQLERRFGSRDMAGLPKNSDQPTLSIRTDV 124

Query: 133 RSFEINIDRHCAIITMSLKIINAHDNSLVGQKV-----FHVEEKLEKDNKLHFIQSLNRA 187
           R FE  +  + A+I +   +      +  G K        V  +   +   + I +  +A
Sbjct: 125 RRFES-MPGNYALIDVVWTLGLRDAGATAGSKRQSLTCSSVIREQAGEGMENLIIAHQKA 183

Query: 188 FSRISSEIID----WTLSSLP 204
            ++++ +I      WT     
Sbjct: 184 VAQLADKIAATASSWTAQRSS 204


>gi|254805427|ref|YP_003083648.1| conserved hypthetical lipoprotein [Neisseria meningitidis alpha14]
 gi|254668969|emb|CBA07275.1| conserved hypthetical lipoprotein [Neisseria meningitidis alpha14]
 gi|325128714|gb|EGC51578.1| putative lipoprotein [Neisseria meningitidis N1568]
          Length = 172

 Score = 50.0 bits (118), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 26/191 (13%), Positives = 72/191 (37%), Gaps = 21/191 (10%)

Query: 9   IKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIITEPITEKIL 68
           ++   I+ +L +  C ++ S  +   P + Y         +  +  +++ + EP+    L
Sbjct: 1   MRLFPIAAALTLAACGTVQSTQYFVLPDSRYI----RPATQGGETAVEVRLAEPLKRGGL 56

Query: 69  NSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFEN--NGKISTVVKPNQGIYADY 126
                + ++ P  I       W+D L  M++  L   F    + +I      +       
Sbjct: 57  -----VYQTDPYRINTAQNHVWADTLDDMLEAALSNAFNRLDSTRIFVPASRSGSTE--- 108

Query: 127 QIISAIRSFEINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNR 186
           +    I +F+ +      +I+    + +  +      + FH+E + + D       +L +
Sbjct: 109 KWTVYIDAFQGSYTGKT-LISGYAVLPDGMN------RPFHIETEQQGDGYAAMTAALEQ 161

Query: 187 AFSRISSEIID 197
              + + ++++
Sbjct: 162 GLKQAAQQMVE 172


>gi|237752257|ref|ZP_04582737.1| predicted protein [Helicobacter winghamensis ATCC BAA-430]
 gi|229376499|gb|EEO26590.1| predicted protein [Helicobacter winghamensis ATCC BAA-430]
          Length = 182

 Score = 50.0 bits (118), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 27/190 (14%), Positives = 62/190 (32%), Gaps = 15/190 (7%)

Query: 9   IKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKY---DESVQRHIQLIITEPITE 65
           + + ++  +         S CF     +  Y++          +   +   L+    +  
Sbjct: 1   MFRGLMQIAWIASFILVFSGCFGKMPQIQYYEIEALNGVKLESKKDSKPRTLVWEISVAS 60

Query: 66  KILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYAD 125
           K + S+ I  +++   I Y   + W +    M+    +    N G +++ V  +   +  
Sbjct: 61  K-IASKKIAYKNNANSIAYFSKNAWIEPFSVMVNSLALKIAGNYGILNSQVSQDSKEH-- 117

Query: 126 YQIISAIRSFEINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLN 185
             I   +     +  R    I      I +   S+         E +E    +  I+   
Sbjct: 118 --IKINVLDCYFDTQRESVFIRF---FIESSKGSVF----IEKVELVESGGFIQIIKGFE 168

Query: 186 RAFSRISSEI 195
           RA +   +EI
Sbjct: 169 RALNAGFAEI 178


>gi|309378442|emb|CBX22937.1| unnamed protein product [Neisseria lactamica Y92-1009]
          Length = 172

 Score = 50.0 bits (118), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 26/191 (13%), Positives = 72/191 (37%), Gaps = 21/191 (10%)

Query: 9   IKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIITEPITEKIL 68
           ++   I+ +L +  C ++ S  +   P + Y         +  +  +++ + EP+    L
Sbjct: 1   MRLFPIAAALTLAACGTVQSTQYFVLPDSRYI----RPTTQGGETAVEVRLAEPLKRGGL 56

Query: 69  NSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFEN--NGKISTVVKPNQGIYADY 126
                + ++ P  I       W+D L  M++  L   F    + +I      +       
Sbjct: 57  -----VYQTDPYRINTAQNHVWADTLDDMLEAALSNAFNRLDSTRIFVPASRSGSTE--- 108

Query: 127 QIISAIRSFEINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNR 186
           +    I +F+ +      +I+    + +  +      + FH+E + + D       +L +
Sbjct: 109 KWTVYIDAFQGSYTGKT-LISGYAVLPDGTN------RPFHIETEQQGDGYAAMTAALEQ 161

Query: 187 AFSRISSEIID 197
              + + ++++
Sbjct: 162 GLKQAAQQMVE 172


>gi|262393800|ref|YP_003285654.1| putative lipoprotein [Vibrio sp. Ex25]
 gi|262337394|gb|ACY51189.1| putative lipoprotein [Vibrio sp. Ex25]
          Length = 192

 Score = 50.0 bits (118), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 24/186 (12%), Positives = 68/186 (36%), Gaps = 10/186 (5%)

Query: 18  LAVLLCTSLSSCFFHNNPV-NIYDLTESTKYDESVQRHIQ--LIITEPITEKI-LNSEDI 73
           L++ L   L+ C         +Y L ++     S     Q   ++  P+     LN   I
Sbjct: 7   LSIALFVGLTGCSSAPETKGALYLLPKAEPVTLSSSDISQRPTLVVRPVKLASYLNDSGI 66

Query: 74  IVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYAD--YQIISA 131
           + R+S  ++     +QW+  +   I  +++    +        + N  +  +   ++   
Sbjct: 67  VYRTSETQVIQARNNQWAHSISEQITQRVVTELRHKQTHYWPTEMNNLLDQNDEAKLQLT 126

Query: 132 IRSFEINIDRHCAIITMSLK-IINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSR 190
           +  F  +   +   I +  + ++   +  +       + + L+ +     + +L+     
Sbjct: 127 LNKFNGSYKGN---IEIEGEWLLINAEGKVEKSAPIQISQPLQDEGYGALVDALSVGLEE 183

Query: 191 ISSEII 196
           ++S+I 
Sbjct: 184 LTSDIA 189


>gi|325204634|gb|ADZ00088.1| putative lipoprotein [Neisseria meningitidis M01-240355]
          Length = 172

 Score = 49.6 bits (117), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 25/189 (13%), Positives = 71/189 (37%), Gaps = 17/189 (8%)

Query: 9   IKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIITEPITEKIL 68
           ++   I+ +L +  C ++ S  +   P + Y         +  +  +++ + EP+    L
Sbjct: 1   MRLFPIAAALTLAACGTMQSTQYFVLPDSRYI----RPATQGGETAVEVRLAEPLKRGGL 56

Query: 69  NSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQI 128
                + ++ P  +       W+D L  M++  L   F        +  P     +  + 
Sbjct: 57  -----VYQTDPYRLNTAQNHVWADTLDDMLEAALSNAFNRLDSAR-IFVPASRSGSTEKW 110

Query: 129 ISAIRSFEINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAF 188
              I +F+ +      +I+    + +  +      + FH+E + + D       +L +  
Sbjct: 111 TVYIDAFQGSYTGKT-LISGYAVLPDGMN------RPFHIETEQQGDGYAAMTAALEQGL 163

Query: 189 SRISSEIID 197
            + + ++++
Sbjct: 164 KQAAQQMVE 172


>gi|269961747|ref|ZP_06176107.1| conserved hypothetical protein [Vibrio harveyi 1DA3]
 gi|269833530|gb|EEZ87629.1| conserved hypothetical protein [Vibrio harveyi 1DA3]
          Length = 189

 Score = 49.6 bits (117), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 29/185 (15%), Positives = 75/185 (40%), Gaps = 10/185 (5%)

Query: 20  VLLCTSLSSCFFHNN-PVNIYDLTESTKY---DESVQRHIQLIITEPITEKILNSED-II 74
           +L+   L+ C         +Y L E++     D  + +  QL++  P+      S+  I+
Sbjct: 6   LLISALLAGCSSAPEDTGALYVLPEASSAKVSDTMISQRPQLVV-RPVELASYLSDSGIV 64

Query: 75  VRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGI-YADY-QIISAI 132
            R+S  +I     +QW+  +   I  ++I    +       V+ N  +  +D  ++  ++
Sbjct: 65  YRASETQIIQAKHNQWAHSISEQITTRVIDELRSKQSQYWPVEVNNLLDQSDESKLQLSL 124

Query: 133 RSFEINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRIS 192
             F  + + + A I     +++A +  +       +   L+ +     + +L+   + ++
Sbjct: 125 SKFNGSYEGN-AEIEGEWLLVDA-NGKVKTSAPVKISMPLQDEGYDALVDALSVGLNNLT 182

Query: 193 SEIID 197
            +I  
Sbjct: 183 DQIAA 187


>gi|161503856|ref|YP_001570968.1| hypothetical protein SARI_01944 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:-- str. RSK2980]
 gi|160865203|gb|ABX21826.1| hypothetical protein SARI_01944 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
          Length = 187

 Score = 49.6 bits (117), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 32/184 (17%), Positives = 75/184 (40%), Gaps = 11/184 (5%)

Query: 18  LAVLLCTSLSSCFFHNNPVNIYDLTESTK--YDESVQRHIQLIITEPITEKILNSEDIIV 75
           L V++   L+SC       + Y L  +       + Q +  L + +      L    ++ 
Sbjct: 5   LVVIMAFWLASCSSSGENKSYYQLPIAQSGVQSTASQGNRLLWVEQVSVPDYLAGNGVVY 64

Query: 76  RSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKIST--VVKPNQGIYADYQIISAIR 133
           ++S ++      + W+  L + ++  L+AN   + ++    V     G   D  +   + 
Sbjct: 65  QTSDVQYVIANNNLWASPLDQQLRNTLVANL--STRLPGWIVASQPLGTTQD-TLNVTVT 121

Query: 134 SFEINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISS 193
            F    D     + +S + +  H+  L+ ++ FH+E   +KD     ++ L   +S+ ++
Sbjct: 122 GFHGRYDGK---VIVSGEWLLNHNGQLI-KRPFHIEASQQKDGYDEMVKVLASVWSQEAT 177

Query: 194 EIID 197
            + D
Sbjct: 178 AMAD 181


>gi|304386850|ref|ZP_07369114.1| lipoprotein [Neisseria meningitidis ATCC 13091]
 gi|261392103|emb|CAX49600.1| conserved hypothetical lipoprotein [Neisseria meningitidis 8013]
 gi|304339104|gb|EFM05194.1| lipoprotein [Neisseria meningitidis ATCC 13091]
 gi|308389794|gb|ADO32114.1| putative lipoprotein [Neisseria meningitidis alpha710]
 gi|325130706|gb|EGC53445.1| putative lipoprotein [Neisseria meningitidis OX99.30304]
 gi|325136678|gb|EGC59278.1| putative lipoprotein [Neisseria meningitidis M0579]
 gi|325142829|gb|EGC65198.1| putative lipoprotein [Neisseria meningitidis 961-5945]
 gi|325144934|gb|EGC67218.1| putative lipoprotein [Neisseria meningitidis M01-240013]
 gi|325198770|gb|ADY94226.1| putative lipoprotein [Neisseria meningitidis G2136]
 gi|325201669|gb|ADY97123.1| putative lipoprotein [Neisseria meningitidis M01-240149]
 gi|325208595|gb|ADZ04047.1| putative lipoprotein [Neisseria meningitidis NZ-05/33]
          Length = 172

 Score = 49.6 bits (117), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 25/192 (13%), Positives = 71/192 (36%), Gaps = 23/192 (11%)

Query: 9   IKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIITEPITEKIL 68
           ++   I+ +L +  C ++ S  +   P + Y         +  +  +++ + EP+    L
Sbjct: 1   MRLFPIAAALTLAACGTVQSTQYFVLPDSRYI----RPATQGGETAVEVRLAEPLKRGGL 56

Query: 69  NSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANF---ENNGKISTVVKPNQGIYAD 125
                + ++ P  +       W+D L  M++  L   F   +N        +        
Sbjct: 57  -----VYQTDPYRLNTAQNHVWADTLDDMLEAALSNAFNRLDNTRIFVPASRSGSTE--- 108

Query: 126 YQIISAIRSFEINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLN 185
            +    I +F+ +      +I+    + +  +      + FH+E + + D       +L 
Sbjct: 109 -KWTVYIDAFQGSYTGKT-LISGYAVLPDGTN------RPFHIETEQQGDGYAAMTAALE 160

Query: 186 RAFSRISSEIID 197
           +   + + ++++
Sbjct: 161 QGLKQAAQQMVE 172


>gi|152996942|ref|YP_001341777.1| hypothetical protein Mmwyl1_2931 [Marinomonas sp. MWYL1]
 gi|150837866|gb|ABR71842.1| protein of unknown function DUF330 [Marinomonas sp. MWYL1]
          Length = 198

 Score = 49.6 bits (117), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 33/191 (17%), Positives = 72/191 (37%), Gaps = 18/191 (9%)

Query: 18  LAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIITE-PITEK-ILNSEDIIV 75
           L VL+   +  C     P   Y L ++  ++  VQ   ++ +   PI     L   +I++
Sbjct: 9   LLVLISWMMIGCATPTPPSKEYLLMDTGLHNTQVQVTKKISVQLMPIVVANYLAGNEIVL 68

Query: 76  RSSPIEIQYLIGSQWSDK----LPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISA 131
            +   ++     + W++     L R+ Q +L     N         P+  I     +   
Sbjct: 69  VTKQGDVHRSQSNLWAESLSPQLTRLTQQRLEKALPNITWFGGQRLPSYAIA---LLNIE 125

Query: 132 IRSFEINIDRHCAIITMSLKI-INAHDNSLVGQKVFHVEEKLEKDNKLHFIQS-----LN 185
           +  F  +++    +I +S +  + +    L     F V+ KL+ D     +Q+      +
Sbjct: 126 VDDFYADLEG---MIHISGRWQVISATGELSASNTFEVQRKLKSDGYSTMVQTLSASWFD 182

Query: 186 RAFSRISSEII 196
           +    ++ EI 
Sbjct: 183 QVIGPMAKEIA 193


>gi|294139021|ref|YP_003554999.1| hypothetical protein SVI_0250 [Shewanella violacea DSS12]
 gi|293325490|dbj|BAJ00221.1| conserved hypothetical protein [Shewanella violacea DSS12]
          Length = 189

 Score = 49.6 bits (117), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 28/183 (15%), Positives = 64/183 (34%), Gaps = 6/183 (3%)

Query: 18  LAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQ-LIITEPITEKILNSED-IIV 75
           L + + T +  C    + +  Y L        +   + Q L+I  P+      ++  ++ 
Sbjct: 5   LVITVLTLMVGCSSTPSELVTYLLPSGNTASAAHHGNDQNLLIVAPVDVASYLADMGLVY 64

Query: 76  RSSPIEIQYLIGSQWSDKLPRMIQLKLIANFEN--NGKISTVVKPNQGIYADYQIISAIR 133
           + SP EI     S W++ L + +  ++  +      G   T +          ++   I 
Sbjct: 65  QVSPTEIVEARQSLWAEGLSKQLTRRITNDLRQKQTGFWPTQLTSTLSTAGIPRLQIRIN 124

Query: 134 SFEINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISS 193
            F        A +     +I+A    L     F     L  D     +++L+     +++
Sbjct: 125 RFNGVYTG-VAEVAGEWMLIDAK-GELQTVHPFIFSVPLAADGFAAQVEALSLGVDELTT 182

Query: 194 EII 196
           ++ 
Sbjct: 183 QVA 185


>gi|153833341|ref|ZP_01986008.1| putative lipoprotein [Vibrio harveyi HY01]
 gi|148870350|gb|EDL69276.1| putative lipoprotein [Vibrio harveyi HY01]
          Length = 189

 Score = 49.6 bits (117), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 28/184 (15%), Positives = 71/184 (38%), Gaps = 8/184 (4%)

Query: 20  VLLCTSLSSCFFHNNPV-NIYDLTESTKY---DESVQRHIQLIITEPITEKILNSEDIIV 75
           +L+   L+ C         +Y L E++     D ++ +  QL++        L    I+ 
Sbjct: 6   LLISALLAGCSSAPEDSGALYVLPEASSAKVSDTAIAQRPQLVVRPVELASYLADSGIVY 65

Query: 76  RSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIY--ADYQIISAIR 133
           R+S  +I     +QW+  +   I  ++I    +       V+ N  +    + +++ ++ 
Sbjct: 66  RTSETKIVQAKHNQWAHNISEQITQRIIDELRSKQSQYWPVEVNNLLDQSGESKLLLSLS 125

Query: 134 SFEINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISS 193
            F  +   + A I     I++  +  +       +   L+ D     + +L+   + ++ 
Sbjct: 126 KFNGSYQGN-AEIEGEWLIVDE-NGKVKNSAPVKINMPLQDDGYDALVDALSVGLNNLTD 183

Query: 194 EIID 197
           +I  
Sbjct: 184 QIAA 187


>gi|157165007|ref|YP_001466751.1| hypothetical protein CCC13826_0089 [Campylobacter concisus 13826]
 gi|112799983|gb|EAT97327.1| putative lipoprotein [Campylobacter concisus 13826]
          Length = 186

 Score = 49.6 bits (117), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 32/185 (17%), Positives = 77/185 (41%), Gaps = 12/185 (6%)

Query: 18  LAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLI---ITEPITEKILNSEDII 74
           LA        S         +Y++  S K   +  +  +L    I       ++++  I+
Sbjct: 7   LAAAFLFFGCSLKTDVPQATMYEIHYSNKECSAENKQKELKNVFIENVSALDMVDTRKIL 66

Query: 75  VRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRS 134
           + +   +I+YL  +++  +   M+   L+    +N     +  PN     D ++  +I S
Sbjct: 67  IVAENNKIRYLSDAKFVSEPSEMVYKSLVKGLYSNCAAKPIFSPNAK---DLRLKVSIIS 123

Query: 135 FEINIDRHCAIITMSLKIINAHD---NSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRI 191
            +I  D+  A ++++ ++ NA+    + ++ +++F   +           ++ N A   +
Sbjct: 124 LQIRGDK--AEVSLAYELFNANTSLKSGMITKEIF-CPDPSSSTIFETINKAANSAIDTL 180

Query: 192 SSEII 196
            SEII
Sbjct: 181 ISEII 185


>gi|269966525|ref|ZP_06180608.1| hypothetical protein VMC_20380 [Vibrio alginolyticus 40B]
 gi|269828869|gb|EEZ83120.1| hypothetical protein VMC_20380 [Vibrio alginolyticus 40B]
          Length = 192

 Score = 49.6 bits (117), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 26/186 (13%), Positives = 70/186 (37%), Gaps = 10/186 (5%)

Query: 18  LAVLLCTSLSSCFFHNNPV-NIYDLTESTKYDESVQRHIQ--LIITEPITEKI-LNSEDI 73
           L++ L   L+ C         +Y L +      S     Q   ++  P+T    LN   I
Sbjct: 7   LSIALFVGLTGCSSAPQTKGAMYLLPKVEPVTLSSSDIAQRPTLVVRPVTLASYLNDSGI 66

Query: 74  IVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIY--ADYQIISA 131
           + R+S  ++     +QW+  +   I  +++A   +        + N  +   ++ ++   
Sbjct: 67  VYRTSETQVIQAKHNQWAHSISEQITQRVVAELRHKQSHYWPAEMNNLLDQSSEAKLQLT 126

Query: 132 IRSFEINIDRHCAIITMSLK-IINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSR 190
           +  F  +   +   I +  + ++   +  +       + + L+ +     + +L+     
Sbjct: 127 LNKFNGSYKGN---IEIEGEWLLINAEGKVENSAPIQISKPLQDEGYEALVNALSIGLES 183

Query: 191 ISSEII 196
           ++S+I 
Sbjct: 184 LTSDIA 189


>gi|239501393|ref|ZP_04660703.1| putative signal peptide [Acinetobacter baumannii AB900]
          Length = 235

 Score = 49.6 bits (117), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 30/199 (15%), Positives = 80/199 (40%), Gaps = 25/199 (12%)

Query: 17  SLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIITEPITEK-ILNSEDIIV 75
           S  +L   ++++C     P N Y LT   K        +Q+I   P+     L+   +++
Sbjct: 21  SGVLLTAIAMTACSSSPTP-NYYTLTP--KVTPVSNSTVQVIEVLPVGIPDRLDRAPLVL 77

Query: 76  RSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYAD----YQIISA 131
           ++S  +   L   +W+  L   ++  L A  +   K+  +   + G+  +    Y++ + 
Sbjct: 78  QNSNGKSTVLDNERWTSTLGTQLRDTLSAGLQQ--KLGAIDSYSSGLSGNNQPLYRVSTD 135

Query: 132 IRSFEINIDRHCAI-ITMSLK------IINAHDNSLVGQK------VFHVEEKLEKD--N 176
              F+I  + +  + ++  +K       + + +  ++  +          ++ +++    
Sbjct: 136 FSHFDIVDNSNINVAVSWVVKRQIPPTQLESTNPKVISNRGAQLNCRIAFKQPIDQKAKK 195

Query: 177 KLHFIQSLNRAFSRISSEI 195
               + + N A S+I + I
Sbjct: 196 MEAIVSASNEAMSQIINTI 214


>gi|254673092|emb|CBA07792.1| putative lipoprotein [Neisseria meningitidis alpha275]
          Length = 172

 Score = 49.6 bits (117), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 26/191 (13%), Positives = 72/191 (37%), Gaps = 21/191 (10%)

Query: 9   IKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIITEPITEKIL 68
           ++   I+ +L +  C ++ S  +   P + Y         +  +  +++ + EP+    L
Sbjct: 1   MRLFPIAAALTLAACGTVQSTQYFVLPDSRYI----RPATQGSETAVKVRLAEPLKRGGL 56

Query: 69  NSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFEN--NGKISTVVKPNQGIYADY 126
                + ++ P  I       W+D L  M++  L   F    + +I      +       
Sbjct: 57  -----VYQTDPYRINTAQNHVWADTLDDMLEAALSNAFNRLDSTRIFVPASRSGSTE--- 108

Query: 127 QIISAIRSFEINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNR 186
           +    I +F+ +      +I+    + +  +      + FH+E + + D       +L +
Sbjct: 109 KWTVYIDAFQGSYTGKT-LISGYAVLPDGTN------RPFHIETEQQGDGYAAMTAALEQ 161

Query: 187 AFSRISSEIID 197
              + + ++++
Sbjct: 162 GLKQAAQQMVE 172


>gi|171058397|ref|YP_001790746.1| hypothetical protein Lcho_1714 [Leptothrix cholodnii SP-6]
 gi|170775842|gb|ACB33981.1| protein of unknown function DUF330 [Leptothrix cholodnii SP-6]
          Length = 232

 Score = 49.6 bits (117), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 23/205 (11%), Positives = 64/205 (31%), Gaps = 19/205 (9%)

Query: 11  KKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTK----------------YDESVQRH 54
           +++      ++    ++ C   +  +  + L  +                     +V   
Sbjct: 24  RRLAGRIALLVFGLVVAGCAGTSPVLQQWRLPNAVPGVAASLATPAAAATVSAPTAVPAV 83

Query: 55  IQLIITEPITEKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKIST 114
            QL+         L+ + ++V      +Q L G +W++ L   +   L+ +       + 
Sbjct: 84  WQLMSPL-QLPDYLDRDALLVPRGQAGLQPLPGHRWAEPLRESVPRLLLQDLGVLRGEAA 142

Query: 115 VVKP--NQGIYADYQIISAIRSFEINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKL 172
           V +     G+    Q+   +R FE   DR    +     + +    +        +   +
Sbjct: 143 VWRAPLPAGVRIARQLRVELRVFEATADRSAVTLQARWSLADPAGGTAPQVLSTGLRVPV 202

Query: 173 EKDNKLHFIQSLNRAFSRISSEIID 197
              +    + +   A  +++  I  
Sbjct: 203 AAGDADALVAAHRIALWQLAERIAA 227


>gi|121635313|ref|YP_975558.1| putative lipoprotein [Neisseria meningitidis FAM18]
 gi|120867019|emb|CAM10782.1| putative lipoprotein [Neisseria meningitidis FAM18]
 gi|325132832|gb|EGC55512.1| putative lipoprotein [Neisseria meningitidis M6190]
 gi|325138734|gb|EGC61286.1| putative lipoprotein [Neisseria meningitidis ES14902]
          Length = 172

 Score = 49.2 bits (116), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 25/191 (13%), Positives = 73/191 (38%), Gaps = 21/191 (10%)

Query: 9   IKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIITEPITEKIL 68
           ++   I+ +L++  C ++ S  +   P + Y         +  +  +++ + EP+    L
Sbjct: 1   MRLFPIAAALSLAACGTVQSTQYFVLPDSRYI----RPATQGGETAVEVRLAEPLKRGGL 56

Query: 69  NSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFEN--NGKISTVVKPNQGIYADY 126
                + ++ P  +       W+D L  M++  L   F    + +I      +       
Sbjct: 57  -----VYQTDPYRLNTAQNHVWADTLDDMLEAALSNAFNRLDSTRIFIPASRSGSTE--- 108

Query: 127 QIISAIRSFEINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNR 186
           +    I +F+ +      +I+    + +  +      + FH+E + + D       +L +
Sbjct: 109 KWTVYIDAFQGSYTGKT-LISGYAVLPDGTN------RPFHIETEQQGDGYAAMTAALEQ 161

Query: 187 AFSRISSEIID 197
              + + ++++
Sbjct: 162 GLKQAAQQMVE 172


>gi|218768692|ref|YP_002343204.1| putative lipoprotein [Neisseria meningitidis Z2491]
 gi|121052700|emb|CAM09043.1| putative lipoprotein [Neisseria meningitidis Z2491]
 gi|254671636|emb|CBA09349.1| putative lipoprotein [Neisseria meningitidis alpha153]
 gi|316984818|gb|EFV63775.1| conserved hypothetical protein [Neisseria meningitidis H44/76]
 gi|319410924|emb|CBY91319.1| conserved hypothetical lipoprotein [Neisseria meningitidis WUE
           2594]
 gi|325199734|gb|ADY95189.1| putative lipoprotein [Neisseria meningitidis H44/76]
 gi|325205611|gb|ADZ01064.1| putative lipoprotein [Neisseria meningitidis M04-240196]
          Length = 172

 Score = 49.2 bits (116), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 25/191 (13%), Positives = 72/191 (37%), Gaps = 21/191 (10%)

Query: 9   IKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIITEPITEKIL 68
           ++   I+ +L +  C ++ S  +   P + Y         +  +  +++ + EP+    L
Sbjct: 1   MRLFPIAAALTLAACGTVQSTQYFVLPDSRYI----RPATQGGETAVEVRLAEPLKRGGL 56

Query: 69  NSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFEN--NGKISTVVKPNQGIYADY 126
                + ++ P  +       W+D L  M++  L   F    + +I      +       
Sbjct: 57  -----VYQTDPYRLNTAQNHVWADTLDDMLEAALSNAFNRLDSTRIFVPASRSGSTE--- 108

Query: 127 QIISAIRSFEINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNR 186
           +    I +F+ +      +I+    + +  +      + FH+E + + D       +L +
Sbjct: 109 KWTVYIDAFQGSYTGKT-LISGYAVLPDGTN------RPFHIETEQQGDGYAAMTAALEQ 161

Query: 187 AFSRISSEIID 197
              + + ++++
Sbjct: 162 GLKQAAQQMVE 172


>gi|299533750|ref|ZP_07047122.1| putative lipoprotein [Comamonas testosteroni S44]
 gi|298718299|gb|EFI59284.1| putative lipoprotein [Comamonas testosteroni S44]
          Length = 227

 Score = 49.2 bits (116), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 36/211 (17%), Positives = 73/211 (34%), Gaps = 28/211 (13%)

Query: 12  KIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIITEPITEKILNSE 71
           +++  S  VL   + S           YDL  +     +       +   P+    + + 
Sbjct: 15  RLLGASSLVLALAACSGLPTAPTQPVRYDLGMADLAVPAANAAAPSVAPVPLVLAEVQAP 74

Query: 72  -----------DIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQ 120
                       +    S  +++    ++WS    +M++ +L       G    V+    
Sbjct: 75  GLPEGLTAMFYRLNYSDS-QQLRAYQNARWSLPPAQMVEQRLRMRL---GLERPVLSGKD 130

Query: 121 G---IYAD----YQIISAIRSFEI---NIDRHCAIITMSLKII---NAHDNSLVGQKVFH 167
               + AD     Q+   +  F     N     A++ +S  +I    +  N L+GQKVF 
Sbjct: 131 NVRPLQADKRSIAQLRVTVDEFSQVFDNASNSRALLRLSASLIGAGESAGNQLLGQKVFT 190

Query: 168 VEEKLEKDNKLHFIQSLNRAFSRISSEIIDW 198
           VE      +     Q++ RA    ++++  W
Sbjct: 191 VEVPAASADAAGGAQAMARAVDEAAAQLSRW 221


>gi|15677521|ref|NP_274677.1| hypothetical protein NMB1672 [Neisseria meningitidis MC58]
 gi|161870519|ref|YP_001599691.1| lipoprotein [Neisseria meningitidis 053442]
 gi|7226925|gb|AAF42021.1| conserved hypothetical protein [Neisseria meningitidis MC58]
 gi|161596072|gb|ABX73732.1| lipoprotein [Neisseria meningitidis 053442]
 gi|325134794|gb|EGC57431.1| putative lipoprotein [Neisseria meningitidis M13399]
 gi|325140865|gb|EGC63375.1| putative lipoprotein [Neisseria meningitidis CU385]
          Length = 172

 Score = 49.2 bits (116), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 25/191 (13%), Positives = 73/191 (38%), Gaps = 21/191 (10%)

Query: 9   IKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIITEPITEKIL 68
           ++   I+ +L++  C ++ S  +   P + Y         +  +  +++ + EP+    L
Sbjct: 1   MRLFPIAAALSLAACGTVQSTQYFVLPDSRYI----RPATQGGETAVEVRLAEPLKRGGL 56

Query: 69  NSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFEN--NGKISTVVKPNQGIYADY 126
                + ++ P  +       W+D L  M++  L   F    + +I      +       
Sbjct: 57  -----VYQTDPYRLNTAQNHVWADTLDDMLEAALSNAFNRLDSTRIFVPASRSGSTE--- 108

Query: 127 QIISAIRSFEINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNR 186
           +    I +F+ +      +I+    + +  +      + FH+E + + D       +L +
Sbjct: 109 KWTVYIDAFQGSYTGKT-LISGYAVLPDGTN------RPFHIETEQQGDGYAAMTAALEQ 161

Query: 187 AFSRISSEIID 197
              + + ++++
Sbjct: 162 GLKQAAQQMVE 172


>gi|261399931|ref|ZP_05986056.1| conserved hypothetical protein [Neisseria lactamica ATCC 23970]
 gi|269210380|gb|EEZ76835.1| conserved hypothetical protein [Neisseria lactamica ATCC 23970]
          Length = 172

 Score = 49.2 bits (116), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 26/191 (13%), Positives = 72/191 (37%), Gaps = 21/191 (10%)

Query: 9   IKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIITEPITEKIL 68
           ++   I+ +L +  C ++ S  +   P + Y         +  +  +++ + EP+    L
Sbjct: 1   MRLFPIAAALTLAACGTVQSTQYFVLPDSRYI----RPATQGSETAVEVRLAEPLKRGGL 56

Query: 69  NSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFEN--NGKISTVVKPNQGIYADY 126
                + ++ P  I       W+D L  M++  L   F    + +I      +       
Sbjct: 57  -----VYQTDPYRINTAQNHVWADTLDDMLEAALSNAFNRLDSTRIFVPASRSGSTE--- 108

Query: 127 QIISAIRSFEINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNR 186
           +    I +F+ +      +I+    + +  +      + FH+E + + D       +L +
Sbjct: 109 KWTVYIDAFQGSYTGKT-LISGYAVLPDGTN------RPFHIETEQQGDGYAAMTAALEQ 161

Query: 187 AFSRISSEIID 197
              + + ++++
Sbjct: 162 GLKQAAQQMVE 172


>gi|289673098|ref|ZP_06493988.1| hypothetical protein PsyrpsF_07614 [Pseudomonas syringae pv.
           syringae FF5]
          Length = 207

 Score = 49.2 bits (116), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 30/198 (15%), Positives = 60/198 (30%), Gaps = 16/198 (8%)

Query: 17  SLAVLLCTSLSSCFFHNNPVNIYDLTESTKY---DESVQRHIQLIITEPITEKILNSEDI 73
            + +     L +C   +   + Y L                 Q  +   I    ++   +
Sbjct: 7   LMVLAAAVGLGAC--TSTQTHYYTLIAPMSANSTAAGKPMPFQFEMLPVIMPVQVDQPPL 64

Query: 74  IVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFE-NNGKISTVVKPNQGIYADYQIISAI 132
           +VR     +  L   +W   L       L    E   G       P         I + +
Sbjct: 65  VVRQGNGSLAILDTERWGSPLGDEFHDALTPQLEHRFGSRDMAGLPKNSDQPTLSIRTDV 124

Query: 133 RSFEINIDRHCAIITMSLKIINAHDNSLVGQKV-----FHVEEKLEKDNKLHFIQSLNRA 187
           R FE  +  + A+I +   +      +  G K        V  +   +   + I +  +A
Sbjct: 125 RRFES-MPGNYALIDVVWTLGLRDAGATAGSKRRSLTCSSVIREQAGEGMENLIIAHQKA 183

Query: 188 FSRISSEII----DWTLS 201
            +R++ +I     +WT  
Sbjct: 184 VARLADKIAATATNWTAQ 201


>gi|296313492|ref|ZP_06863433.1| hypothetical protein NEIPOLOT_00280 [Neisseria polysaccharea ATCC
           43768]
 gi|296840013|gb|EFH23951.1| hypothetical protein NEIPOLOT_00280 [Neisseria polysaccharea ATCC
           43768]
          Length = 172

 Score = 49.2 bits (116), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 25/192 (13%), Positives = 71/192 (36%), Gaps = 23/192 (11%)

Query: 9   IKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIITEPITEKIL 68
           ++   I+ +L +  C ++ S  +   P + Y         +  +  +++ + EP+    L
Sbjct: 1   MRLFPIAAALTLAACGTVQSTQYFVLPDSRYI----RPATQGSETAVEVRLAEPLKRGGL 56

Query: 69  NSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANF---ENNGKISTVVKPNQGIYAD 125
                + ++ P  +       W+D L  M++  L   F   +N        +        
Sbjct: 57  -----VYQTDPYRLNTAQNHVWADTLDDMLEAALSNAFNRLDNTRIFVPASRSGSTE--- 108

Query: 126 YQIISAIRSFEINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLN 185
            +    I +F+ +      +I+    + +  +      + FH+E + + D       +L 
Sbjct: 109 -KWTVYIDAFQGSYTGKT-LISGYAVLPDGTN------RPFHIETEQQGDGYAAMTAALE 160

Query: 186 RAFSRISSEIID 197
           +   + + ++++
Sbjct: 161 QGLKQAAQQMVE 172


>gi|113866708|ref|YP_725197.1| hypothetical protein H16_A0681 [Ralstonia eutropha H16]
 gi|113525484|emb|CAJ91829.1| conserved hypothetical protein [Ralstonia eutropha H16]
          Length = 201

 Score = 49.2 bits (116), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 26/164 (15%), Positives = 58/164 (35%), Gaps = 12/164 (7%)

Query: 43  ESTKYDESVQRHIQLIITEPITEKILNSEDIIVRSSPIE-IQYLIGSQWSDKLPRMIQLK 101
            +T    S      L +      + LN   ++VR      ++ L  ++WS  LP  ++  
Sbjct: 42  PATTTPASTNTLW-LEVAPVRVPERLNRPQLVVRDGGDAGLRLLDLARWSAPLPDELRDA 100

Query: 102 LIANFENNGKISTVVKPNQG---IYADYQIISAIRSFEINIDRHC-AIITMSLKIINAHD 157
           L    +    +  V    QG   +   Y+I + +   + ++ +   A I  +++     D
Sbjct: 101 LSQRLQAT--LGAVDTYQQGMSDVQPLYRITTEVLRLDADVGQRAGATINWTVR--RLPD 156

Query: 158 NSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEIIDWTLS 201
             +V  +    E           + +     +  +++I    LS
Sbjct: 157 GKVVSGRT-QAELPAPGA-VDGVVAAYREIVATTAADIAAGVLS 198


>gi|242277492|ref|YP_002989621.1| hypothetical protein Desal_0010 [Desulfovibrio salexigens DSM 2638]
 gi|242120386|gb|ACS78082.1| hypothetical protein Desal_0010 [Desulfovibrio salexigens DSM 2638]
          Length = 208

 Score = 48.8 bits (115), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 36/199 (18%), Positives = 69/199 (34%), Gaps = 12/199 (6%)

Query: 6   NKIIKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIITEPITE 65
           +K     I+   L+   C    S       V+ Y  +  ++ D       +L +    + 
Sbjct: 3   SKFFFIAILIFVLSCAGCIGGKSVESSFLRVDGY--SSVSECDRVNPDMPRLALKRFSSL 60

Query: 66  KILNSEDIIVRSSPIEIQYLIGSQWS-DKLPRMIQLKLIA-NFE--NNGKISTVVKPNQG 121
             L+ E +IV    +        +WS +  P  I   +        N+ ++ +  +P  G
Sbjct: 61  PALDRETVIVAKGQVMKPDY---RWSWEGTPAEIFDLVAGPALNCMNSYEVISPYRP--G 115

Query: 122 IYADYQIISAIRSFEINIDRHCAI-ITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHF 180
           I  D  +   I SFEI      A  + +   + +     L+ +K+   E  ++       
Sbjct: 116 IEKDLVLSGVITSFEIQRSGGDAFKVAVRYSLWDGSGKELLARKLVEAEAPVKSMRGESI 175

Query: 181 IQSLNRAFSRISSEIIDWT 199
            Q+  +A   I    I W 
Sbjct: 176 AQAAQKAVDGIMKNTIFWI 194


>gi|283853767|ref|ZP_06370992.1| protein of unknown function DUF330 [Desulfovibrio sp. FW1012B]
 gi|283570829|gb|EFC18864.1| protein of unknown function DUF330 [Desulfovibrio sp. FW1012B]
          Length = 199

 Score = 48.8 bits (115), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 28/177 (15%), Positives = 60/177 (33%), Gaps = 7/177 (3%)

Query: 25  SLSSCFFHNNPVNIYDLTESTKYDESVQRH--IQLIITEPITEKILNSEDIIVRSSPIEI 82
            L+ C   + P + Y L+              + L I        L+   I+ R    ++
Sbjct: 21  LLAGCG-KSAPTHFYSLSAPPPKTAEAPAGPCLSLGIGPVDFPAYLDRSQIVTRLGQNQM 79

Query: 83  QYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKP--NQGIYADYQIISAIRSFEINID 140
                 QW + L    Q  L  N         +V      G + D Q++  + SF+ ++ 
Sbjct: 80  HLADFEQWIEPLRENFQRALTDNLAALVCAKPLVTYPWPAGGHPDRQVVIQVASFDGSL- 138

Query: 141 RHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEIID 197
              A +  S  +++A D   +  +     E     +      + +R   + + ++ +
Sbjct: 139 GQEAWLKASWSVLDA-DGKSLTWRTAEYREAAAGPDYAALAAAQSRLVEKFAKDVAE 194


>gi|330950549|gb|EGH50809.1| hypothetical protein PSYCIT7_03933 [Pseudomonas syringae Cit 7]
          Length = 207

 Score = 48.8 bits (115), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 31/198 (15%), Positives = 61/198 (30%), Gaps = 16/198 (8%)

Query: 17  SLAVLLCTSLSSCFFHNNPVNIYDLTES---TKYDESVQRHIQLIITEPITEKILNSEDI 73
            + +     L +C   +   + Y L      T    S     Q  +   I    ++   +
Sbjct: 7   LVVLAAALGLGAC--TSTQTHYYTLIAPMGATSAATSKPMPFQFEMLPVIMPVQVDQPPL 64

Query: 74  IVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFE-NNGKISTVVKPNQGIYADYQIISAI 132
           +VR     +  L   +W   L       L    E   G       P         I + +
Sbjct: 65  VVRQGNGSLAILDTERWGSPLGDEFHDALTPQLERRFGSRDMAGLPKNSDQPTLSIRTDV 124

Query: 133 RSFEINIDRHCAIITMSLKIINAHDNSLVGQKV-----FHVEEKLEKDNKLHFIQSLNRA 187
           R FE  +  + A+I +   +      +  G K        V  +   +   + I +  +A
Sbjct: 125 RRFES-MLGNYALIDVVWTLGLRDAGATAGSKRQSLTCSSVIREQAGEGMENLIIAHQKA 183

Query: 188 FSRISSEI----IDWTLS 201
            ++++ +I      WT  
Sbjct: 184 VAQLADKIATTAARWTAQ 201


>gi|255603661|ref|XP_002538094.1| conserved hypothetical protein [Ricinus communis]
 gi|223513857|gb|EEF24290.1| conserved hypothetical protein [Ricinus communis]
          Length = 182

 Score = 48.8 bits (115), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 25/165 (15%), Positives = 64/165 (38%), Gaps = 9/165 (5%)

Query: 39  YDLTESTKYDES--VQRHIQLIITEPITEKILNSEDIIVRSSPIEIQYLIGSQWSDKLPR 96
           Y L+ +    ++        ++I      ++++   I+V  +  ++     S+W++ L  
Sbjct: 14  YVLSANIDTQQAKNPTATYGIVIGTVTIPEVVDRPQIVVLKADSQVSVAEQSRWAEPLNS 73

Query: 97  MIQLKLIANFENNGKISTVVKPNQG--IYADYQIISAIRSFEINIDRHCAIITMSLKIIN 154
            I   +  N  +    + V    Q   + +DY+++  ++ F+  +     +    L I++
Sbjct: 74  NISRVVADNLAHLLPGAQVSSVAQSRTVASDYRVMVEVQHFDSIVGEG--VRDEFLWIVH 131

Query: 155 A--HDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEIID 197
               D      +   V E  E       + + +RA + +S +I  
Sbjct: 132 TPNSDGVEKRGRTV-VRETAEGGEYAALVAAHSRALTTLSRDIAT 175


>gi|292487864|ref|YP_003530739.1| lipoprotein YmbA [Erwinia amylovora CFBP1430]
 gi|292899090|ref|YP_003538459.1| lipoprotein [Erwinia amylovora ATCC 49946]
 gi|291198938|emb|CBJ46048.1| putative lipoprotein [Erwinia amylovora ATCC 49946]
 gi|291553286|emb|CBA20331.1| Uncharacterized lipoprotein ymbA precursor [Erwinia amylovora
           CFBP1430]
          Length = 186

 Score = 48.8 bits (115), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 28/173 (16%), Positives = 65/173 (37%), Gaps = 8/173 (4%)

Query: 27  SSCFFHNNPVNIYDLT--ESTKYDESVQRHIQLIITEPITEKILNSEDIIVRSSPIEIQY 84
           S+C      V  Y L    +     S      L +        L    ++ +S+ ++   
Sbjct: 14  SACSETPKTVY-YQLPMAATRAAVSSPSVTQPLWVERVTVPDYLAGNGVVYQSNDVQYVI 72

Query: 85  LIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFEINIDRHCA 144
              +QW+  L + +Q  LI N         ++   Q       +  ++  F    D H A
Sbjct: 73  AANNQWASPLDQQLQQTLIGNLSAA-LPGALISSAQPGQQHDTLTVSVHDFHGRYDGH-A 130

Query: 145 IITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEIID 197
           ++    + I  H+  L  ++ F++    ++D     +++L   + R++ ++ +
Sbjct: 131 VVR--GEWILEHNGKLF-KQPFNMTLPQKEDGYDDLVRTLAAGWQRVAVQVAN 180


>gi|325266671|ref|ZP_08133348.1| lipoprotein [Kingella denitrificans ATCC 33394]
 gi|324982114|gb|EGC17749.1| lipoprotein [Kingella denitrificans ATCC 33394]
          Length = 178

 Score = 48.8 bits (115), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 25/169 (14%), Positives = 60/169 (35%), Gaps = 19/169 (11%)

Query: 32  HNNPVNIYDLTESTKYDESVQR-----HIQLIITEPITEKILNSEDIIVRSSPIEIQYLI 86
            + P   Y L +S     +  +     ++ +++ EP     LN + ++ +S    +Q   
Sbjct: 23  SSTPTVYYQLPDSAFVSANTPKQTVWTNVYVVLAEP-----LNRQSLLYQSDEHTVQMTQ 77

Query: 87  GSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFEINIDRHCAII 146
            + W+  L   +   +         +    +P +G      I   I  F+ +       I
Sbjct: 78  HNLWAAPLSNGLAAAVANKLNRQSSLHF--RPAEGAAKSPAITLFIDRFQGSYLGQT-EI 134

Query: 147 TMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEI 195
               ++    + S+     FH     + D     ++SLN+    ++ ++
Sbjct: 135 RGYARL---PNGSIRA---FHAVTPQKGDGYAAMLESLNQGLDDVARQL 177


>gi|313667950|ref|YP_004048234.1| lipoprotein [Neisseria lactamica ST-640]
 gi|313005412|emb|CBN86846.1| putative lipoprotein [Neisseria lactamica 020-06]
          Length = 172

 Score = 48.8 bits (115), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 25/191 (13%), Positives = 72/191 (37%), Gaps = 21/191 (10%)

Query: 9   IKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIITEPITEKIL 68
           ++   I+ +L +  C ++ S  +   P + Y         +  +  +++ + EP+    L
Sbjct: 1   MRLFPIAAALTLAACGTVQSTQYFVLPDSRYI----RPATQGSETAVEVRLAEPLKRGGL 56

Query: 69  NSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFEN--NGKISTVVKPNQGIYADY 126
                + ++ P  +       W+D L  M++  L   F    + +I      +       
Sbjct: 57  -----VYQTDPYRLNTAQNHVWADTLDDMLEAALSNAFNRLDSTRIFVPASRSGSTE--- 108

Query: 127 QIISAIRSFEINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNR 186
           +    I +F+ +      +I+    + +  +      + FH+E + + D       +L +
Sbjct: 109 KWTVYIDAFQGSYTGKT-LISGYAVLPDGTN------RPFHIETEQQGDGYAAMTAALEQ 161

Query: 187 AFSRISSEIID 197
              + + ++++
Sbjct: 162 GLKQAAQQMVE 172


>gi|264676425|ref|YP_003276331.1| lipoprotein [Comamonas testosteroni CNB-2]
 gi|262206937|gb|ACY31035.1| putative lipoprotein [Comamonas testosteroni CNB-2]
          Length = 227

 Score = 48.4 bits (114), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 35/211 (16%), Positives = 73/211 (34%), Gaps = 28/211 (13%)

Query: 12  KIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIITEPITEKILNSE 71
           +++  S  VL   + S           YDL  +     +       +   P+    + + 
Sbjct: 15  RLLGASSLVLALAACSGLPTAPTQPVRYDLGMADLAVPAANAAAPSVAPVPLVLAEVQAP 74

Query: 72  -----------DIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQ 120
                       +    S  +++    ++WS    +M++ ++       G    V+    
Sbjct: 75  GLPEGLTAMFYRLNYSDS-QQLRAYQNARWSLPPAQMVEQRMRMRL---GLERPVLSGKD 130

Query: 121 G---IYAD----YQIISAIRSFEI---NIDRHCAIITMSLKII---NAHDNSLVGQKVFH 167
               + AD     Q+   +  F     N     A++ +S  +I    +  N L+GQKVF 
Sbjct: 131 NVRPLQADKRSIAQLRVTVDEFSQVFDNASNSRALLRLSASLIGAGESAGNQLLGQKVFT 190

Query: 168 VEEKLEKDNKLHFIQSLNRAFSRISSEIIDW 198
           VE      +     Q++ RA    ++++  W
Sbjct: 191 VEVPAASADAAGGAQAMARAVDEAAAQLSRW 221


>gi|294838770|ref|ZP_06783453.1| putative signal peptide [Acinetobacter sp. 6013113]
 gi|294857249|ref|ZP_06795018.1| putative signal peptide [Acinetobacter sp. 6013150]
 gi|301344823|ref|ZP_07225564.1| putative signal peptide [Acinetobacter baumannii AB056]
 gi|301510474|ref|ZP_07235711.1| putative signal peptide [Acinetobacter baumannii AB058]
 gi|301596619|ref|ZP_07241627.1| putative signal peptide [Acinetobacter baumannii AB059]
          Length = 235

 Score = 48.4 bits (114), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 29/199 (14%), Positives = 79/199 (39%), Gaps = 25/199 (12%)

Query: 17  SLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIITEPITEK-ILNSEDIIV 75
           S  +L   ++++C     P N Y LT   K        +Q+I   P+     L+   +++
Sbjct: 21  SGVLLTAIAMTACSSSPTP-NYYTLTP--KVTPVSNSTVQVIEVLPVGIPDRLDRAPLVL 77

Query: 76  RSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYAD----YQIISA 131
           + S  +   L   +W+  L   ++  L A  +   K+  +   + G+  +    Y++ + 
Sbjct: 78  QDSNGKSTVLDNERWTSTLGTQLRDTLSAGLQQ--KLGAIDSYSSGLSGNNQPLYRVSTD 135

Query: 132 IRSFEINIDRHCAI-ITMSLK------IINAHDNSLVGQK------VFHVEEKLEKD--N 176
              F+I  + +  + ++  +K       + + +  ++  +          ++ +++    
Sbjct: 136 FSHFDIVDNSNINVAVSWVVKRQIPPTQLESTNPKVISNRGAQLNCRIAFKQPIDQKAKK 195

Query: 177 KLHFIQSLNRAFSRISSEI 195
               + + N A S+I + +
Sbjct: 196 MEAIVGASNEAMSQIINTV 214


>gi|169795460|ref|YP_001713253.1| putative signal peptide [Acinetobacter baumannii AYE]
 gi|169148387|emb|CAM86252.1| conserved hypothetical protein; putative signal peptide
           [Acinetobacter baumannii AYE]
          Length = 252

 Score = 48.4 bits (114), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 29/199 (14%), Positives = 79/199 (39%), Gaps = 25/199 (12%)

Query: 17  SLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIITEPITEK-ILNSEDIIV 75
           S  +L   ++++C     P N Y LT   K        +Q+I   P+     L+   +++
Sbjct: 38  SGVLLTAIAMTACSSSPTP-NYYTLTP--KVTPVSNSTVQVIEVLPVGIPDRLDRAPLVL 94

Query: 76  RSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYAD----YQIISA 131
           + S  +   L   +W+  L   ++  L A  +   K+  +   + G+  +    Y++ + 
Sbjct: 95  QDSNGKSTVLDNERWTSTLGTQLRDTLSAGLQQ--KLGAIDSYSSGLSGNNQPLYRVSTD 152

Query: 132 IRSFEINIDRHCAI-ITMSLK------IINAHDNSLVGQK------VFHVEEKLEKD--N 176
              F+I  + +  + ++  +K       + + +  ++  +          ++ +++    
Sbjct: 153 FSHFDIVDNSNINVAVSWVVKRQIPPTQLESTNPKVISNRGAQLNCRIAFKQPIDQKAKK 212

Query: 177 KLHFIQSLNRAFSRISSEI 195
               + + N A S+I + +
Sbjct: 213 MEAIVGASNEAMSQIINTV 231


>gi|237801280|ref|ZP_04589741.1| hypothetical protein POR16_20821 [Pseudomonas syringae pv. oryzae
           str. 1_6]
 gi|331024139|gb|EGI04196.1| hypothetical protein POR16_20821 [Pseudomonas syringae pv. oryzae
           str. 1_6]
          Length = 207

 Score = 48.4 bits (114), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 31/199 (15%), Positives = 64/199 (32%), Gaps = 16/199 (8%)

Query: 19  AVLLCTSLSSCFFHNNPVNIYDLTES---TKYDESVQRHIQLIITEPITEKILNSEDIIV 75
            + +   L +C   +   + Y L      T+   +     Q  +   +    ++   ++V
Sbjct: 9   VLAMTLGLVAC--TSTQTHYYTLIAPMGQTEASAARPMPFQFEMLPVLMAVQVDQPPLVV 66

Query: 76  RSSPIEIQYLIGSQWSDKLPRMIQLKLIANFE-NNGKISTVVKPNQGIYADYQIISAIRS 134
           R     +  L   +W+  L       L    E   G       P         I + +R 
Sbjct: 67  RQGNGSLAILDTERWASPLGDEFHDALTPQLERRFGSRDMAGLPKSADQPVLSIRTDVRR 126

Query: 135 FEINIDRHCAIITMSLKIINAHDNSLVGQKV-----FHVEEKLEKDNKLHFIQSLNRAFS 189
           FE  +  + A+I +   +      ++ G K        V  +       + I +  +A S
Sbjct: 127 FES-MPGNYALIDVVWTLGLREGGAIAGSKRKSLTCSSVIREQAGAGMENLIVAHQKAVS 185

Query: 190 RISSEIID----WTLSSLP 204
           +++ +I      WT  S  
Sbjct: 186 KLADKIAATAQSWTQQSSS 204


>gi|260554521|ref|ZP_05826742.1| lipoprotein [Acinetobacter baumannii ATCC 19606]
 gi|260411063|gb|EEX04360.1| lipoprotein [Acinetobacter baumannii ATCC 19606]
          Length = 243

 Score = 48.4 bits (114), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 30/199 (15%), Positives = 79/199 (39%), Gaps = 25/199 (12%)

Query: 17  SLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIITEPITEK-ILNSEDIIV 75
           S  +L   ++++C     P N Y LT   K        +Q+I   P+     L+   +++
Sbjct: 29  SGVLLTAIAMTACSSSPTP-NYYTLTP--KVTPVSNSTVQVIEVLPVGIPDRLDRAPLVL 85

Query: 76  RSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYAD----YQIISA 131
           + S  +   L   +W+  L   ++  L A  +   K+  +   + G+  +    Y++ + 
Sbjct: 86  QDSNGKSTVLDNERWTSTLGTQLRDTLSAGLQQ--KLGAIDSYSSGLSGNNQPLYRVSTD 143

Query: 132 IRSFEINIDRHCAI-ITMSLK------IINAHDNSLVGQK------VFHVEEKLEKD--N 176
              F+I  + +  + ++  +K       + + +  ++  +          ++ +++    
Sbjct: 144 FSHFDIVDNSNINVAVSWVVKRQIPPTQLESTNPKVISNRGAQLNCRIAFKQPIDQKAKK 203

Query: 177 KLHFIQSLNRAFSRISSEI 195
               + + N A S+I + I
Sbjct: 204 MEAIVGASNEAMSQIINTI 222


>gi|326622751|gb|EGE29096.1| putative lipoprotein [Salmonella enterica subsp. enterica serovar
           Dublin str. 3246]
          Length = 179

 Score = 48.0 bits (113), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 32/176 (18%), Positives = 72/176 (40%), Gaps = 11/176 (6%)

Query: 26  LSSCFFHNNPVNIYDLTESTK--YDESVQRHIQLIITEPITEKILNSEDIIVRSSPIEIQ 83
           L+SC       + Y L  +       + Q +  L + +      L    ++ ++S ++  
Sbjct: 5   LASCSSGGENKSYYQLPIAQSGVQSTASQGNRLLWVEQVSVPDYLAGNGVVYQASDVQYV 64

Query: 84  YLIGSQWSDKLPRMIQLKLIANFENNGKIST--VVKPNQGIYADYQIISAIRSFEINIDR 141
               + W+  L + ++  L+AN   + ++    V     G   D  +   +  F    D 
Sbjct: 65  IANNNLWASPLDQQLRNTLVANL--SARLPGWVVASQPLGTTQD-TLNVTVTGFHGRYDG 121

Query: 142 HCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEIID 197
               + +S + +  H+  L+ ++ FH+E   +KD     ++ L  A+S+ ++ I D
Sbjct: 122 K---VIVSGEWLLNHNGQLI-KRPFHIEASQQKDGYDEMVKVLASAWSQEAAAIAD 173


>gi|54302838|ref|YP_132831.1| hypothetical protein PBPRB1159 [Photobacterium profundum SS9]
 gi|46916262|emb|CAG23031.1| conserved hypothetical protein [Photobacterium profundum SS9]
          Length = 197

 Score = 48.0 bits (113), Expect = 8e-04,   Method: Composition-based stats.
 Identities = 30/185 (16%), Positives = 72/185 (38%), Gaps = 6/185 (3%)

Query: 16  CSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQ-LIITEP-ITEKILNSEDI 73
               V     L+ C    + VN Y L    +   S     Q L++  P    + L    +
Sbjct: 5   LLFMVAAAAFLAGCSSQPDAVNSYLLPTGVQSTTSQIGSNQPLLVIRPVEMAEHLAGTGL 64

Query: 74  IVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFEN--NGKISTVVKPNQGIYADYQIISA 131
           + + S  E+     + W++ + + +  ++  +  +  +   +T + P    Y   ++   
Sbjct: 65  VYQVSDTEVVQAQQNLWAESIGKQLTRRINQDLRSKQSQFWTTELTPALSTYNSPRLQVK 124

Query: 132 IRSFEINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRI 191
           I  F  +     A I+    ++   D  L G   F  +  L+++     +++L+   +R+
Sbjct: 125 IDEFNGHYSG-MAKISGEWMLVK-SDGDLNGVYPFQFQVPLQEEGYDAQVKALSEGINRL 182

Query: 192 SSEII 196
           +++I 
Sbjct: 183 TTQIA 187


>gi|238894008|ref|YP_002918742.1| hypothetical protein KP1_1953 [Klebsiella pneumoniae NTUH-K2044]
 gi|330010374|ref|ZP_08306734.1| hypothetical protein HMPREF9538_04433 [Klebsiella sp. MS 92-3]
 gi|238546324|dbj|BAH62675.1| hypothetical protein KP1_1953 [Klebsiella pneumoniae subsp.
           pneumoniae NTUH-K2044]
 gi|328534566|gb|EGF61148.1| hypothetical protein HMPREF9538_04433 [Klebsiella sp. MS 92-3]
          Length = 187

 Score = 48.0 bits (113), Expect = 8e-04,   Method: Composition-based stats.
 Identities = 31/184 (16%), Positives = 71/184 (38%), Gaps = 8/184 (4%)

Query: 16  CSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQ--LIITEPITEKILNSEDI 73
             LA  +C  L++C         Y L       +S        L + +      L    +
Sbjct: 4   WLLAAAVCV-LTACSSGGESKTYYQLPVVQGGAQSAASQGARLLWVEQVSIPDYLAGNGV 62

Query: 74  IVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIR 133
           + +++ ++      + W+  L + ++  L+AN         V     G   D  +  A+ 
Sbjct: 63  VYQTTDVQYVIANNNLWASPLDQQLRTTLVANLSQQLPGWVVSSQPLGSEQD-TLNVAVN 121

Query: 134 SFEINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISS 193
            F    D     + +S + +  H   L+ ++ F++  + E+D     +++L +A+S+ ++
Sbjct: 122 GFHGRYDG---RVIVSGEWLLKHQGQLI-KRPFNIVLRQEQDGYDAMVKTLAQAWSQEAA 177

Query: 194 EIID 197
            I  
Sbjct: 178 AIAS 181


>gi|262039992|ref|ZP_06013257.1| conserved hypothetical protein [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
 gi|259042660|gb|EEW43666.1| conserved hypothetical protein [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
          Length = 187

 Score = 48.0 bits (113), Expect = 8e-04,   Method: Composition-based stats.
 Identities = 31/184 (16%), Positives = 71/184 (38%), Gaps = 8/184 (4%)

Query: 16  CSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQ--LIITEPITEKILNSEDI 73
             LA  +C  L++C         Y L       +S        L + +      L    +
Sbjct: 4   WLLAAAVCV-LTACSSGGESKTYYQLPVVQGGAQSAASQGARLLWVEQVSIPDYLAGNGV 62

Query: 74  IVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIR 133
           + +++ ++      + W+  L + ++  L+AN         V     G   D  +  A+ 
Sbjct: 63  VYQTTDVQYVIANNNLWASPLDQQLRTTLVANLSQQLPGWVVSSQPLGSEQD-TLNVAVN 121

Query: 134 SFEINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISS 193
            F    D     + +S + +  H   L+ ++ F++  + E+D     +++L +A+S+ ++
Sbjct: 122 GFHGRYDG---RVIVSGEWLMKHQGQLI-KRPFNIVLRQEQDGYDAMVKTLAQAWSQEAA 177

Query: 194 EIID 197
            I  
Sbjct: 178 AIAS 181


>gi|261378865|ref|ZP_05983438.1| conserved hypothetical protein [Neisseria cinerea ATCC 14685]
 gi|269144679|gb|EEZ71097.1| conserved hypothetical protein [Neisseria cinerea ATCC 14685]
          Length = 172

 Score = 47.7 bits (112), Expect = 0.001,   Method: Composition-based stats.
 Identities = 25/183 (13%), Positives = 61/183 (33%), Gaps = 17/183 (9%)

Query: 17  SLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIITEPITEKILNSEDIIVR 76
            +AV L  +            ++D           +  +++ + EP+    L     + +
Sbjct: 5   PIAVALLLAACGTAQSTQYFILHDSRYLPPERRVAETAVKVRLAEPLKRGGL-----VYQ 59

Query: 77  SSPIEIQYLIGSQWSDKLPRMIQLKLIANFE--NNGKISTVVKPNQGIYADYQIISAIRS 134
           + P  +       W+  L  M++  L   F   N  ++      N       +    I +
Sbjct: 60  TDPYRLHTAQNHVWASSLDDMLEAALSNAFNRLNTKRVFIPASRNGQSE---KWTVYIDT 116

Query: 135 FEINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSE 194
           F+ +      +   ++      D ++   + FH E + + D       SL +   + + +
Sbjct: 117 FQGSYTGKTIVGGYAV----FPDGTV---RSFHAETEQQGDGYAAMTASLEQGLQQAARQ 169

Query: 195 IID 197
           I+ 
Sbjct: 170 IVR 172


>gi|83746046|ref|ZP_00943101.1| Hypothetical Protein RRSL_04075 [Ralstonia solanacearum UW551]
 gi|207742459|ref|YP_002258851.1| protein of unknown function duf330 [Ralstonia solanacearum IPO1609]
 gi|83727229|gb|EAP74352.1| Hypothetical Protein RRSL_04075 [Ralstonia solanacearum UW551]
 gi|206593849|emb|CAQ60776.1| protein of unknown function duf330 [Ralstonia solanacearum IPO1609]
          Length = 229

 Score = 47.7 bits (112), Expect = 0.001,   Method: Composition-based stats.
 Identities = 18/140 (12%), Positives = 52/140 (37%), Gaps = 3/140 (2%)

Query: 9   IKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIITEPITEKIL 68
            +   +  +        + +C      ++   L  +    E+ +      ++     + L
Sbjct: 7   TRASSLRLACVAGAAALMGACASPEPTLHTLSLRAAPPAPEATRIQRAFRLSGVRVPERL 66

Query: 69  NSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVV--KPNQGIYADY 126
           +   I++R+S  ++Q L   +W+      ++  L A+  +      V    P  G+   Y
Sbjct: 67  DKPQIVLRTSDSQVQELEQQRWAAPFSAELRDALSADLADALSAVDVGGATPPAGV-PLY 125

Query: 127 QIISAIRSFEINIDRHCAII 146
           +I + ++ F+    +  + +
Sbjct: 126 RIGADVQRFDARPGQDVSAL 145


>gi|148264678|ref|YP_001231384.1| hypothetical protein Gura_2634 [Geobacter uraniireducens Rf4]
 gi|146398178|gb|ABQ26811.1| protein of unknown function DUF330 [Geobacter uraniireducens Rf4]
          Length = 212

 Score = 47.7 bits (112), Expect = 0.001,   Method: Composition-based stats.
 Identities = 35/206 (16%), Positives = 74/206 (35%), Gaps = 22/206 (10%)

Query: 4   KLNKIIKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIITE-P 62
           K  + I+  +++C L+ +L            P   Y L         +      II+  P
Sbjct: 2   KKYRPIRFLLLACGLSPVLAGCFGGTSP---PSRFYTLAPLETRSSQLPTGRSAIISLGP 58

Query: 63  ITEKI-LNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKIST------- 114
           +     L+   I+ RS   E+      +W   L   I   L+AN   +G++++       
Sbjct: 59  VFIPDYLDRRQIVTRSGQNELIIAEFDRWGGSLADEITRSLVANL--SGRLASANISVFS 116

Query: 115 -VVKPNQGIYADYQIISAIRSFEINIDRHCAIITMSLK----IINAHDNSLVGQKVFHVE 169
               P   +   Y++  +I  F+         + +S +          +  +  K   + 
Sbjct: 117 WQSMPLSIMGTSYRVPVSISRFD---GIPGDSVVLSARWGVFAKKETTDESLLVKEAAIT 173

Query: 170 EKLEKDNKLHFIQSLNRAFSRISSEI 195
           EK++  +    + ++ RA  R+  E+
Sbjct: 174 EKVDGQSYDAMVAAMQRALDRLGKEM 199


>gi|152969538|ref|YP_001334647.1| hypothetical protein KPN_00981 [Klebsiella pneumoniae subsp.
           pneumoniae MGH 78578]
 gi|150954387|gb|ABR76417.1| hypothetical protein KPN_00981 [Klebsiella pneumoniae subsp.
           pneumoniae MGH 78578]
          Length = 187

 Score = 47.7 bits (112), Expect = 0.001,   Method: Composition-based stats.
 Identities = 31/184 (16%), Positives = 71/184 (38%), Gaps = 8/184 (4%)

Query: 16  CSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQ--LIITEPITEKILNSEDI 73
             LA  +C  L++C         Y L       +S        L + +      L    +
Sbjct: 4   WLLAAAVCV-LTACSIGGESKTYYQLPVVQGGAQSAASQGARLLWVEQVSIPDYLAGNGV 62

Query: 74  IVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIR 133
           + +++ ++      + W+  L + ++  L+AN         V     G   D  +  A+ 
Sbjct: 63  VYQTTDVQYVIANNNLWASPLDQQLRTTLVANLSQQLPGWVVSSQPLGSEQD-TLNVAVN 121

Query: 134 SFEINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISS 193
            F    D     + +S + +  H   L+ ++ F++  + E+D     +++L +A+S+ ++
Sbjct: 122 GFHGRYDG---RVIVSGEWLLKHQGQLI-KRPFNIVLRQEQDGYDAMVKTLAQAWSQEAA 177

Query: 194 EIID 197
            I  
Sbjct: 178 AIAS 181


>gi|154175220|ref|YP_001408231.1| 50S ribosomal protein L5 (BL6) [Campylobacter curvus 525.92]
 gi|112802190|gb|EAT99534.1| 50S ribosomal protein L5 (BL6) [Campylobacter curvus 525.92]
          Length = 192

 Score = 47.7 bits (112), Expect = 0.001,   Method: Composition-based stats.
 Identities = 29/198 (14%), Positives = 77/198 (38%), Gaps = 11/198 (5%)

Query: 3   KKLNKIIKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIITEP 62
           + +  I +  +    +      SL +         IY   +    ++  +    + I + 
Sbjct: 2   RNMKNITRNFMYFILVTAFAGCSLKTDVPQATMYEIYYANKECAAEKRQEFRKNVYIEKV 61

Query: 63  ITEKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGI 122
               ++++  I++ +   +I++L  +++      MI   L+    +N     +  PN   
Sbjct: 62  SALDMVDTRQILIVAENNQIRFLQDAKFVALPSEMIYKALVKGLYSNCAAKPIFSPN--- 118

Query: 123 YADYQIISAIRSFEINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEE----KLEKDNKL 178
           + D ++  ++ S +I  D+  A I  + ++ NA  N  +   + + E        K    
Sbjct: 119 FDDLRLKISVISLQIRGDK--AEIAFAYELFNA--NKSIKSGMINKELFCPDPSSKTIFD 174

Query: 179 HFIQSLNRAFSRISSEII 196
              +++N A   + ++I+
Sbjct: 175 TINKAVNLAIDTLLADIV 192


>gi|239907927|ref|YP_002954668.1| hypothetical protein DMR_32910 [Desulfovibrio magneticus RS-1]
 gi|239797793|dbj|BAH76782.1| hypothetical protein [Desulfovibrio magneticus RS-1]
          Length = 201

 Score = 47.7 bits (112), Expect = 0.001,   Method: Composition-based stats.
 Identities = 28/201 (13%), Positives = 72/201 (35%), Gaps = 9/201 (4%)

Query: 1   MDKKLNKIIKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLT-ESTKYDESVQRHIQLII 59
           M+  + +++   +I  + A  L   L  C   + P + Y L+  +   + S      L +
Sbjct: 1   MNPAIRRLV---VILAAGAACLLPLLVGCG-KSAPTHFYSLSGAAPAAEGSGPSGPCLAV 56

Query: 60  T-EPITEKI-LNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVK 117
              P+     L+   I+ R+   ++      QW +      Q  L  N      +  +  
Sbjct: 57  GIGPVDFPSYLDRSQIVTRTGANQMHLAEFEQWIEAPHDNFQRALTENLSRLVCVKPIYT 116

Query: 118 PNQGIYADYQIISAIRSFEINID-RHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDN 176
               + A  +    I+   ++      A++ ++  +++A D+  +  +     E +   +
Sbjct: 117 YPWPVGARLERQVVIQVARLDGTLGQEAVLRVNWSVLDA-DHKTLEWRSGDYREPVSGPD 175

Query: 177 KLHFIQSLNRAFSRISSEIID 197
                 + +R   + + E+  
Sbjct: 176 YASLAAAESRLVEKFAKEVAA 196


>gi|283784772|ref|YP_003364637.1| putative lipoprotein [Citrobacter rodentium ICC168]
 gi|282948226|emb|CBG87793.1| putative lipoprotein [Citrobacter rodentium ICC168]
          Length = 187

 Score = 47.7 bits (112), Expect = 0.001,   Method: Composition-based stats.
 Identities = 27/168 (16%), Positives = 62/168 (36%), Gaps = 7/168 (4%)

Query: 19  AVLLCTSLSSCFFHNNPVNIYDLTESTK--YDESVQRHIQLIITEPITEKILNSEDIIVR 76
            V++   L+SC       + Y L  +       + Q    L + +      L    ++ +
Sbjct: 6   VVVMACLLASCSSGGENKSYYQLPVAQSGVQSTANQSSRLLWVEQVSVPDYLAGNGLVYQ 65

Query: 77  SSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFE 136
           +S ++      + W+  L + ++  L+A+         V     G   D  +   +  F 
Sbjct: 66  TSDVQYVIASNNLWASPLDQQLRNTLVASLSTQLPGWVVASQPLGSVQD-TLNVTVTGFH 124

Query: 137 INIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSL 184
              D     + +S +++  H   L+ ++ FH+E    +D     ++ L
Sbjct: 125 GRYDGK---VIVSGELLLNHQGQLI-KRPFHIEAVQTRDGYDEMVKVL 168


>gi|325271254|ref|ZP_08137798.1| hypothetical protein G1E_00625 [Pseudomonas sp. TJI-51]
 gi|324103614|gb|EGC00917.1| hypothetical protein G1E_00625 [Pseudomonas sp. TJI-51]
          Length = 236

 Score = 47.7 bits (112), Expect = 0.001,   Method: Composition-based stats.
 Identities = 25/164 (15%), Positives = 60/164 (36%), Gaps = 5/164 (3%)

Query: 34  NPVNIYDLTESTKYDESVQRHIQLIITEPITEKILNSEDIIVRSSPIEIQYLIGSQWSDK 93
            PV +Y L        S    + +++        L  E  + R +   +      +W+  
Sbjct: 25  QPVALYQLDSGDPGQPSQSAGMAVVLGPVSVADYLQRETFLQRQADGSLSAATDGRWAGS 84

Query: 94  LPRMIQLKLIANFE-NNGKISTVVKPNQ-GIYADYQIISAIRSFEINIDRHCAIITMSLK 151
           L   I   L+            V+ P   G   D Q++ +I   +   D+  AI+    +
Sbjct: 85  LSSDIDQLLVRQLAWRLDSQRVVLAPATAGFTPDVQVLLSITRLDSGKDQP-AILDAQWR 143

Query: 152 IINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEI 195
           +++     +   ++ H+E+  E       +Q+  +   +++ ++
Sbjct: 144 LLDRR-GRVRDNRIVHLEQPHEGSE-SSQVQAQGQLLQKLAEQL 185


>gi|317047594|ref|YP_004115242.1| hypothetical protein Pat9b_1365 [Pantoea sp. At-9b]
 gi|316949211|gb|ADU68686.1| protein of unknown function DUF330 [Pantoea sp. At-9b]
          Length = 188

 Score = 47.3 bits (111), Expect = 0.001,   Method: Composition-based stats.
 Identities = 27/185 (14%), Positives = 64/185 (34%), Gaps = 10/185 (5%)

Query: 17  SLAVLLCTSLSSCFFHNNPVNIYDLTE-STKYDESVQRHIQ---LIITEPITEKILNSED 72
            L +     L+ C         Y L   +     S +   Q   L + +      L    
Sbjct: 4   GLMIGALLLLAGCSSTVE-TTYYQLPAGAAVAPVSSEASSQQPMLWVQQISVPDYLAGNG 62

Query: 73  IIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAI 132
           ++ ++S ++      + W+  L + +Q  L+ N         V     G   D  +   +
Sbjct: 63  LVYQTSDVKYVIAANNLWASPLDQQLQQTLVNNLSRALPGRLVSGSPLGDTHD-TLSVNV 121

Query: 133 RSFEINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRIS 192
             F+   D    +   S + +  H+  L+    F++     +D     +++L   + +++
Sbjct: 122 TGFQGRFDGKAVV---SGEWVLQHEGRLIKHG-FNLTLPQTEDGYDALVRTLALGWQQVA 177

Query: 193 SEIID 197
            +I +
Sbjct: 178 QQIAN 182


>gi|223936764|ref|ZP_03628674.1| hypothetical protein Cflav_PD3783 [bacterium Ellin514]
 gi|223894615|gb|EEF61066.1| hypothetical protein Cflav_PD3783 [bacterium Ellin514]
          Length = 136

 Score = 47.3 bits (111), Expect = 0.001,   Method: Composition-based stats.
 Identities = 26/138 (18%), Positives = 55/138 (39%), Gaps = 23/138 (16%)

Query: 72  DII---VRSSPIEIQYLIGSQWSDK----LPRMIQLKLIANFENNGKISTVVKPNQGIYA 124
            I+   VR    +I YL    W++     + R ++  L       G +  V + +    +
Sbjct: 3   RILGFPVRKGENQIDYLQYYNWAEPIHAGIERTMRENLSEEL---GIL--VGRNSVARSS 57

Query: 125 D---YQIISAIRSFEINIDRHCAIITMSLKIINA---HDNSLVGQKVFHVEEKLEKDNKL 178
           D   +++   I  FE+  D++ AI++    I++        +  +K F       K +  
Sbjct: 58  DENNFEVRINISRFEL-TDKNQAIVSGDWMILHGNGVRKGRVELRKNF----PGSKTDAG 112

Query: 179 HFIQSLNRAFSRISSEII 196
             + +L+ A S +  +I 
Sbjct: 113 PGVAALSGALSELCQQIA 130


>gi|194288781|ref|YP_002004688.1| lipoprotein [Cupriavidus taiwanensis LMG 19424]
 gi|193222616|emb|CAQ68619.1| putative lipoprotein [Cupriavidus taiwanensis LMG 19424]
          Length = 206

 Score = 47.3 bits (111), Expect = 0.001,   Method: Composition-based stats.
 Identities = 30/207 (14%), Positives = 67/207 (32%), Gaps = 25/207 (12%)

Query: 8   IIKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQ-------LIIT 60
           ++K+  ++ + A      L+ C         Y L +      +             L + 
Sbjct: 1   MMKRLSLTLACASFAAAVLAGCASPE--PRYYTLAQGPAPVAAPAPAAAPSTDTLWLEVA 58

Query: 61  EPITEKILNSEDIIVRSSPIE------IQYLIGSQWSDKLPRMIQLKLIANFENNGKIST 114
                + LN   ++VR           ++ L  S+WS  LP  ++  L    +    +  
Sbjct: 59  PVRVPERLNRPQLVVRDGQNGSGGDAGVRLLDLSRWSAPLPDELRDALSQRLQAT--LGA 116

Query: 115 VVKPNQGI---YADYQIISAIRSFEINIDRHC-AIITMSLKIINAHDNSLVGQKVFHVEE 170
           V    QG+      Y+I + +   +  + +   A I  +++     D  +V  +    E 
Sbjct: 117 VDTYQQGLSDVQPLYRITTEVLRLDAEVGQRAGATINWTVR--RLPDGKVVSGRT-QAEL 173

Query: 171 KLEKDNKLHFIQSLNRAFSRISSEIID 197
                     + +     +  +S+I  
Sbjct: 174 PAPGA-VDGVVAAYREIVASTASDIAA 199


>gi|330971509|gb|EGH71575.1| Glyoxalase/bleomycin resistance protein/dioxygenase [Pseudomonas
           syringae pv. aceris str. M302273PT]
          Length = 380

 Score = 47.3 bits (111), Expect = 0.001,   Method: Composition-based stats.
 Identities = 23/179 (12%), Positives = 60/179 (33%), Gaps = 13/179 (7%)

Query: 8   IIKKKII-SCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDE-SVQRHIQLIITEPITE 65
           + ++ +I    LA  L + L S  F   P    +++ ST  +  +  R   L +  P   
Sbjct: 1   MKRRTLIKGAVLAAALPSILPSLSFAAGPALTTEVSASTIVNAVAATRDGTLFVGMPRWN 60

Query: 66  KILNSEDIIVRSSPIEIQYLIGSQWSDKLP------RMIQLKLIANFENNGKISTVVKPN 119
               +  +     P ++    G  W++  P        +Q+  +  F+++          
Sbjct: 61  ITKQTPSLARVDGPSKLTPFPGGAWNEWAPGKDVANAFVQVNSVHVFDDDTVWIVDQGAP 120

Query: 120 QGIYADYQIISAIRSFEINIDRHCAIITMSLKIIN----AHDNSLVGQKVFHVEEKLEK 174
             +    +  + +  F+    +   ++     I+      +D  +    V+  +  +  
Sbjct: 121 DNLTT-LRGAAKVAQFDSKTGKVLRVLRFDATILPHGAVMNDLRIFANHVYITDAGVGG 178


>gi|58039756|ref|YP_191720.1| hypothetical protein GOX1304 [Gluconobacter oxydans 621H]
 gi|58002170|gb|AAW61064.1| Hypothetical protein GOX1304 [Gluconobacter oxydans 621H]
          Length = 205

 Score = 47.3 bits (111), Expect = 0.001,   Method: Composition-based stats.
 Identities = 32/195 (16%), Positives = 71/195 (36%), Gaps = 7/195 (3%)

Query: 6   NKIIKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIITEPITE 65
           +   + + +S   A+ L   LS+C        +Y L       ++      + I  P+  
Sbjct: 4   SSTSRLRFLSLVGALGLTGLLSACSSDPT---LYTLAPLPGVSQAG-GPAVVEIRTPVVS 59

Query: 66  KILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGI--Y 123
             L+ + I+  S   + +   GS WS+ LP M+   L+ +       +TV   +  +   
Sbjct: 60  ARLDRDTIVKASEDYQTKLASGSSWSEALPDMLGHTLMTDLAQRLPGTTVFAQDDAVTTT 119

Query: 124 ADYQIISAIRSFEINIDRHCAIIT-MSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQ 182
               +   IR+FE +   H  +   +S+         ++   V     +    +      
Sbjct: 120 PAAYVELTIRNFEADSAGHALVTGMLSVHPAGKMIGPVMTTPVVWQSPEPVASSTAKLTA 179

Query: 183 SLNRAFSRISSEIID 197
           +L++  + I+ +   
Sbjct: 180 ALSQGVASIADQAAA 194


>gi|307821989|ref|ZP_07652221.1| protein of unknown function DUF330 [Methylobacter tundripaludum
           SV96]
 gi|307736555|gb|EFO07400.1| protein of unknown function DUF330 [Methylobacter tundripaludum
           SV96]
          Length = 190

 Score = 47.3 bits (111), Expect = 0.001,   Method: Composition-based stats.
 Identities = 34/187 (18%), Positives = 66/187 (35%), Gaps = 14/187 (7%)

Query: 18  LAVLLCTSLSSCFFHNNPVNIYDLTE----STKYDESVQRHIQLIITEPITEKILNSEDI 73
           +A+   T LS+C     P   Y L            + ++  Q+ +       +L  + I
Sbjct: 1   MALSTVTLLSACISTP-PTQFYVLEPLSEPPPSSTTTAEKKRQIGVGPVSIPTLLERKQI 59

Query: 74  IVRSSPIEIQYLIGSQWSDKLPRMIQLKL---IANFENNGKISTVVKPNQGIYADYQIIS 130
           + R     ++     QW+  L   +   L   +A  +    I        G    Y+II 
Sbjct: 60  VTRLPDNSVKIAEFHQWASPLKDNVAQVLTHNLATLQTGDLIRAYPWSAYGTID-YRIII 118

Query: 131 AIRSFEINIDRHCAIITMSLK--IINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAF 188
            I  F+    R    +       I+N  +++L+      +   L   +    +++LN+  
Sbjct: 119 DIIRFDT---RPEQTVDFEANWAIMNEKNHTLLSHGRSKIAHPLNDPSYPAAVKALNKVL 175

Query: 189 SRISSEI 195
           S  S E+
Sbjct: 176 SEFSQEL 182


>gi|283833764|ref|ZP_06353505.1| putative outer membrane protein [Citrobacter youngae ATCC 29220]
 gi|291070425|gb|EFE08534.1| putative outer membrane protein [Citrobacter youngae ATCC 29220]
          Length = 187

 Score = 47.3 bits (111), Expect = 0.001,   Method: Composition-based stats.
 Identities = 31/181 (17%), Positives = 67/181 (37%), Gaps = 7/181 (3%)

Query: 18  LAVLLCTSLSSCFFHNNPVNIYDLTESTK--YDESVQRHIQLIITEPITEKILNSEDIIV 75
           L V++   L+SC       + Y L  +       + Q +  L + +      L    ++ 
Sbjct: 5   LVVMMAVWLTSCSSSGENKSYYQLPIAQGGVQSTANQGNRLLWVEQVAVPDYLAGNGVVY 64

Query: 76  RSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSF 135
           ++S ++      + W+  L + ++  L+ N         V     G   D  +   +  F
Sbjct: 65  QTSDVQYVIANNNLWASPLDQQLRNTLVTNLSMQLPGWVVASQPLGSTQD-TLNVTVTGF 123

Query: 136 EINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEI 195
               D    +I     ++N     +  ++ FH+E    KD     ++ L  A+S+ ++ I
Sbjct: 124 HGRYDGK--VIVSGEWLLNHQGQLI--KRPFHIEAVQTKDGYDEMVKVLANAWSQEATAI 179

Query: 196 I 196
            
Sbjct: 180 A 180


>gi|171915888|ref|ZP_02931358.1| hypothetical protein VspiD_31995 [Verrucomicrobium spinosum DSM
           4136]
          Length = 195

 Score = 47.3 bits (111), Expect = 0.001,   Method: Composition-based stats.
 Identities = 22/132 (16%), Positives = 50/132 (37%), Gaps = 7/132 (5%)

Query: 68  LNSEDIIVRSSPIEIQYLIGSQWS----DKLPRMIQLKLIANFENNGKISTVVKPNQGIY 123
           L+  ++++R     I      +W+    D   R++   L    +     +     + G+ 
Sbjct: 59  LDRPNLVMREDGTRIAVAESHRWAGKLEDNFARVLATNLGRQLKTGNLRTYPWDTDDGLK 118

Query: 124 ADYQIISAIRSFEINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQS 183
             YQI   +       +   A +  S ++ +  D  L+  + +   E L KD     + +
Sbjct: 119 --YQISLDLTHLHGTSEGD-AFMEASWRVYSLPDRKLIATRSWSGTEPLSKDGYDALVAA 175

Query: 184 LNRAFSRISSEI 195
            +R  +R + E+
Sbjct: 176 ESRLIARFAVEV 187


>gi|294086099|ref|YP_003552859.1| hypothetical protein SAR116_2531 [Candidatus Puniceispirillum
           marinum IMCC1322]
 gi|292665674|gb|ADE40775.1| hypothetical protein SAR116_2531 [Candidatus Puniceispirillum
           marinum IMCC1322]
          Length = 207

 Score = 46.9 bits (110), Expect = 0.002,   Method: Composition-based stats.
 Identities = 32/193 (16%), Positives = 65/193 (33%), Gaps = 10/193 (5%)

Query: 8   IIKKKIISCSLAVLLCTSLSSCFFHNNPVNI-YDL-TESTKYDESVQRHIQLIITEPITE 65
           +I   I   ++ VLL              +  Y++ T         +  IQL   +    
Sbjct: 1   MIHSAIRFGAIVVLLTIIGGCTSPAPRMADTHYNIETSIPPIHYGTEATIQLTKLD---M 57

Query: 66  KILNSEDIIVR---SSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGI 122
           + + S   +V    + PI++Q   G  W      +++  +    ++              
Sbjct: 58  RGIQSSRALVIISDTDPIQLQERRGHYWHSAPALLLKRTISETLDSASHDIRFGTNVTMQ 117

Query: 123 YADYQIISAIRSFEINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQ 182
             DY +   +R F    D H A + M   +I   D  ++   V      L+  + L+ + 
Sbjct: 118 DPDYTMDIDMRLFAFTPDVH-ATVEMGF-VIRNQDGDIMLHDVLLKTASLDGASSLNGVH 175

Query: 183 SLNRAFSRISSEI 195
            L  A ++    +
Sbjct: 176 GLQSALAKALEAL 188


>gi|77456732|ref|YP_346237.1| hypothetical protein Pfl01_0504 [Pseudomonas fluorescens Pf0-1]
 gi|77380735|gb|ABA72248.1| putative lipoprotein [Pseudomonas fluorescens Pf0-1]
          Length = 237

 Score = 46.9 bits (110), Expect = 0.002,   Method: Composition-based stats.
 Identities = 30/191 (15%), Positives = 72/191 (37%), Gaps = 10/191 (5%)

Query: 9   IKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIITEPITEKIL 68
           +   +      +     L+ C  H  PV++Y L   +    +    + +++   I    L
Sbjct: 1   MMTSLRPLIFLLAGVLGLAGCSVHQ-PVSLYQLDSGSPAQPAQSAGMAVLLGPVIVADYL 59

Query: 69  NSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKI---STVVKPNQ-GIYA 124
             E ++ R     +Q  +  +W+  L   I   L+   +  G +     V+ P   G   
Sbjct: 60  QRETLLQRQPDGSLQASVDGRWAGSLSSDIDQLLLR--QVAGHLDSQRVVLAPATLGFTP 117

Query: 125 DYQIISAIRSFEINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSL 184
           D Q++  I   +    +  AI+    ++I+     +   ++ H++E+         +Q+ 
Sbjct: 118 DVQVLLTITRLDS-GAKQPAILDAQWRLIDRR-GQVRDNRIVHLQEQHAGT-TAAQVQAQ 174

Query: 185 NRAFSRISSEI 195
                R++ ++
Sbjct: 175 GVLLQRLAEQL 185


>gi|237730908|ref|ZP_04561389.1| conserved hypothetical protein [Citrobacter sp. 30_2]
 gi|226906447|gb|EEH92365.1| conserved hypothetical protein [Citrobacter sp. 30_2]
          Length = 187

 Score = 46.9 bits (110), Expect = 0.002,   Method: Composition-based stats.
 Identities = 32/181 (17%), Positives = 68/181 (37%), Gaps = 7/181 (3%)

Query: 18  LAVLLCTSLSSCFFHNNPVNIYDLTESTK--YDESVQRHIQLIITEPITEKILNSEDIIV 75
           L V++   L+SC       + Y L  +       + Q +  L + +      L    ++ 
Sbjct: 5   LVVMMAVWLTSCSSSGENKSYYQLPIAQGGVQSSANQGNRLLWVEQIAVPDYLAGNGVVY 64

Query: 76  RSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSF 135
           ++S ++      + W+  L + ++  L+AN         V     G   D  +   +  F
Sbjct: 65  QTSDVQYVIANNNLWASPLDQQLRNTLVANLSMQLPGWVVASQPLGSTQD-TLNVTVTGF 123

Query: 136 EINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEI 195
               D    +I     ++N     +  ++ FH+E    KD     ++ L  A+S+ ++ I
Sbjct: 124 HGRYDGK--VIVSGEWLLNHQGQLI--KRPFHIEAVQTKDGYDEMVKVLANAWSQEATAI 179

Query: 196 I 196
            
Sbjct: 180 A 180


>gi|261339279|ref|ZP_05967137.1| hypothetical protein ENTCAN_05518 [Enterobacter cancerogenus ATCC
           35316]
 gi|288319139|gb|EFC58077.1| putative outer membrane protein [Enterobacter cancerogenus ATCC
           35316]
          Length = 188

 Score = 46.9 bits (110), Expect = 0.002,   Method: Composition-based stats.
 Identities = 32/184 (17%), Positives = 80/184 (43%), Gaps = 10/184 (5%)

Query: 18  LAVLLCTSLSSCFFHNNPVNIYDLT---ESTKYDESVQRHIQLIITEPITEKILNSEDII 74
           L ++    L++C   +   + Y L    +S     + Q +  L + +      L    ++
Sbjct: 5   LVIVGALVLTACSSGSENKSYYQLPLNAQSGAQSSASQGNRLLWVEQVAVPDYLAGNGVV 64

Query: 75  VRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADY-QIISAIR 133
            ++S ++      + W+  L + ++  L+AN   +G++   +  +Q + +D   +   + 
Sbjct: 65  YQTSDVQYVIANNNLWASPLDQQLRNTLVANL--SGQLPGWIVASQPLGSDQDTLNVTVT 122

Query: 134 SFEINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISS 193
            F    D     + +S + +  H   L+ ++ FH+E K +KD     ++ L + +++ S+
Sbjct: 123 GFHGRYDG---AVVISGEWLLNHQGQLI-KRPFHLEMKQQKDGYDEMVKVLAQGWAQESA 178

Query: 194 EIID 197
            I  
Sbjct: 179 NIAR 182


>gi|330427911|gb|AEC19245.1| putative lipoprotein [Pusillimonas sp. T7-7]
          Length = 219

 Score = 46.9 bits (110), Expect = 0.002,   Method: Composition-based stats.
 Identities = 22/204 (10%), Positives = 70/204 (34%), Gaps = 26/204 (12%)

Query: 10  KKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDES---------VQRHIQLIIT 60
           + K+++C LA +L    ++      P + Y L  +     +               + + 
Sbjct: 4   RLKVLACGLAGVLLAGCAA----TKPSHYYTLMATAPQQPATGQAAESSASASRYAISVD 59

Query: 61  EPITEKILNSEDIIVR-SSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPN 119
                + ++   I++      ++  L  S W+  L   +Q  L  ++E + ++  +    
Sbjct: 60  TVELPEQVDRPQIVITDPKSTQVMPLGDSLWASPLSYQLQNAL--SYELSSQLGVLDVSA 117

Query: 120 QGIYADY---QIISAIRSFEINIDRHCAIITMSL--KIINAHDNSLVGQKVFHVEEKLE- 173
            GI       +++  ++ FE   +     + +    ++   +        +     +++ 
Sbjct: 118 TGIPGSLPVWRVLMQVQRFESLYNE---RVLLDATWRLTPINQGK-KASIICRGAAQVQV 173

Query: 174 KDNKLHFIQSLNRAFSRISSEIID 197
           +      +    +A  +++  I  
Sbjct: 174 QQGVSAMVAGHQQALHQLAELIAR 197


>gi|70734053|ref|YP_257693.1| hypothetical protein PFL_0549 [Pseudomonas fluorescens Pf-5]
 gi|68348352|gb|AAY95958.1| Protein of unknown function (DUF330) family [Pseudomonas
           fluorescens Pf-5]
          Length = 237

 Score = 46.5 bits (109), Expect = 0.002,   Method: Composition-based stats.
 Identities = 26/192 (13%), Positives = 71/192 (36%), Gaps = 11/192 (5%)

Query: 8   IIKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIITEPITEKI 67
           ++    +     +     L+ C  H  PV++Y L   +   +     + +++   +    
Sbjct: 1   MMTALRLPLVFLLAGVLGLAGCSVHQ-PVSLYQLDSGSPA-QPASAGMSVLLGPVLIADY 58

Query: 68  LNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKIST----VVKPNQGIY 123
           L  E ++ R     +Q     +W+  L   I   L+   +  G + +    +     G  
Sbjct: 59  LQRETLLQRQDDGSLQASTDGRWAGSLSSDIDQLLLR--QVAGHLDSQRVVLAPATSGFT 116

Query: 124 ADYQIISAIRSFEINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQS 183
            D Q++ +I   +       A++    ++I+     +   ++ H++E+         +Q+
Sbjct: 117 PDVQVLLSITRLDS-GKSQPAVLDAQWRLIDRR-GQVRDNRIVHLQEQHAGTTASQ-VQA 173

Query: 184 LNRAFSRISSEI 195
                 R++ ++
Sbjct: 174 QGVLLQRLAEQL 185


>gi|161522847|ref|YP_001585776.1| hypothetical protein Bmul_5821 [Burkholderia multivorans ATCC
           17616]
 gi|189348317|ref|YP_001941513.1| hypothetical protein BMULJ_05701 [Burkholderia multivorans ATCC
           17616]
 gi|160346400|gb|ABX19484.1| protein of unknown function DUF330 [Burkholderia multivorans ATCC
           17616]
 gi|189338455|dbj|BAG47523.1| hypothetical protein BMULJ_05701 [Burkholderia multivorans ATCC
           17616]
          Length = 212

 Score = 46.5 bits (109), Expect = 0.002,   Method: Composition-based stats.
 Identities = 28/205 (13%), Positives = 70/205 (34%), Gaps = 14/205 (6%)

Query: 3   KKLNKIIKKKIISCSLAVLLCTSLSSCFFHNN----PVNIY----DLTESTKYDESVQRH 54
           K++   ++  + S   A+ +  +L   F        P   Y     +  +          
Sbjct: 7   KQIGTSVRDAVKSAPAALAVTIALGGTFVVAGCGHSPPTCYVALSPVASAAPRATEPVAP 66

Query: 55  IQL-IITEPITEKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKIS 113
           +QL  +  P     L    ++V+ S   +    G++W   L  M++  L  +        
Sbjct: 67  VQLTAVHVPAALDRLE---VVVQRSANRLVIDDGARWGAPLDLMMRETLTQDLLARLPEG 123

Query: 114 TVVKPNQGIYADYQIISAIRSFEINIDRHCAIITMSL-KIINAHDNSLVGQKVFHVEEKL 172
            VV P     AD + +  +   + + D    +  ++   +++     +   +   +  +L
Sbjct: 124 AVVLPGAPRQADTRTLV-VTVLDAHADESGTLTFLAAWTLLSGRPERVTSSRETTLTAQL 182

Query: 173 EKDNKLHFIQSLNRAFSRISSEIID 197
              +      +L+R   +++  I  
Sbjct: 183 TSRDAAAQADALSRVLGQLADRIAS 207


>gi|207728063|ref|YP_002256457.1| protein of unknown function duf330 [Ralstonia solanacearum MolK2]
 gi|206591307|emb|CAQ56919.1| protein of unknown function duf330 [Ralstonia solanacearum MolK2]
          Length = 220

 Score = 46.5 bits (109), Expect = 0.002,   Method: Composition-based stats.
 Identities = 18/140 (12%), Positives = 51/140 (36%), Gaps = 3/140 (2%)

Query: 9   IKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIITEPITEKIL 68
            +   +  +        + +C      ++   L       E+ +      ++     + L
Sbjct: 7   TRASSLRLACVAGAAALMGACASPEPTLHTLSLRAEPPAPEATRIQRAFRLSAVRVPERL 66

Query: 69  NSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVV--KPNQGIYADY 126
           +   I++R+S  ++Q L   +W+      ++  L A+  +      V    P  G+   Y
Sbjct: 67  DKPQIVLRTSDSQVQELEQQRWAAPFGAELRDALSADLADALSAVDVGGATPPAGV-PLY 125

Query: 127 QIISAIRSFEINIDRHCAII 146
           +I + ++ F+    +  + +
Sbjct: 126 RIGADVQRFDARPGQDVSAL 145


>gi|213158600|ref|YP_002319898.1| hypothetical protein AB57_2554 [Acinetobacter baumannii AB0057]
 gi|213057760|gb|ACJ42662.1| conserved hypothetical protein [Acinetobacter baumannii AB0057]
          Length = 213

 Score = 46.5 bits (109), Expect = 0.002,   Method: Composition-based stats.
 Identities = 28/197 (14%), Positives = 78/197 (39%), Gaps = 25/197 (12%)

Query: 19  AVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIITEPITEK-ILNSEDIIVRS 77
            +L   ++++C     P N Y LT   K        +Q+I   P+     L+   ++++ 
Sbjct: 1   MLLTAIAMTACSSSPTP-NYYTLTP--KVTPVSNSTVQVIEVLPVGIPDRLDRAPLVLQD 57

Query: 78  SPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYAD----YQIISAIR 133
           S  +   L   +W+  L   ++  L A  +   K+  +   + G+  +    Y++ +   
Sbjct: 58  SNGKSTVLDNERWTSTLGTQLRDTLSAGLQQ--KLGAIDSYSSGLSGNNQPLYRVSTDFS 115

Query: 134 SFEINIDRHCAI-ITMSLK------IINAHDNSLVGQK------VFHVEEKLEKD--NKL 178
            F+I  + +  + ++  +K       + + +  ++  +          ++ +++      
Sbjct: 116 HFDIVDNSNINVAVSWVVKRQIPPTQLESTNPKVISNRGAQLNCRIAFKQPIDQKAKKME 175

Query: 179 HFIQSLNRAFSRISSEI 195
             + + N A S+I + +
Sbjct: 176 AIVGASNEAMSQIINTV 192


>gi|326315187|ref|YP_004232859.1| hypothetical protein Acav_0369 [Acidovorax avenae subsp. avenae
           ATCC 19860]
 gi|323372023|gb|ADX44292.1| protein of unknown function DUF330 [Acidovorax avenae subsp. avenae
           ATCC 19860]
          Length = 221

 Score = 46.5 bits (109), Expect = 0.002,   Method: Composition-based stats.
 Identities = 30/193 (15%), Positives = 62/193 (32%), Gaps = 23/193 (11%)

Query: 27  SSCFFHNNP-VNIYDLTESTKYDESVQRHIQLI-ITEPI---TEKILNSEDIIVR---SS 78
            S      P  ++YD           +R   L  I  P       +  S  ++ R     
Sbjct: 27  CSALPAPPPRADVYDFGPGPLAQAPAERGAPLPPIALPEVAVAGPVEGSTAVLYRLAYDD 86

Query: 79  PIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGI-------YADYQIISA 131
           P  ++    ++WS    +++Q  L       G    V+  ++G             +   
Sbjct: 87  PRHLRPYGQARWSQPPAQLVQQALRDQL---GLRRPVLMGDEGASQLVDTGKPPAVLRVE 143

Query: 132 IRSFEINIDRHCA---IITMSLKIINA--HDNSLVGQKVFHVEEKLEKDNKLHFIQSLNR 186
           I  F        A   ++ +   + ++      LV Q+VF ++      +      ++  
Sbjct: 144 IEEFSQVFQAPKASTGVLRLRASLADSTQAGEKLVAQRVFVIQRPAPTADARGGTLAMAE 203

Query: 187 AFSRISSEIIDWT 199
           A ++ S E+  W 
Sbjct: 204 AAAQASQEVAQWV 216


>gi|148549989|ref|YP_001270091.1| hypothetical protein Pput_4787 [Pseudomonas putida F1]
 gi|148514047|gb|ABQ80907.1| protein of unknown function DUF330 [Pseudomonas putida F1]
          Length = 251

 Score = 46.1 bits (108), Expect = 0.003,   Method: Composition-based stats.
 Identities = 24/164 (14%), Positives = 58/164 (35%), Gaps = 5/164 (3%)

Query: 34  NPVNIYDLTESTKYDESVQRHIQLIITEPITEKILNSEDIIVRSSPIEIQYLIGSQWSDK 93
            PV +Y L        S    + +++        L  E  + R     +      +W+  
Sbjct: 40  QPVALYQLDSGDPGQPSQSAGMAVVLGPVSVADYLQRETFLQRQPDGSLSAATDGRWAGS 99

Query: 94  LPRMIQLKLIANFE-NNGKISTVVKPNQ-GIYADYQIISAIRSFEINIDRHCAIITMSLK 151
           L   I   L+            V+ P   G   D Q++ +I   +       AI+    +
Sbjct: 100 LSSDIDQLLVRQLAWRLDSQRVVLAPATAGFSPDVQVLLSITRLDS-GKNQPAILDAQWR 158

Query: 152 IINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEI 195
           +++     +   ++ H+E++ E       +Q+  +   +++ ++
Sbjct: 159 LLDRR-GRVRDNRIIHLEQQHEGSE-SSQVQAQGQLLQKLAEQL 200


>gi|296103038|ref|YP_003613184.1| hypothetical protein ECL_02694 [Enterobacter cloacae subsp. cloacae
           ATCC 13047]
 gi|295057497|gb|ADF62235.1| hypothetical protein ECL_02694 [Enterobacter cloacae subsp. cloacae
           ATCC 13047]
          Length = 188

 Score = 46.1 bits (108), Expect = 0.003,   Method: Composition-based stats.
 Identities = 35/190 (18%), Positives = 78/190 (41%), Gaps = 9/190 (4%)

Query: 18  LAVLLCTSLSSCFFHNNPVNIYDLT---ESTKYDESVQRHIQLIITEPITEKILNSEDII 74
           LA++    L++C   +   + Y L    +      + Q +  L + +      L    ++
Sbjct: 5   LAIVGAMVLTACSSGSETKSYYQLPLMAQVGTQSTASQGNRLLWVEQVAVPDYLAGNGVV 64

Query: 75  VRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRS 134
            ++S ++      + W+  L + ++  L+AN  +      V     G   D  +   +  
Sbjct: 65  YQTSDVQYVIANNNLWASPLDQQLRNTLVANLSSQLPGWVVASQPLGSDQD-TLNVTVTG 123

Query: 135 FEINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSE 194
           F    D     + +S + +  H   L+ ++ FH+E K +KD     ++ L + +++ S+ 
Sbjct: 124 FHGRYDG---AVVISGEWLLNHQGQLI-KRPFHLELKQQKDGYDEMVKVLAQGWAQESAN 179

Query: 195 IIDWTLSSLP 204
           I    +S LP
Sbjct: 180 IAR-EISRLP 188


>gi|73542365|ref|YP_296885.1| putative lipoprotein [Ralstonia eutropha JMP134]
 gi|72119778|gb|AAZ62041.1| putative lipoprotein [Ralstonia eutropha JMP134]
          Length = 207

 Score = 46.1 bits (108), Expect = 0.003,   Method: Composition-based stats.
 Identities = 26/205 (12%), Positives = 65/205 (31%), Gaps = 18/205 (8%)

Query: 5   LNKIIKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQ----LIIT 60
           +N+I   +  + S+                   +     +     +          + + 
Sbjct: 2   MNRIHASRACALSMLFAATVLAGCASPEPRYYTLAQGPAADASAVTPAVPASDSLWIEVA 61

Query: 61  EPITEKILNSEDIIVRS----SPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVV 116
                + LN   ++VR     +   ++ L  S+WS  LP  ++  L    + +  +  V 
Sbjct: 62  PVRVPERLNRPQLVVRDPRNGNESGLRLLDLSRWSSPLPDEMRDALSQRLQAS--LGAVD 119

Query: 117 KPNQGI---YADYQIISAIRSFEINIDRHC-AIITMSLKIINAHDNSLVGQKVFHVEEKL 172
              QG+      Y+I + +   + +I +   A I  +++     D  +V  +    +   
Sbjct: 120 TYQQGLADVAPVYRITTEVVRLDADIGQRAGATINWTVR--RLPDGKVVSGRT-QSDLPA 176

Query: 173 EKDNKLHFIQSLNRAFSRISSEIID 197
                   + +     S  + +I  
Sbjct: 177 PG-EVDAVVAAYREILSGTAGDIAA 200


>gi|157146357|ref|YP_001453676.1| hypothetical protein CKO_02116 [Citrobacter koseri ATCC BAA-895]
 gi|157083562|gb|ABV13240.1| hypothetical protein CKO_02116 [Citrobacter koseri ATCC BAA-895]
          Length = 187

 Score = 46.1 bits (108), Expect = 0.003,   Method: Composition-based stats.
 Identities = 28/169 (16%), Positives = 62/169 (36%), Gaps = 7/169 (4%)

Query: 18  LAVLLCTSLSSCFFHNNPVNIYDLTESTK--YDESVQRHIQLIITEPITEKILNSEDIIV 75
           L V++   L+SC       + Y L  +       + Q +  L + +      L    ++ 
Sbjct: 5   LVVMMAFWLTSCSSSGENKSYYQLPVAQGGVQSTASQGNRLLWVEQVSVPDYLAGNGVVY 64

Query: 76  RSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSF 135
           ++S ++      + W+  L + ++  L+AN         V     G   D  +   +  F
Sbjct: 65  QTSDVQYVIASNNLWASPLDQQLRNTLVANLSAQLPGWVVASQPLGSVQD-TLNVTVTGF 123

Query: 136 EINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSL 184
               D    +I     ++N     +  ++ FH+E   ++D     ++ L
Sbjct: 124 HGRYDGK--VIVSGEWLLNHQGQLI--KRPFHIETAQQQDGYDEMVKVL 168


>gi|254492568|ref|ZP_05105740.1| hypothetical protein MDMS009_2910 [Methylophaga thiooxidans DMS010]
 gi|224462460|gb|EEF78737.1| hypothetical protein MDMS009_2910 [Methylophaga thiooxydans DMS010]
          Length = 213

 Score = 46.1 bits (108), Expect = 0.003,   Method: Composition-based stats.
 Identities = 27/152 (17%), Positives = 47/152 (30%), Gaps = 5/152 (3%)

Query: 1   MDKKLNKIIKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESV-QRHIQLII 59
           M+K   +     ++   L +  C S           + Y +        +   R   L+I
Sbjct: 1   MNKAFIQYKPVIVVLLCLMLSACFSWGGGEDEETTPHYYVVDVDRGSVATEFARDRVLLI 60

Query: 60  TEPITEKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPN 119
                     ++ I+ R    E Q     ++      M   +L    +  G  S VV   
Sbjct: 61  KPVRVVPHFENKTIVFRVGENEFQSQPPHEFFSDPQDMFTNQLRRWLQKTGLFSQVVTD- 119

Query: 120 QGIYADYQIISAIRSFEIN---IDRHCAIITM 148
             I ADY + SA+              A++ M
Sbjct: 120 DSIAADYVLESAVTGLYGEKRAAYSPQAVVEM 151


>gi|260219762|emb|CBA26617.1| hypothetical protein Csp_H39500 [Curvibacter putative symbiont of
           Hydra magnipapillata]
          Length = 230

 Score = 46.1 bits (108), Expect = 0.003,   Method: Composition-based stats.
 Identities = 33/208 (15%), Positives = 75/208 (36%), Gaps = 21/208 (10%)

Query: 16  CSLAVLLCTSLSSCF-FHNNPVNIYDLTESTKYDESVQRHIQL---IITEPITEKILNSE 71
               ++L   L+ C         +YD            R   L   ++ E    + L++ 
Sbjct: 24  ALFGLMLAGVLAGCAAPRPGTALVYDFGPGAVALAPANRMAPLPPLVLAEVQAPQSLDNT 83

Query: 72  DIIVR---SSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYAD--- 125
            ++ R   S    +Q    ++WS    ++++ +L A          V+  N+G+ +    
Sbjct: 84  SVLYRLNYSDAHVLQPYAQARWSMPPAQLLRQQLRAALSA---QRAVLNANEGVQSPAGA 140

Query: 126 YQIISAIRSFEINIDRHCA---IITMSLKIINAHDN--SLVGQKVFHVEEKLEKDNKLHF 180
             +   +  F    D   A   ++ +   +  +     +LV Q+V  V+      +    
Sbjct: 141 LVLRLELEEFSQIFDSPQASSGLLRLRATLSQSAPGGEALVAQRVVLVKSPSVSPDAAGG 200

Query: 181 IQSLNRAFSRISSEIIDW---TLSSLPL 205
           +++L  A +    ++  W   T ++LP 
Sbjct: 201 VRALAAAAALAVEQLDQWVQQTQAALPA 228


>gi|114777672|ref|ZP_01452632.1| lipoprotein, putative [Mariprofundus ferrooxydans PV-1]
 gi|114551888|gb|EAU54422.1| lipoprotein, putative [Mariprofundus ferrooxydans PV-1]
          Length = 204

 Score = 45.7 bits (107), Expect = 0.003,   Method: Composition-based stats.
 Identities = 30/201 (14%), Positives = 71/201 (35%), Gaps = 16/201 (7%)

Query: 8   IIKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRH----IQLIITEPI 63
           +++   +   L   L   L +    +     Y L    + +   Q       ++ I+   
Sbjct: 1   MMRAIAVLKFLVPGLTALLCAACSVSPVTRYYVLNPVIRAEAPAQTDHAPGKRIGISLLR 60

Query: 64  TEKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQ----LKLIANFENNGKISTVVKPN 119
             + L+   I+ RS+  E++     +W     + I+      L    E+ G   +V+  +
Sbjct: 61  LPQYLDRASIVTRSTSNELKLAEYDRWGGNPEKNIRQVMNRNLSQLLESAGF--SVIAAD 118

Query: 120 QGIYADYQIISAIRSFEINIDRHCAIITMSL--KIINAHDNSLVGQKVFHVEEKLEK-DN 176
             +  +  I   I  FE   D    ++ +S    I++     L G+      + +    +
Sbjct: 119 SDLSPELNIEIEITRFERFPDG---VVRLSAVWHILDPSGKLLTGRSSDLSSQPVAGASD 175

Query: 177 KLHFIQSLNRAFSRISSEIID 197
               + +++    ++S  I D
Sbjct: 176 YDAIVAAMSDLLGQLSHVIAD 196


>gi|330875277|gb|EGH09426.1| lipoprotein [Pseudomonas syringae pv. morsprunorum str. M302280PT]
          Length = 207

 Score = 45.7 bits (107), Expect = 0.004,   Method: Composition-based stats.
 Identities = 29/190 (15%), Positives = 59/190 (31%), Gaps = 12/190 (6%)

Query: 17  SLAVLLCTSLSSCFFHNNPVNIYDLTES---TKYDESVQRHIQLIITEPITEKILNSEDI 73
            + +     + +C   +   + Y L      T    +     Q  +   I    ++   +
Sbjct: 7   LMVLAAALGMGAC--TSTQTHYYTLIAPMGATSNSAARPAPFQFEMLPVIMPVQVDQPPL 64

Query: 74  IVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFE-NNGKISTVVKPNQGIYADYQIISAI 132
           +VR     +  L   +W   L       L    E   G       P  G      + + +
Sbjct: 65  VVRQGNGSLAILDTERWGSPLGDEFHDALTPQLERRFGSRDMAGLPKNGDQPVLSVRTDV 124

Query: 133 RSFEINIDRHCAIITMSLKIINAHDNSLVGQKV-----FHVEEKLEKDNKLHFIQSLNRA 187
           R FE  +  H A+I +   +      +  G K        V  +   +   + I +  +A
Sbjct: 125 RRFES-MPGHYALIDVVWTLGLREAGATAGSKRQSLTCSSVIREQAGEGMENLILAHQKA 183

Query: 188 FSRISSEIID 197
            S ++ +I  
Sbjct: 184 VSTLAEKIAA 193


>gi|226939553|ref|YP_002794626.1| hypothetical protein LHK_00624 [Laribacter hongkongensis HLHK9]
 gi|226714479|gb|ACO73617.1| hypothetical protein LHK_00624 [Laribacter hongkongensis HLHK9]
          Length = 212

 Score = 45.7 bits (107), Expect = 0.004,   Method: Composition-based stats.
 Identities = 17/178 (9%), Positives = 52/178 (29%), Gaps = 5/178 (2%)

Query: 23  CTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIITEPITEKILNSEDIIVRSSPIEI 82
            ++         P   Y LT       +      + +         N   ++ + S +  
Sbjct: 18  LSACQILPTEITPPTTYALTLPAPVPVTAPALPAVRLGTTTVGAPWNGTALVYQLSDVRF 77

Query: 83  QYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFEINIDRH 142
                 +       ++   L        +   V+ P     A +++ + I +   +    
Sbjct: 78  SADAYHRLLSPASTLLNTALADWLGARQRFEAVLAPGSPAPAPWRLETGITALYGDFRSA 137

Query: 143 CA-IITMSLKIINAHDNSLVGQKVF----HVEEKLEKDNKLHFIQSLNRAFSRISSEI 195
            A    +S + +     ++  +++     +    LE    +  +    + + R+  E+
Sbjct: 138 SAPQAVISAQFVIVDTAAVPRRRLLVLDLNQRIPLESATPVALVAGYRQGWLRMLEEL 195


>gi|184158723|ref|YP_001847062.1| hypothetical protein ACICU_02403 [Acinetobacter baumannii ACICU]
 gi|183210317|gb|ACC57715.1| uncharacterized protein conserved in bacteria [Acinetobacter
           baumannii ACICU]
          Length = 207

 Score = 45.7 bits (107), Expect = 0.004,   Method: Composition-based stats.
 Identities = 28/190 (14%), Positives = 75/190 (39%), Gaps = 25/190 (13%)

Query: 26  LSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIITEPITEK-ILNSEDIIVRSSPIEIQY 84
           +++C     P N Y LT   K        +Q+I   P+     L+   ++++ S  +   
Sbjct: 1   MTACSSSPTP-NYYTLTP--KVTPVSNSTVQVIEVLPVGIPDRLDRAPLVLQESNGKSTV 57

Query: 85  LIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYAD----YQIISAIRSFEINID 140
           L   +W+  L   ++  L A  +   K+  +   + G+  +    Y++ +    F+I  +
Sbjct: 58  LDNERWTSTLGTQLRDTLSAGLQQ--KLGAIDSYSSGLSGNNQPLYRVSTDFSHFDIVDN 115

Query: 141 RHCAI-ITMSLK------IINAHDNSLVGQK------VFHVEEKLEKD--NKLHFIQSLN 185
            +  + ++  +K       + + +  ++  +          ++ +++        + + N
Sbjct: 116 SNINVAVSWVVKRQIPPTQLESTNPKVISNRGAQLNCRIAFKQPIDQKAKKMEAIVSASN 175

Query: 186 RAFSRISSEI 195
            A S+I + I
Sbjct: 176 EAMSQIINTI 185


>gi|312958635|ref|ZP_07773155.1| protein of unknown function DUF330 [Pseudomonas fluorescens WH6]
 gi|311287178|gb|EFQ65739.1| protein of unknown function DUF330 [Pseudomonas fluorescens WH6]
          Length = 266

 Score = 45.7 bits (107), Expect = 0.004,   Method: Composition-based stats.
 Identities = 26/192 (13%), Positives = 69/192 (35%), Gaps = 10/192 (5%)

Query: 8   IIKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIITEPITEKI 67
           ++    +     +     L+ C  H  PV++Y L   +         + +++   +    
Sbjct: 31  MMTAPRLPFIFMLAGLLGLAGCSTHQ-PVSLYQLDSGSPAQPEQAAGMAVLLGPVVVADY 89

Query: 68  LNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKIST----VVKPNQGIY 123
           L  E ++ R S   +Q     +W+  L   I   ++   +  G + +    +     G  
Sbjct: 90  LQRETLLQRQSDGSLQGSTDGRWAGSLSSDINQLVLR--QVAGHLDSQRVVLAPAPTGFS 147

Query: 124 ADYQIISAIRSFEINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQS 183
            D Q++  I   +       AI+    ++I+     +   ++ H++E+         +Q+
Sbjct: 148 PDVQVLLTITRLDS-GKSQPAILDAQWRLIDRR-GQVRDNRIVHLQEEHAGTTASQ-VQA 204

Query: 184 LNRAFSRISSEI 195
                  ++ ++
Sbjct: 205 QGVLLQHLAQQL 216


>gi|254458298|ref|ZP_05071724.1| conserved hypothetical protein [Campylobacterales bacterium GD 1]
 gi|207085134|gb|EDZ62420.1| conserved hypothetical protein [Campylobacterales bacterium GD 1]
          Length = 73

 Score = 45.7 bits (107), Expect = 0.004,   Method: Composition-based stats.
 Identities = 10/61 (16%), Positives = 33/61 (54%)

Query: 138 NIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEIID 197
           ++D+  A + +SL +I++  + ++  K F  +++    +    ++ L+ A + +  + +D
Sbjct: 7   DLDKSDASVGISLTLIDSISSEVISTKTFSAKKETSSPDASGGVKGLDAALTNVLEQGLD 66

Query: 198 W 198
           +
Sbjct: 67  F 67


>gi|229588057|ref|YP_002870176.1| putative lipoprotein [Pseudomonas fluorescens SBW25]
 gi|229359923|emb|CAY46777.1| putative lipoprotein [Pseudomonas fluorescens SBW25]
          Length = 237

 Score = 45.7 bits (107), Expect = 0.004,   Method: Composition-based stats.
 Identities = 24/190 (12%), Positives = 71/190 (37%), Gaps = 6/190 (3%)

Query: 8   IIKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIITEPITEKI 67
           ++    +     +     L+ C  H  PV++Y L   +    +    + +++   +    
Sbjct: 1   MMTAPRLPFIFMLAGLLGLAGCSTHQ-PVSLYQLDSGSPAQPAQTAGMAVLLGPVVVADY 59

Query: 68  LNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIA--NFENNGKISTVVKPNQGIYAD 125
           L  E ++ R +   +Q     +W+  L   I   ++     + + +   +     G   D
Sbjct: 60  LQRETLLQRQNDGSLQGSTDGRWAGSLSSDINQLMLRQVAGQLDSQRVVLAPAPAGFSPD 119

Query: 126 YQIISAIRSFEINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLN 185
            Q++  I   +    +  AI+    ++I+     +   ++ H++E+    +    +Q+  
Sbjct: 120 VQVLLTITRLDSGTSQP-AILDAQWRLIDRR-GQVRDNRIVHLQEEHTG-STASQVQAQG 176

Query: 186 RAFSRISSEI 195
                ++ ++
Sbjct: 177 VLLQHLAQQL 186


>gi|156934561|ref|YP_001438477.1| hypothetical protein ESA_02395 [Cronobacter sakazakii ATCC BAA-894]
 gi|156532815|gb|ABU77641.1| hypothetical protein ESA_02395 [Cronobacter sakazakii ATCC BAA-894]
          Length = 187

 Score = 45.7 bits (107), Expect = 0.004,   Method: Composition-based stats.
 Identities = 32/183 (17%), Positives = 68/183 (37%), Gaps = 9/183 (4%)

Query: 18  LAVLLCTSLSSCFFHNNPVNIYDLTEST-KYDESVQRHIQ--LIITEPITEKILNSEDII 74
           L  +    LS+C         Y L  ST     S     Q  L + +      L    ++
Sbjct: 5   LPFVAVALLSACSTTQE-TTWYQLPASTAPVTRSAPMDSQHLLWVEQVSVPDYLAGNGVV 63

Query: 75  VRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRS 134
            +++ ++      + W+  L + ++  L+ N         V     G   D  +   +  
Sbjct: 64  YQTTDVQYVIASQNLWASPLDQQLRNTLVTNLSATLPGWVVSAQPLGAEQD-TLNVNVTG 122

Query: 135 FEINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSE 194
           F    D     + +S + +  H   L+ ++ F+ E K ++D     +++L +A+ + +  
Sbjct: 123 FHGRYDG---RVIVSGEWLLKHKGQLI-KRPFYTELKQQQDGYDAMVKTLAQAWQQQAKT 178

Query: 195 IID 197
           I D
Sbjct: 179 IAD 181


>gi|170723861|ref|YP_001751549.1| hypothetical protein PputW619_4703 [Pseudomonas putida W619]
 gi|169761864|gb|ACA75180.1| protein of unknown function DUF330 [Pseudomonas putida W619]
          Length = 236

 Score = 45.7 bits (107), Expect = 0.004,   Method: Composition-based stats.
 Identities = 24/164 (14%), Positives = 60/164 (36%), Gaps = 5/164 (3%)

Query: 34  NPVNIYDLTESTKYDESVQRHIQLIITEPITEKILNSEDIIVRSSPIEIQYLIGSQWSDK 93
            PV +Y L        S    + +++        L  E  + R +   +      +W+  
Sbjct: 25  QPVALYQLDSGDPGQPSQSAGMAVVLGPVSVADYLQRETFLQRQADGSLSSATDGRWAGS 84

Query: 94  LPRMIQLKLIANFE-NNGKISTVVKP-NQGIYADYQIISAIRSFEINIDRHCAIITMSLK 151
           L   I   L+            V+ P + G   D Q++ +I   +       AI+    +
Sbjct: 85  LSADIDQLLVRQLAWRLDSQRVVLAPASSGFSPDVQVLLSITRLDS-GKNQPAILDAQWR 143

Query: 152 IINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEI 195
           +++    ++   ++ H+E+  E       +Q+  +   +++ ++
Sbjct: 144 LLDRR-GNVRDNRIVHLEQPHEGSE-SSQVQAQGQLLQKLAEQL 185


>gi|167035953|ref|YP_001671184.1| hypothetical protein PputGB1_4964 [Pseudomonas putida GB-1]
 gi|166862441|gb|ABZ00849.1| protein of unknown function DUF330 [Pseudomonas putida GB-1]
          Length = 214

 Score = 45.3 bits (106), Expect = 0.005,   Method: Composition-based stats.
 Identities = 25/164 (15%), Positives = 60/164 (36%), Gaps = 5/164 (3%)

Query: 34  NPVNIYDLTESTKYDESVQRHIQLIITEPITEKILNSEDIIVRSSPIEIQYLIGSQWSDK 93
            PV +Y L        S    + +++        L  E  + R +   +      +W+  
Sbjct: 3   QPVALYQLDSGDPGQPSQSAGMAVVLGPVSVADYLQRETFLQRQADGSLSAATDGRWAGS 62

Query: 94  LPRMIQLKLIANFE-NNGKISTVVKP-NQGIYADYQIISAIRSFEINIDRHCAIITMSLK 151
           L   I   L+            V+ P   G   D Q++ +I   +   D+  AI+    +
Sbjct: 63  LSSDIDQLLVRQLAWRLDSQRVVLAPATTGFSPDVQVLLSITRLDSGKDQP-AILDAQWR 121

Query: 152 IINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEI 195
           +++     +   ++ H+E+  E       +Q+  +   +++ ++
Sbjct: 122 LLDRR-GHVRDNRIVHLEQPHEGSE-SSQVQAQGQLLQKLAEQL 163


>gi|163803693|ref|ZP_02197554.1| hypothetical protein 1103602000423_AND4_00025 [Vibrio sp. AND4]
 gi|159172504|gb|EDP57368.1| hypothetical protein AND4_00025 [Vibrio sp. AND4]
          Length = 189

 Score = 45.3 bits (106), Expect = 0.005,   Method: Composition-based stats.
 Identities = 29/185 (15%), Positives = 70/185 (37%), Gaps = 10/185 (5%)

Query: 20  VLLCTSLSSCFFHNNPV-NIYDLTESTKY---DESVQRHIQLIITEPITEKILNSED-II 74
           +L+   L+ C         +Y L E++     D  +    QL++  P+      ++  I+
Sbjct: 6   LLISALLAGCSSAPENSGALYVLPEASSPKVSDAMIALRSQLVV-RPVELAGYLTDSGIV 64

Query: 75  VRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIY--ADYQIISAI 132
            R+S  +I      +W+  +   I  ++I    +       V+ N  +      ++  ++
Sbjct: 65  YRTSETKIVQAKHYRWAHNISEQITQRVIGELRSKQSQYWPVEVNNLLDQSGGSKLQLSL 124

Query: 133 RSFEINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRIS 192
             F  +   + A I     II+A    +       ++  L+ D     + +L+   + ++
Sbjct: 125 SKFNGSYQGN-AEIEGEWLIIDAS-GKVKNSAPIKIKMPLQDDGYDALVDALSVGLNNLT 182

Query: 193 SEIID 197
            +I  
Sbjct: 183 DQIAA 187


>gi|206580056|ref|YP_002239407.1| putative lipoprotein [Klebsiella pneumoniae 342]
 gi|206569114|gb|ACI10890.1| putative lipoprotein [Klebsiella pneumoniae 342]
          Length = 187

 Score = 45.3 bits (106), Expect = 0.005,   Method: Composition-based stats.
 Identities = 29/184 (15%), Positives = 68/184 (36%), Gaps = 8/184 (4%)

Query: 16  CSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQ--LIITEPITEKILNSEDI 73
             L   +C   ++C         Y L       +S        L + +      L    +
Sbjct: 4   WLLVAAVCVM-TACSSGGESKTYYQLPVVQGGAQSAASQGSRLLWVEQVSIPDYLAGNGV 62

Query: 74  IVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIR 133
           + +++ ++      + W+  L + ++  L+AN         V     G   D  +  A+ 
Sbjct: 63  VYQTTDVQYVIANNNLWASPLDQQLRTTLVANLSQQLPGWVVSSQPLGSEQD-TLNVAVN 121

Query: 134 SFEINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISS 193
            F    D     + +S + +  H   L+ ++ F++  K ++D     +++L +A+S+ + 
Sbjct: 122 GFHGRYDG---RVIVSGEWLLKHQGQLI-KRPFNIVLKQQQDGYDAMVKTLAQAWSQEAV 177

Query: 194 EIID 197
            I  
Sbjct: 178 AIAG 181


>gi|170769171|ref|ZP_02903624.1| putative lipoprotein [Escherichia albertii TW07627]
 gi|170121823|gb|EDS90754.1| putative lipoprotein [Escherichia albertii TW07627]
          Length = 187

 Score = 45.3 bits (106), Expect = 0.006,   Method: Composition-based stats.
 Identities = 28/181 (15%), Positives = 65/181 (35%), Gaps = 7/181 (3%)

Query: 18  LAVLLCTSLSSCFFHNNPVNIYDLTESTKYDES--VQRHIQLIITEPITEKILNSEDIIV 75
           L  +    L+ C       N Y L       +S   Q +  L + +      L    ++ 
Sbjct: 5   LVTIAALWLAGCSSGEINKNYYQLPVVQGGTQSTASQGNRLLWVEQVAVPDYLAGNGVVY 64

Query: 76  RSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSF 135
           ++S ++      + W+  L + ++  L+AN         V     G   D  +   +  F
Sbjct: 65  QTSDVKYVIANNNLWASPLDQQLRNTLVANLSTQLPGWVVASQPLGSAQD-TLNVTVTEF 123

Query: 136 EINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEI 195
               D    +I     ++N     +  ++ F +E    +D     +++L  A+++ ++ +
Sbjct: 124 NGRYDGK--VIVSGEWLLNHQGQLI--KRPFRLEGVQNQDGYDEMVKALASAWNQEAAAM 179

Query: 196 I 196
            
Sbjct: 180 A 180


>gi|224437096|ref|ZP_03658077.1| hypothetical protein HcinC1_03970 [Helicobacter cinaedi CCUG 18818]
 gi|313143566|ref|ZP_07805759.1| conserved hypothetical protein [Helicobacter cinaedi CCUG 18818]
 gi|313128597|gb|EFR46214.1| conserved hypothetical protein [Helicobacter cinaedi CCUG 18818]
          Length = 201

 Score = 45.0 bits (105), Expect = 0.006,   Method: Composition-based stats.
 Identities = 26/202 (12%), Positives = 68/202 (33%), Gaps = 16/202 (7%)

Query: 9   IKKKIISCSLAVLLCTSLSSCF----FHNNPVNIYD----LTESTKYDESVQRHIQLIIT 60
           + KK     L ++   +LSSC         P   Y     L       +      ++ + 
Sbjct: 1   MSKKYRILGLGIVTILTLSSCVDVKIASQIPKVTYLSLQKLQTQANDAKCKANKGKIGLL 60

Query: 61  EPITEKIL-NSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPN 119
           +        ++  I+  +  ++I  L   +W D   +M++  L+   E        + P 
Sbjct: 61  QVNANAPFNDTAIILHNTQTLQISELEHKKWVDSPNKMLESNLLQALEQ-NCFQVAISPF 119

Query: 120 QGIYADYQIISAIRSFEINIDRH--CAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNK 177
                +  +  ++   ++  D     A +++  +++N          +   E  L+    
Sbjct: 120 GTQKLNKILKLSLLGLQVVEDGGKYKAQMSVFYEVLNTSTTQSSKSGIITQEVALQSLED 179

Query: 178 LHFIQSLNRA----FSRISSEI 195
             F ++  +A      ++  ++
Sbjct: 180 ESFAKNFVKANELVIDKLLKQL 201


>gi|222833235|gb|EEE71712.1| predicted protein [Populus trichocarpa]
          Length = 144

 Score = 45.0 bits (105), Expect = 0.006,   Method: Composition-based stats.
 Identities = 21/133 (15%), Positives = 48/133 (36%), Gaps = 15/133 (11%)

Query: 78  SPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIY-------ADYQIIS 130
           +  E++    ++WS     ++Q +L +     G    V+  ++ +            +  
Sbjct: 9   NGQELRPYQLARWSQPPALLLQQRLRSQL---GLQRPVLASSESVAQPRLQGAVPTLLRV 65

Query: 131 AIRSFEINIDRHCA---IITMSLKIINAHDN--SLVGQKVFHVEEKLEKDNKLHFIQSLN 185
            I  F    D   +   ++ +   ++        L+GQK+F V       +     Q+L 
Sbjct: 66  DIEEFSQVFDAPGSSAGVVRLRATLVEQSGAVDRLLGQKLFEVRSPAASGDAAGGAQALA 125

Query: 186 RAFSRISSEIIDW 198
           +A     ++I  W
Sbjct: 126 KATDTAIAQIDAW 138


>gi|224824235|ref|ZP_03697343.1| protein of unknown function DUF330 [Lutiella nitroferrum 2002]
 gi|224603654|gb|EEG09829.1| protein of unknown function DUF330 [Lutiella nitroferrum 2002]
          Length = 192

 Score = 45.0 bits (105), Expect = 0.006,   Method: Composition-based stats.
 Identities = 31/175 (17%), Positives = 64/175 (36%), Gaps = 12/175 (6%)

Query: 28  SCFFHNNPVNIYDL---TESTKYDESVQRHIQLIITEPITEKILNSEDIIVRSSPIEIQY 84
            C      V+ Y L   T +T    +V+ +IQL +  P     LN  +I+ +S  + I  
Sbjct: 15  GCASAPE-VHYYRLSDETMATPQAVAVEGNIQLSVRLPD---YLNDRNIVYQSDDVTIAA 70

Query: 85  LIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYA-DYQIISAIRSFEINIDRHC 143
              + W++   + I  +L A             P  G    D  +      F    +   
Sbjct: 71  ARQNLWAEPPEQAIGRRLSAELGLLRPHYGWSTPLSGGGPRDPVLEVVFDQFNGRFNGRA 130

Query: 144 AIITMSLK-IINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEIID 197
               +S   ++    ++   +  F +E + + D     +++LN+    ++ +I  
Sbjct: 131 V---LSGHWLLRDGRSATPSRHSFRIEARQQGDGYPALVRALNQGLVELAGQIAR 182


>gi|215482945|ref|YP_002325150.1| hypothetical protein ABBFA_001247 [Acinetobacter baumannii
           AB307-0294]
 gi|213987708|gb|ACJ58007.1| conserved hypothetical protein [Acinetobacter baumannii AB307-0294]
          Length = 211

 Score = 45.0 bits (105), Expect = 0.006,   Method: Composition-based stats.
 Identities = 27/195 (13%), Positives = 77/195 (39%), Gaps = 25/195 (12%)

Query: 21  LLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIITEPITEK-ILNSEDIIVRSSP 79
           +   ++++C     P N Y LT   K        +Q+I   P+     L+   ++++ S 
Sbjct: 1   MTAIAMTACSSSPTP-NYYTLTP--KVTPVSNSTVQVIEVLPVGIPDRLDRAPLVLQDSN 57

Query: 80  IEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYAD----YQIISAIRSF 135
            +   L   +W+  L   ++  L A  +   K+  +   + G+  +    Y++ +    F
Sbjct: 58  GKSTVLDNERWTSTLGTQLRDTLSAGLQQ--KLGAIDSYSSGLSGNNQPLYRVSTDFSHF 115

Query: 136 EINIDRHCAI-ITMSLK------IINAHDNSLVGQK------VFHVEEKLEKD--NKLHF 180
           +I  + +  + ++  +K       + + +  ++  +          ++ +++        
Sbjct: 116 DIVDNSNINVAVSWVVKRQIPPTQLESTNPKVISNRGAQLNCRIAFKQPIDQKAKKMEAI 175

Query: 181 IQSLNRAFSRISSEI 195
           + + N A S+I + +
Sbjct: 176 VGASNEAMSQIINTV 190


>gi|109948191|ref|YP_665419.1| hypothetical protein Hac_1724 [Helicobacter acinonychis str.
           Sheeba]
 gi|109715412|emb|CAK00420.1| conserved hypothetical protein [Helicobacter acinonychis str.
           Sheeba]
          Length = 223

 Score = 45.0 bits (105), Expect = 0.006,   Method: Composition-based stats.
 Identities = 21/109 (19%), Positives = 47/109 (43%), Gaps = 4/109 (3%)

Query: 38  IYDLTESTKYDESVQRHI-QLIITEPITEKILNSEDIIVRSSPIEIQYLIGSQWSDKLPR 96
            YDL  S+       + + ++ +   ++  + N+++I+V++   +I Y    +W D    
Sbjct: 36  TYDLNASSFEKSQCTKPLAEVWLVSILSADLFNTKEIVVKTQDGQITYKKRQKWIDLPRN 95

Query: 97  MIQLKLIANFENNGKISTVVKPNQGIY-ADYQIISAIRSFEINIDRHCA 144
           M++   +   E      +V  P  G+    Y +   I SF +  + + A
Sbjct: 96  MLKTMFMQ--EAEKACLSVALPPYGVGVPTYAVRFTILSFSLLEEGNGA 142


>gi|226330656|ref|ZP_03806174.1| hypothetical protein PROPEN_04576 [Proteus penneri ATCC 35198]
 gi|225201451|gb|EEG83805.1| hypothetical protein PROPEN_04576 [Proteus penneri ATCC 35198]
          Length = 190

 Score = 44.6 bits (104), Expect = 0.007,   Method: Composition-based stats.
 Identities = 26/187 (13%), Positives = 66/187 (35%), Gaps = 15/187 (8%)

Query: 18  LAVLLCTSLSSCFFHNNPVNIYDLT-------ESTKYDESVQRHIQLIITEPITEKILNS 70
           +  +    L++C         Y L         +        +  Q+ +       +L +
Sbjct: 4   IIGIFVLMLTACSSQPE-KTYYQLPDIYQTGVSAQVTTTQSAKKPQIWVQPIRLSSMLVN 62

Query: 71  EDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQ-II 129
             I+ +++ I         W + L + +Q  LI+       +   V  NQ +  +   + 
Sbjct: 63  AGIVYQTTDINYTVANQHLWINPLDQQLQQNLISGL--TKALPGTVVANQPVEDNLAKLT 120

Query: 130 SAIRSFEINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFS 189
             +  F+   D     + +S   I   +N ++  + F +     +D     +++L + + 
Sbjct: 121 VTVNYFQGRYDGQ---VIISGDWIYTENNKVI-NQPFSLVLPQTEDGYPALVRTLGQGWE 176

Query: 190 RISSEII 196
           ++ S+I 
Sbjct: 177 QVISDIA 183


>gi|330822972|ref|YP_004386275.1| hypothetical protein Alide2_0331 [Alicycliphilus denitrificans
           K601]
 gi|329308344|gb|AEB82759.1| protein of unknown function DUF330 [Alicycliphilus denitrificans
           K601]
          Length = 226

 Score = 44.6 bits (104), Expect = 0.008,   Method: Composition-based stats.
 Identities = 26/219 (11%), Positives = 63/219 (28%), Gaps = 36/219 (16%)

Query: 12  KIISCSLAVLLCTSLSSCFFHNNP---VNIYDLTESTKYDESVQRHIQLIITEPITEKIL 68
           K       ++L    + C     P    ++YD            +        P+   +L
Sbjct: 14  KGARAVFCMMLAALAAGCSVLPAPPVRADVYDFGPGPMQPAGDAQA-----AVPLAPIVL 68

Query: 69  NSEDIIVRSSPI-------------EIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTV 115
            + D +                   +++    ++WS     ++   L       G+   V
Sbjct: 69  AAVDTVGMPEGSSALLYRLAYANVQQLRPYTQARWSQPPADLLAQALRERL---GQRRMV 125

Query: 116 VKPNQGIYADY-------QIISAIRSFEINIDRHCA---IITMSLKIINA--HDNSLVGQ 163
           +  + G             +   +  F        A   ++ +   + +A     +L  Q
Sbjct: 126 LSGDGGAALQLDQIRQASVLRVQLEEFSQIFSTPDASTGLVRVRAMLADAGPAGEALQAQ 185

Query: 164 KVFHVEEKLEKDNKLHFIQSLNRAFSRISSEIIDWTLSS 202
           +VF         +     ++L  A ++++ E+  W    
Sbjct: 186 RVFIARRPAATSDAAGGARALAEAAAQVADELAHWVQQQ 224


>gi|33601007|ref|NP_888567.1| lipoprotein [Bordetella bronchiseptica RB50]
 gi|33575442|emb|CAE32520.1| lipoprotein [Bordetella bronchiseptica RB50]
          Length = 222

 Score = 44.6 bits (104), Expect = 0.008,   Method: Composition-based stats.
 Identities = 29/196 (14%), Positives = 64/196 (32%), Gaps = 11/196 (5%)

Query: 9   IKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDES----VQRHIQLIITEPIT 64
           +K  +  C+  +L+ T L+ C   + P   Y L                   + I     
Sbjct: 1   MKSTVARCA-PLLIATILAGCG-ASPPARYYTLQPPGATQAVQAGVAPAPFMIEILPVNV 58

Query: 65  EKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENN-GKISTVVKPNQGIY 123
               +   ++VR+    +  L   +WS  LP   +  L        G     V       
Sbjct: 59  PAQADQPQLMVRTGDGTVAPLYSERWSAPLPDEFRAALSDTLTRELGAPDVQVIKPASGT 118

Query: 124 ADYQIISAIRSFEINIDRHCAI-ITMSLKIINAHDNSLVGQKVFHVEEKLEKD-NKLHFI 181
             +++   ++ F++       +  T  ++ +N    +LV      V+     + +    +
Sbjct: 119 PVWRVQVDVQRFDLVAGGPSLLDATWRVRPVNLAAPALVC--RTRVDVPAGGERDTAALV 176

Query: 182 QSLNRAFSRISSEIID 197
           Q+  R  + ++  I  
Sbjct: 177 QAQQRGTALLARTIAS 192


>gi|242278702|ref|YP_002990831.1| hypothetical protein Desal_1229 [Desulfovibrio salexigens DSM 2638]
 gi|242121596|gb|ACS79292.1| conserved hypothetical protein [Desulfovibrio salexigens DSM 2638]
          Length = 227

 Score = 44.6 bits (104), Expect = 0.009,   Method: Composition-based stats.
 Identities = 28/193 (14%), Positives = 62/193 (32%), Gaps = 13/193 (6%)

Query: 14  ISCSLAVLLCTSLSSCFFHNNPV---NIYDLTESTKYDESVQRHIQ--LIITEPITEKIL 68
           I+  L ++   + + C     P      Y L       +         LI+         
Sbjct: 14  IAVVLVLIALCAAAGCVKLERPSLDRKYYTLDVLRGDKQKNDIKAVKNLIVRRIKISPRY 73

Query: 69  NSEDIIVRSSPI--EIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADY 126
              D++ +      E  Y   S +      + Q   +     +G  + V+ P      + 
Sbjct: 74  EDRDLVYKVGENVFEADYY-NSYFVPPAALITQDLRV-WMGESGVFANVLGPESLGTGEL 131

Query: 127 QIISAIRSFEINIDRHC--AIITMSLKIINAH--DNSLVGQKVFHVEEKLEKDNKLHFIQ 182
            +   + S   +       A++ M   ++N    D  +V  + F  E+ +        ++
Sbjct: 132 LLEGVVNSIYGDYSGPEPKAVVKMQFILLNNSNPDLPIVYSRDFSREKVIGAAGPAALVK 191

Query: 183 SLNRAFSRISSEI 195
           +LN   + I +E+
Sbjct: 192 ALNEGLTDIFTEL 204


>gi|319761114|ref|YP_004125051.1| hypothetical protein Alide_0386 [Alicycliphilus denitrificans BC]
 gi|317115675|gb|ADU98163.1| protein of unknown function DUF330 [Alicycliphilus denitrificans
           BC]
          Length = 226

 Score = 44.6 bits (104), Expect = 0.009,   Method: Composition-based stats.
 Identities = 26/219 (11%), Positives = 63/219 (28%), Gaps = 36/219 (16%)

Query: 12  KIISCSLAVLLCTSLSSCFFHNNP---VNIYDLTESTKYDESVQRHIQLIITEPITEKIL 68
           K       ++L    + C     P    ++YD            +        P+   +L
Sbjct: 14  KGARAVFCMMLAALAAGCSVLPAPPVRADVYDFGPGPMQPAGDAQA-----AVPLAPIVL 68

Query: 69  NSEDIIVRSSPI-------------EIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTV 115
            + D +                   +++    ++WS     ++   L       G+   V
Sbjct: 69  AAVDTVGMPEGSSALLYRLAYANVQQLRPYTQARWSQPPADLLAQALRERL---GQRRMV 125

Query: 116 VKPNQGIYADY-------QIISAIRSFEINIDRHCA---IITMSLKIINA--HDNSLVGQ 163
           +  + G             +   +  F        A   ++ +   + +A     +L  Q
Sbjct: 126 LSGDGGAALQLDQIRQASVLRVQLEEFSQIFSTPDASTGLVRVRAMLADAGPAGEALQAQ 185

Query: 164 KVFHVEEKLEKDNKLHFIQSLNRAFSRISSEIIDWTLSS 202
           +VF         +     ++L  A ++++ E+  W    
Sbjct: 186 RVFIARRPAATPDAAGGARALAEAAAQVADELAHWVQQQ 224


>gi|70731895|ref|YP_261637.1| putative lipoprotein [Pseudomonas fluorescens Pf-5]
 gi|68346194|gb|AAY93800.1| lipoprotein, putative [Pseudomonas fluorescens Pf-5]
          Length = 194

 Score = 44.6 bits (104), Expect = 0.009,   Method: Composition-based stats.
 Identities = 27/181 (14%), Positives = 58/181 (32%), Gaps = 13/181 (7%)

Query: 28  SCFFHNNPVNIYDLTESTKYDESVQRHI--QLIITEPITEKILNSEDIIVRSSPIEIQYL 85
           +C   + P + Y L        S  R    Q  ++       ++   ++VR     +  L
Sbjct: 16  ACS--SAPTHYYTLLPPVAEGSSAARTGGPQFEMSTVRIPVQVDQPQLVVRQDSGTLAIL 73

Query: 86  IGSQWSDKLPRMIQLKLIANFENNGKISTV-VKPNQGIYADYQIISAIRSFEINIDRHCA 144
              +WS  L       L +  E       +   P Q       + + +R FE    R  A
Sbjct: 74  ETQRWSAPLVDEFHDALASQMEQKLGTRNLEGLPKQPGRPVLSLQTDVRRFESLPGR-YA 132

Query: 145 IITMSLKIINAHDNSLVGQKVF--HVEEKLEKDNKLHFIQSLNRAFSRISSEII----DW 198
           +I +   +    +            + +          +Q+  +A ++++ ++      W
Sbjct: 133 LIDVVWSLRQRGEGGPARSLTCSSQIRQPA-GVELNSLVQAHQQAIAQLAGQVAAAAQRW 191

Query: 199 T 199
           T
Sbjct: 192 T 192


>gi|317491497|ref|ZP_07949933.1| hypothetical protein HMPREF0864_00696 [Enterobacteriaceae bacterium
           9_2_54FAA]
 gi|316921044|gb|EFV42367.1| hypothetical protein HMPREF0864_00696 [Enterobacteriaceae bacterium
           9_2_54FAA]
          Length = 186

 Score = 44.6 bits (104), Expect = 0.009,   Method: Composition-based stats.
 Identities = 27/185 (14%), Positives = 66/185 (35%), Gaps = 11/185 (5%)

Query: 18  LAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHI-----QLIITEPITEKILNSED 72
           +       LS+C       N Y L   T     V   +     QL +        L++  
Sbjct: 5   MIGAAALLLSACSSQPQ-KNYYQLPVPTATTSVVHAPVESGAHQLWLERVNVADFLSALG 63

Query: 73  IIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAI 132
           ++ +++ ++      + W+  L + +Q  ++AN         V     G   D  +   +
Sbjct: 64  VVYQTNDVQFVTAGNNLWASPLEQQLQQTMVANLSAAMPGWIVSAQPLGNVQD-TLNINV 122

Query: 133 RSFEINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRIS 192
             F    D       +S + I       + ++ F++   +++D     +++L + + + +
Sbjct: 123 TGFHGRYDGKAV---ISGEWILMRSGQ-LTKRAFNLVLPVQQDGYDALVKTLAQGWQQEA 178

Query: 193 SEIID 197
            +I  
Sbjct: 179 QQIAR 183


>gi|288936257|ref|YP_003440316.1| hypothetical protein Kvar_3404 [Klebsiella variicola At-22]
 gi|290510687|ref|ZP_06550057.1| hypothetical protein HMPREF0485_02457 [Klebsiella sp. 1_1_55]
 gi|288890966|gb|ADC59284.1| protein of unknown function DUF330 [Klebsiella variicola At-22]
 gi|289777403|gb|EFD85401.1| hypothetical protein HMPREF0485_02457 [Klebsiella sp. 1_1_55]
          Length = 187

 Score = 44.6 bits (104), Expect = 0.009,   Method: Composition-based stats.
 Identities = 29/184 (15%), Positives = 68/184 (36%), Gaps = 8/184 (4%)

Query: 16  CSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQ--LIITEPITEKILNSEDI 73
             L   +C   ++C         Y L       +S        L + +      L    +
Sbjct: 4   WLLVAAVCVM-TACSSGGESKTYYQLPVVQGGAQSAASQGARLLWVEQVSIPDYLAGNGV 62

Query: 74  IVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIR 133
           + +++ ++      + W+  L + ++  L+AN         V     G   D  +  A+ 
Sbjct: 63  VYQTTDVQYVIANNNLWASPLDQQLRTTLVANLSQQLPGWVVSSQPLGSEQD-TLNVAVN 121

Query: 134 SFEINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISS 193
            F    D     + +S + +  H   L+ ++ F++  K ++D     +++L +A+S+ + 
Sbjct: 122 GFHGRYDG---RVIVSGEWLLKHQGQLI-KRPFNIVLKQQQDGYDAMVKTLAQAWSQEAV 177

Query: 194 EIID 197
            I  
Sbjct: 178 AIAG 181


>gi|290473844|ref|YP_003466718.1| hypothetical protein XBJ1_0783 [Xenorhabdus bovienii SS-2004]
 gi|289173151|emb|CBJ79924.1| conserved hypothetical protein; putative exported protein
           [Xenorhabdus bovienii SS-2004]
          Length = 200

 Score = 44.6 bits (104), Expect = 0.009,   Method: Composition-based stats.
 Identities = 23/147 (15%), Positives = 44/147 (29%), Gaps = 7/147 (4%)

Query: 1   MDKKLNKIIKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRH----IQ 56
           M K ++++     IS  +  +    +S C         Y L   T   +  +       Q
Sbjct: 1   MKKLMSRLAF--FISVCVFAVSSVFISGCSSSQPQKTYYQLPALTSTSQESRSGVKDERQ 58

Query: 57  LIITEPITEKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVV 116
           L +        L S  I+ ++  +         W+  L + ++  LI           + 
Sbjct: 59  LWVKGVTLADYLASPGIVYQTGDVIYVNASNHLWASPLEQQLKQVLITELSAAFPQRLIA 118

Query: 117 KPNQGIYADYQIISAIRSFEINIDRHC 143
                  AD  +   I +F    D   
Sbjct: 119 GQPLEKNAD-TLDITITAFHGRYDGKV 144


>gi|317182668|dbj|BAJ60452.1| hypothetical protein HPF57_1378 [Helicobacter pylori F57]
          Length = 225

 Score = 44.6 bits (104), Expect = 0.010,   Method: Composition-based stats.
 Identities = 28/124 (22%), Positives = 52/124 (41%), Gaps = 5/124 (4%)

Query: 15  SCSLAVLLCTSLSSCFFHNNP-VNIYDLTESTKYDESVQRH-IQLIITEPITEKILNSED 72
           S +LA+LL   LS       P +  YDL  S+       +  I++ +   ++  + N+++
Sbjct: 12  SSALALLLQGCLSINLKQMLPEIRTYDLNASSFETTQCPKPLIEVRLISILSADLFNTKE 71

Query: 73  IIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYAD-YQIISA 131
           I+ ++   +I +    +W D    M++   +   E       V  P  G  A  Y +   
Sbjct: 72  IVFKAQDGQITHGKHQKWIDLPRNMLKTMFMQ--EAQKACLGVALPPYGAGAPTYAVRFT 129

Query: 132 IRSF 135
           I SF
Sbjct: 130 ILSF 133


>gi|320353357|ref|YP_004194696.1| hypothetical protein Despr_1240 [Desulfobulbus propionicus DSM
           2032]
 gi|320121859|gb|ADW17405.1| protein of unknown function DUF330 [Desulfobulbus propionicus DSM
           2032]
          Length = 199

 Score = 44.2 bits (103), Expect = 0.010,   Method: Composition-based stats.
 Identities = 28/189 (14%), Positives = 66/189 (34%), Gaps = 6/189 (3%)

Query: 13  IISCSLAVLLCTSLSSCFFHNNPVNIYDL--TESTKYDESVQRHIQLIITEPITEKILNS 70
           ++  +   L   SL+ C   +  V+ Y L  T+        ++ + +++       +L +
Sbjct: 7   LLGLAAFGLFLGSLTGCSPVSPQVSYYSLLDTQRPPSVAGARQSLAILVGPVSVPDLLKT 66

Query: 71  EDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANF-ENNGKISTVVKPNQG-IYADYQI 128
             I    +    Q     +W  ++ R     +        G     + P    + A  Q+
Sbjct: 67  SQIA-TGTAERYQLAEQHRWVSQVDRDFARAIGEQLASRLGTERIALYPQDQYLAAPLQV 125

Query: 129 ISAIRSFEINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAF 188
           +  I + E  +    A +T+   ++     +    +     E+    +   ++ +  R  
Sbjct: 126 VVDILAMEGTL-GQEARLTVRWSLVATKSKTARLTRRSTFSERPADSSHGAWVAAQRRNI 184

Query: 189 SRISSEIID 197
           SR+S EI  
Sbjct: 185 SRLSEEIAA 193


>gi|293606223|ref|ZP_06688586.1| lipoprotein [Achromobacter piechaudii ATCC 43553]
 gi|292815370|gb|EFF74488.1| lipoprotein [Achromobacter piechaudii ATCC 43553]
          Length = 215

 Score = 44.2 bits (103), Expect = 0.010,   Method: Composition-based stats.
 Identities = 28/179 (15%), Positives = 64/179 (35%), Gaps = 7/179 (3%)

Query: 32  HNNPVNIYDLT--ESTKYDESVQRHIQLIITEPITEKI-LNSEDIIVRSSPIEIQYLIGS 88
            + PV+ Y L    +            LI  +P++     +   ++VR+    +  L   
Sbjct: 24  SSPPVHYYTLQGPAAPSTAAPAGSAGFLIEVQPVSLSTQADQPQLMVRTGDGSVSALYSE 83

Query: 89  QWSDKLPRMIQLKLIANFENN-GKISTVVKPNQGIYADYQIISAIRSFE-INIDRHCAII 146
           +WS  L   ++  L    +   G +   +         +++ + ++ FE ++        
Sbjct: 84  RWSSPLGDELRGALSDALKGELGALDVQMVKPGPAAPVWRVQTDVQRFEMVSGSMAQLDA 143

Query: 147 TMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEIIDWTLSSLPL 205
           T  ++ +NA     + + V  V EK+ +      I +  RA   ++  +        P 
Sbjct: 144 TWRVRPVNAKGAGQLCRSV--VTEKVTETGIPALIAAQQRAVVALAGAMASAIRGQTPA 200


>gi|26991589|ref|NP_747014.1| hypothetical protein PP_4911 [Pseudomonas putida KT2440]
 gi|24986678|gb|AAN70478.1|AE016689_6 conserved hypothetical protein [Pseudomonas putida KT2440]
 gi|313500890|gb|ADR62256.1| Hypothetical protein, conserved [Pseudomonas putida BIRD-1]
          Length = 251

 Score = 44.2 bits (103), Expect = 0.010,   Method: Composition-based stats.
 Identities = 24/164 (14%), Positives = 58/164 (35%), Gaps = 5/164 (3%)

Query: 34  NPVNIYDLTESTKYDESVQRHIQLIITEPITEKILNSEDIIVRSSPIEIQYLIGSQWSDK 93
            PV +Y L        S    + +++        L  E  + R     +      +W+  
Sbjct: 40  QPVALYQLDSGDPGQPSQSAGMAVVLGPVSVADYLQRETFLQRQPDGSLSAATDGRWAGS 99

Query: 94  LPRMIQLKLIANFE-NNGKISTVVKPNQ-GIYADYQIISAIRSFEINIDRHCAIITMSLK 151
           L   I   L+            V+ P   G   D Q++ +I   +       AI+    +
Sbjct: 100 LSSDIDQLLVRQLAWRLDSQRVVLAPATAGFSPDVQVLLSITRLDS-GKNQPAILDAQWR 158

Query: 152 IINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEI 195
           +++     +   ++ H+E++ E       +Q+  +   +++ ++
Sbjct: 159 LLDRR-GHVRDNRIIHLEQQHEGSE-SSQVQAQGQLLQKLAEQL 200


>gi|33597163|ref|NP_884806.1| lipoprotein [Bordetella parapertussis 12822]
 gi|33566614|emb|CAE37872.1| lipoprotein [Bordetella parapertussis]
          Length = 222

 Score = 44.2 bits (103), Expect = 0.011,   Method: Composition-based stats.
 Identities = 32/196 (16%), Positives = 71/196 (36%), Gaps = 11/196 (5%)

Query: 9   IKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTES--TKYDESVQRHIQLIIT-EPITE 65
           +K  +  C+  +L+ T L+ C   + P   Y L     T+  ++     Q +I   P+  
Sbjct: 1   MKSTVARCA-PLLIATILAGCG-ASPPARYYTLQPPGATQAVQAGVAPAQFMIEILPVNV 58

Query: 66  KI-LNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENN-GKISTVVKPNQGIY 123
               +   ++VR+    +  L   +WS  LP   +  L        G     V       
Sbjct: 59  PAQADQPQLMVRTGDGTVAPLYSERWSAPLPDEFRAALSDTLTRELGAPDVQVIKPASGT 118

Query: 124 ADYQIISAIRSFEINIDRHCAI-ITMSLKIINAHDNSLVGQKVFHVEEKLEKD-NKLHFI 181
             +++   ++ F++       +  T  ++ +N    +LV      V+     + +    +
Sbjct: 119 PVWRVQVDVQRFDLVAGGPSLLDATWRVRPVNLAAPALVC--RTRVDVPAGGERDTAALV 176

Query: 182 QSLNRAFSRISSEIID 197
           Q+  R  + ++  I  
Sbjct: 177 QAQQRGTALLARTIAS 192


>gi|58040552|ref|YP_192516.1| hypothetical protein GOX2124 [Gluconobacter oxydans 621H]
 gi|58002966|gb|AAW61860.1| Putative outer membrane protein [Gluconobacter oxydans 621H]
          Length = 188

 Score = 43.8 bits (102), Expect = 0.013,   Method: Composition-based stats.
 Identities = 25/167 (14%), Positives = 56/167 (33%), Gaps = 7/167 (4%)

Query: 14  ISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQ---LIITEPITEKILNS 70
           ++ S A+L    +S C     P+  Y L        S         L ++       L+S
Sbjct: 1   MTRSAALLAFALMSGCAAP--PMQFYTLGAPAIAQNSGTLPASAPVLNVSHVTLPDYLDS 58

Query: 71  EDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIIS 130
           +DI++R    ++      +W  +L + +   L A+   +     V           ++  
Sbjct: 59  QDILIR-QGDQLDRSPNGRWGSRLSQGVTDLLAAHLGQDWPGYVVTTQPLAETPALRLAV 117

Query: 131 AIRSFEINIDRHCAIITMSLKIINAHDNSLVGQK-VFHVEEKLEKDN 176
            I   +++     A+      I +     +   +  F  +  +  D+
Sbjct: 118 NISRLDLDSSGQGALTADWALIPSDEHQPIQRSRGSFTAQGTVTTDS 164


>gi|330501587|ref|YP_004378456.1| hypothetical protein MDS_0673 [Pseudomonas mendocina NK-01]
 gi|328915873|gb|AEB56704.1| hypothetical protein MDS_0673 [Pseudomonas mendocina NK-01]
          Length = 240

 Score = 43.8 bits (102), Expect = 0.013,   Method: Composition-based stats.
 Identities = 23/173 (13%), Positives = 63/173 (36%), Gaps = 6/173 (3%)

Query: 27  SSC-FFHNNPVNIYDLTESTKYDESVQRHIQLIITEPITEKILNSEDIIVRSSPIEIQYL 85
           S C      PV +Y L        +    + +++        L  + ++ R +   +   
Sbjct: 19  SGCSLLQQKPVPLYQLDSGDAVTPTKDNGVTVLVGPISVADYLRQQHLLQRQADGSLVAT 78

Query: 86  IGSQWSDKLPRMIQLKLIANFE-NNGKISTVVKPNQ-GIYADYQIISAIRSFEINIDRHC 143
             ++W+  L   I  +++            V+ P   G  AD Q++  I   +    +  
Sbjct: 79  QDARWASGLANDIDQQMLRQLAWRLDSQRLVLAPAAPGFSADAQVMLTITRLDSGPTQP- 137

Query: 144 AIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEII 196
           A++    ++++     L   ++  +E+          +++ +    R+++E+ 
Sbjct: 138 AVLEAQWRLLDRR-GQLRDSRLIRLEQPHGGP-LAEQVKAQSTLLQRLAAEMA 188


>gi|291481511|ref|YP_586223.2| hypothetical protein Rmet_4087 [Cupriavidus metallidurans CH34]
 gi|288237351|gb|ABF10954.2| conserved exported protein of unknown function [Cupriavidus
           metallidurans CH34]
          Length = 188

 Score = 43.8 bits (102), Expect = 0.014,   Method: Composition-based stats.
 Identities = 31/185 (16%), Positives = 64/185 (34%), Gaps = 13/185 (7%)

Query: 19  AVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIITEPITEKIL-NSEDIIVRS 77
           +V L   L+ C         Y L      + +       ++  P+T   L +   I+ R 
Sbjct: 3   SVALIGLLAGCSSPK--SRFYTLDPDNTVERASTATPIRVVVGPVTIPDLVDRPQIVTRV 60

Query: 78  SPIEIQYLIGSQWSDKLPRMIQLKL---IANFENNGKISTVVKPNQGIYADYQIISAIRS 134
           S  E++    ++W++ L   I   +   +     + ++ TV          +++   I S
Sbjct: 61  SANEVKVNEFARWAEPLKSEISQVIAADLRTMLGSDQV-TVFDTGSNAMPAWRVRVDILS 119

Query: 135 FEINIDRHCAIITMSL--KIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRIS 192
            +         ++M     I        +  +   V E +  D     I + NRA + +S
Sbjct: 120 LDSE---PAVAVSMDALWTIQPPGKQPAIAGRSV-VREAVASDGFDAIIAAHNRALASVS 175

Query: 193 SEIID 197
            +I  
Sbjct: 176 RDIAT 180


>gi|260597350|ref|YP_003209921.1| lipoprotein YmbA [Cronobacter turicensis z3032]
 gi|260216527|emb|CBA29724.1| Uncharacterized lipoprotein ymbA [Cronobacter turicensis z3032]
          Length = 187

 Score = 43.8 bits (102), Expect = 0.014,   Method: Composition-based stats.
 Identities = 31/181 (17%), Positives = 68/181 (37%), Gaps = 8/181 (4%)

Query: 20  VLLCTSLSSCFFHNNPVNIYDLTEST-KYDESVQRHIQ--LIITEPITEKILNSEDIIVR 76
            L+  +L S          Y L  ST     S   + Q  L + +      L    ++ +
Sbjct: 6   PLVAVALLSACSSTEETTWYQLPASTAPVAHSASMNSQHLLWVEQVSVPDYLAGNGVVYQ 65

Query: 77  SSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFE 136
           ++ ++      + W+  L + ++  L+ N         V     G   D  +   +  F 
Sbjct: 66  TTDVQYVIASQNLWASPLDQQLRNTLVTNLSATLPGWVVSAQPLGAEQD-TLNVNVTGFH 124

Query: 137 INIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEII 196
              D     + +S + +  H   L+ ++ F+ E K ++D     +++L +A+ + +  I 
Sbjct: 125 GRYDG---RVIVSGEWLLKHKGQLI-KRPFYTELKQQEDGYDAMVKTLAQAWQQQAKTIA 180

Query: 197 D 197
           D
Sbjct: 181 D 181


>gi|330828284|ref|YP_004391236.1| lipoprotein [Aeromonas veronii B565]
 gi|328803420|gb|AEB48619.1| Lipoprotein [Aeromonas veronii B565]
          Length = 189

 Score = 43.8 bits (102), Expect = 0.014,   Method: Composition-based stats.
 Identities = 20/164 (12%), Positives = 60/164 (36%), Gaps = 6/164 (3%)

Query: 36  VNIYDLTESTKYD-ESVQRHIQLIITEPITEKI-LNSEDIIVRSSPIEIQYLIGSQWSDK 93
           ++ Y L   ++    +  +    ++  P+     L+   ++ +    E+ +    +W+  
Sbjct: 23  LHYYSLDADSQQPVTAPAKPQHQLVLRPVALASQLDRISLVYQLEGQELHFTEYHRWAGA 82

Query: 94  LPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFEINIDRHCAIITMSLKII 153
           L   +    +     + ++   V    G      +   +  F+   D   A+++   +++
Sbjct: 83  LDDQLNRLTLNGL--STRLPGWVVRQDGARKGPVLTILVERFQGRHDG-SAMLSGRWRLL 139

Query: 154 NAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEIID 197
            A D +++    F  E  L  D     +  L + + ++  +I  
Sbjct: 140 -AEDGTVLRDAPFRQERVLPADGYNALVNELGQGWQQLLDQIAA 182


>gi|121592687|ref|YP_984583.1| putative lipoprotein [Acidovorax sp. JS42]
 gi|120604767|gb|ABM40507.1| putative lipoprotein [Acidovorax sp. JS42]
          Length = 225

 Score = 43.8 bits (102), Expect = 0.015,   Method: Composition-based stats.
 Identities = 28/214 (13%), Positives = 66/214 (30%), Gaps = 24/214 (11%)

Query: 9   IKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQL---IITEPITE 65
           I  K I C  ++ L    S         ++YD                L    + E    
Sbjct: 14  ISAKAIFCLASLALVAGCSILPEPPVRADVYDFGPGPLQAPGPAASAPLPPIALAEVTAT 73

Query: 66  KILNSE-----DIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQ 120
            +          +    +  +++    ++WS     ++   +       G+   V+  + 
Sbjct: 74  GLPEGSTALLYRLAYT-NAQQLRPYTQARWSLPPAVLLHQAVRERL---GQRRAVLSGDD 129

Query: 121 GIYADYQ-------IISAIRSFEINIDRHCA---IITMSLKIINAHDN--SLVGQKVFHV 168
           G+    +       +   +  F        A   ++ +   + +A     +LV Q+VF  
Sbjct: 130 GMAVLLERGRMPSVLRLELEEFSHVFGAPQASAGLVRVRAVLADASTAGETLVAQRVFVA 189

Query: 169 EEKLEKDNKLHFIQSLNRAFSRISSEIIDWTLSS 202
                  +     ++L  A ++++ E+  W   S
Sbjct: 190 RRDAATPDAAGGAKALADAAAQVAEELAAWVEQS 223


>gi|330890320|gb|EGH22981.1| putative lipoprotein [Pseudomonas syringae pv. mori str. 301020]
          Length = 207

 Score = 43.8 bits (102), Expect = 0.016,   Method: Composition-based stats.
 Identities = 28/182 (15%), Positives = 57/182 (31%), Gaps = 14/182 (7%)

Query: 33  NNPVNIYDLTESTKYD---ESVQRHIQLIITEPITEKILNSEDIIVRSSPIEIQYLIGSQ 89
           +   + Y L           +     Q  +   +    ++   ++VR     +  L   +
Sbjct: 21  STQTHYYTLIAPMGAASSVAARPMPFQFEMLPVLMPVQVDQPPLVVRQGNGSLAILDTER 80

Query: 90  WSDKLPRMIQLKLIANFENN-GKISTVVKPNQGIYADYQIISAIRSFEINIDRHCAIITM 148
           W   L       L    E + G       P         + + +R FE  +  + A+I +
Sbjct: 81  WGSPLGDEFHDALTPQLERHFGSRDMAGLPKNSDQPVLSVRTDVRRFES-MPGNYALIDV 139

Query: 149 SLKIINAHDNSLVGQKV-----FHVEEKLEKDNKLHFIQSLNRAFSRISSEIID----WT 199
              +      + VG K        V  +   +   + I +  +A SR++ +I      WT
Sbjct: 140 VWTLGLRDAGATVGSKRQSLTCSSVIREQAGEGMENLIIAHQKAVSRLADKIAATAASWT 199

Query: 200 LS 201
             
Sbjct: 200 AQ 201


>gi|160895817|ref|YP_001561399.1| putative lipoprotein [Delftia acidovorans SPH-1]
 gi|160361401|gb|ABX33014.1| putative lipoprotein [Delftia acidovorans SPH-1]
          Length = 222

 Score = 43.8 bits (102), Expect = 0.016,   Method: Composition-based stats.
 Identities = 23/192 (11%), Positives = 57/192 (29%), Gaps = 28/192 (14%)

Query: 4   KLNKIIKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDL-------TESTKYDESVQRHIQ 56
            L++         + A++L    S+          YD           +    + Q    
Sbjct: 2   PLSRKTAVASAGLAAALILLAGCSALPQPPAQPARYDFGLAPLSAPAQSATSAAPQARTP 61

Query: 57  LIITEPITEKILNSE-----DIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGK 111
           L + +     + +        +    +  E++    ++WS     ++Q +L +     G 
Sbjct: 62  LALADVEAPALSDGSTAMFYRLAYA-NGQELRPYQLARWSQPPALLLQQRLRSQL---GL 117

Query: 112 ISTVVKPNQGIY-------ADYQIISAIRSFE---INIDRHCAIITMSLKIINAHDN--S 159
              V+  ++ +            +   I  F            ++ +   ++        
Sbjct: 118 QRPVLASSESVAQPRLQGAVPTLLRVDIEEFSQVFYAPGSSAGVVRLRATLVEQSGAVDR 177

Query: 160 LVGQKVFHVEEK 171
           L+GQK+F V   
Sbjct: 178 LLGQKLFEVRSP 189


>gi|28870350|ref|NP_792969.1| lipoprotein [Pseudomonas syringae pv. tomato str. DC3000]
 gi|213969826|ref|ZP_03397960.1| lipoprotein [Pseudomonas syringae pv. tomato T1]
 gi|301385010|ref|ZP_07233428.1| lipoprotein, putative [Pseudomonas syringae pv. tomato Max13]
 gi|302060458|ref|ZP_07251999.1| lipoprotein, putative [Pseudomonas syringae pv. tomato K40]
 gi|302133283|ref|ZP_07259273.1| lipoprotein, putative [Pseudomonas syringae pv. tomato NCPPB 1108]
 gi|28853597|gb|AAO56664.1| lipoprotein, putative [Pseudomonas syringae pv. tomato str. DC3000]
 gi|213925374|gb|EEB58935.1| lipoprotein [Pseudomonas syringae pv. tomato T1]
 gi|331016583|gb|EGH96639.1| lipoprotein, putative [Pseudomonas syringae pv. lachrymans str.
           M302278PT]
          Length = 207

 Score = 43.4 bits (101), Expect = 0.017,   Method: Composition-based stats.
 Identities = 28/188 (14%), Positives = 59/188 (31%), Gaps = 12/188 (6%)

Query: 17  SLAVLLCTSLSSCFFHNNPVNIYDLTES---TKYDESVQRHIQLIITEPITEKILNSEDI 73
            + +     + +C   +   + Y L      T    +     Q  +   I    ++   +
Sbjct: 7   LMVLAAALGMGAC--TSTQTHYYTLIAPMGATGSAAARPAPFQFEMLPVIMPVQVDQPPL 64

Query: 74  IVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFE-NNGKISTVVKPNQGIYADYQIISAI 132
           +VR     +  L   +W   L       L    E   G       P  G      + + +
Sbjct: 65  VVRQGNGSLAILDTERWGSPLGDEFHDALTPQLERRFGSRDMAGLPKNGDQPVLSVRTDV 124

Query: 133 RSFEINIDRHCAIITMSLKIINAHDNSLVGQKV-----FHVEEKLEKDNKLHFIQSLNRA 187
           R FE  +  H A+I +   +      +  G K        V  +   +   + I +  +A
Sbjct: 125 RRFES-MPGHYALIDVVWTLGLRDAGATAGSKRQSLTCSSVIREQAAEGMENLILAHQKA 183

Query: 188 FSRISSEI 195
            + ++ +I
Sbjct: 184 VATLAEKI 191


>gi|256828142|ref|YP_003156870.1| protein of unknown function DUF330 [Desulfomicrobium baculatum DSM
           4028]
 gi|256577318|gb|ACU88454.1| protein of unknown function DUF330 [Desulfomicrobium baculatum DSM
           4028]
          Length = 204

 Score = 43.4 bits (101), Expect = 0.017,   Method: Composition-based stats.
 Identities = 30/180 (16%), Positives = 52/180 (28%), Gaps = 13/180 (7%)

Query: 28  SCFFHNNPVNIYDLTESTKYDESVQ---RHIQLIITEPITEKILNSEDIIVRSSPIEIQY 84
            C     P   Y L   T +          I + +   I   IL    I    +      
Sbjct: 24  GCAGSKTPTVYYSLYAPTLHGAEASMTDGDISVSVGPVIIPDILKQTRIATGGADGSYDL 83

Query: 85  LIGSQWSDKLPRMIQLKLIANFENNGKISTVV--KPNQGIYADYQIISAIRSFEINIDRH 142
               +WS  + R +   L  +         V     +Q     YQ++  +  F       
Sbjct: 84  TEYHRWSGDVDRDLARALAEHLAQALGTQRVSVFPWDQDFTPTYQVLVDVL-FMGGEPGG 142

Query: 143 CAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQS-------LNRAFSRISSEI 195
            AI++    IIN         +   + E     +   ++ +       L  A ++  SEI
Sbjct: 143 EAILSARWNIINKAGKEGSSTRRIDLREVSAGPDVAQWVAAQQLNVEKLGEAIAQTISEI 202


>gi|238919297|ref|YP_002932812.1| hypothetical protein NT01EI_1387 [Edwardsiella ictaluri 93-146]
 gi|238868866|gb|ACR68577.1| conserved hypothetical protein [Edwardsiella ictaluri 93-146]
          Length = 188

 Score = 43.4 bits (101), Expect = 0.017,   Method: Composition-based stats.
 Identities = 26/185 (14%), Positives = 70/185 (37%), Gaps = 10/185 (5%)

Query: 17  SLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHI----QLIITEPITEKILNSED 72
            + +L   +LS+C   +   + Y L  ++    SV R +    QL +       +L    
Sbjct: 4   GMILLAVLALSACSVGSQ-KSYYQLPTTSAATTSVSRTVSQGHQLWVQPVSVTDLLGGMG 62

Query: 73  IIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAI 132
           ++ + + ++      + W+  L + +   L+A          V      +  D  +   I
Sbjct: 63  VVYQQNDVQFVTASNNLWASPLAQQLTQSLVAGLSAGMPGWLVSAQPLEMGQD-TLTVNI 121

Query: 133 RSFEINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRIS 192
            +F    D     + ++ + + +    ++ QK FH+    + +     +++L + + +  
Sbjct: 122 NAFYGRYDGK---VVVAGEWLLSRQG-MLTQKTFHIVLPQQGNGYDALVRTLAQGWQQEI 177

Query: 193 SEIID 197
           + +  
Sbjct: 178 ASMAG 182


>gi|330991779|ref|ZP_08315729.1| hypothetical protein SXCC_01685 [Gluconacetobacter sp. SXCC-1]
 gi|329761247|gb|EGG77741.1| hypothetical protein SXCC_01685 [Gluconacetobacter sp. SXCC-1]
          Length = 178

 Score = 43.4 bits (101), Expect = 0.017,   Method: Composition-based stats.
 Identities = 23/165 (13%), Positives = 52/165 (31%), Gaps = 10/165 (6%)

Query: 38  IYDLTESTKYDE---SVQRHIQLIITEPITEKILNSEDIIVRSSPIEIQYLIGSQWSDKL 94
           +Y L       +     Q    + +  P     L+ ++I+       +  L G+ WS+ L
Sbjct: 1   MYSLAPIAGTQQVGMGGQVPAVIEVRTPGVPPSLDRQNIVGTQDDYSLTPLAGAAWSEPL 60

Query: 95  PRMIQLKLIANFENNGKISTVVKPNQGIYADYQ--IISAIRSFEINIDRHCAIITMSLKI 152
             M+   L  + +       V   N       Q  +   I  F  +      ++ +   +
Sbjct: 61  APMLGHVLATDLQQRLPGHGVFAQNDATTVPPQGFVEVEITRFARDASG---VVHLGGSL 117

Query: 153 INAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEIID 197
                     +    V   L         +++  A S+++ ++ D
Sbjct: 118 SVHRVGD--AEHALSVPLALSATPTDSGTRAMVAALSQLTGQVAD 160


>gi|330965857|gb|EGH66117.1| lipoprotein [Pseudomonas syringae pv. actinidiae str. M302091]
          Length = 207

 Score = 43.4 bits (101), Expect = 0.018,   Method: Composition-based stats.
 Identities = 28/190 (14%), Positives = 58/190 (30%), Gaps = 12/190 (6%)

Query: 17  SLAVLLCTSLSSCFFHNNPVNIYDLTESTKYD---ESVQRHIQLIITEPITEKILNSEDI 73
            + +     + +C   +   + Y L           +     Q  +   I    ++   +
Sbjct: 7   LMVLAAALGMGAC--TSTQTHYYTLIAPMGAASNSAARPAPFQFEMLPVIMPVQVDQPPL 64

Query: 74  IVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFE-NNGKISTVVKPNQGIYADYQIISAI 132
           +VR     +  L   +W   L       L    E   G       P  G      + + +
Sbjct: 65  VVRQGNGSLAILDTERWGSPLGDEFHDALTPQLEHRFGSRDMAGLPKNGDQPVLSVRTDV 124

Query: 133 RSFEINIDRHCAIITMSLKIINAHDNSLVGQKV-----FHVEEKLEKDNKLHFIQSLNRA 187
           R FE  +  H A+I +   +      +  G K        V  +   +   + I +  +A
Sbjct: 125 RRFES-MPGHYALIDVVWTLGLREAGATAGSKRQSLTCSSVIREQAAEGMENLILAHQKA 183

Query: 188 FSRISSEIID 197
            S ++ +I  
Sbjct: 184 VSTLAEKIAA 193


>gi|296117258|ref|ZP_06835850.1| hypothetical protein GXY_15619 [Gluconacetobacter hansenii ATCC
           23769]
 gi|295976211|gb|EFG82997.1| hypothetical protein GXY_15619 [Gluconacetobacter hansenii ATCC
           23769]
          Length = 211

 Score = 43.4 bits (101), Expect = 0.019,   Method: Composition-based stats.
 Identities = 30/208 (14%), Positives = 70/208 (33%), Gaps = 10/208 (4%)

Query: 1   MDKKLNKIIKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIIT 60
           M + L+ +     +  +   L   +       ++   +Y L   T+     Q    + + 
Sbjct: 1   MTQPLSILPFAPALRRAALALAAATPLLAGCGSSDPTLYSL-APTQGSTVGQAPAVIEVR 59

Query: 61  EPITEKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENN--GKISTVVKP 118
            P     L+ + I+ + +   +  L G+ WS+ L +MI   L A+ +    G        
Sbjct: 60  TPGVPPTLDRDHIVGQQANYSLTTLSGAAWSEPLSQMIGETLTADLQQRLPGSSIFAQNN 119

Query: 119 NQGIYADYQIISAIRSFEINIDRHCAIITMSLKII--NAHDNSLVGQKVFHVEEKLEKDN 176
              + A   +   +  F  +       + +S  +    A D      + F +        
Sbjct: 120 ATSMPAKAFVELDVTQFARDASGQ---VRLSGTLSVHRAGDAQGGTAQAFILTTP-SGGG 175

Query: 177 KLHFIQSLNRAFSRISSEIIDWTLSSLP 204
            +  +  L++   +++       L +LP
Sbjct: 176 AVAMVAGLSQLLGQVADSAAQ-RLQTLP 202


>gi|220904328|ref|YP_002479640.1| protein of unknown function DUF330 [Desulfovibrio desulfuricans
           subsp. desulfuricans str. ATCC 27774]
 gi|219868627|gb|ACL48962.1| protein of unknown function DUF330 [Desulfovibrio desulfuricans
           subsp. desulfuricans str. ATCC 27774]
          Length = 198

 Score = 43.4 bits (101), Expect = 0.020,   Method: Composition-based stats.
 Identities = 28/195 (14%), Positives = 73/195 (37%), Gaps = 15/195 (7%)

Query: 9   IKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDL-TESTKYDESVQRHIQLIITEPITEKI 67
           +++  +   +A ++  +  S    + P N Y L +  T           L +      + 
Sbjct: 1   MQRYALYTLMAFVVLMAACS---RSTPTNYYLLESRLTPVSAESLPGKSLRVAPVTVPEY 57

Query: 68  LNSEDIIVRSSPI-EIQYLIGSQWSDKLP----RMIQLKLIANFENNGKISTVVKPNQGI 122
           L+ + I+ R     ++       W++ L     R+ +  L     +NG    V+      
Sbjct: 58  LDRDGIVSRVGESTQLVVAQFHSWAEPLSHGVRRVTREVLTRPMLDNGI--NVLPAGDES 115

Query: 123 YADYQIISAIRSFEINIDRHCAIITMSLK-IINAHDNSLVGQKVFHVEEKLEKDNKLHFI 181
            ADY +   ++  + N D+      + ++  + +  N ++ + ++  EE +   +     
Sbjct: 116 TADYVLYLDVQRLDGNFDQKAV---LDVRWTLRSKYNDVLARGIYVDEEDVAGKSYDILT 172

Query: 182 QSLNRAFSRISSEII 196
            + +R   R++  + 
Sbjct: 173 AAESRMVQRMAEHLT 187


>gi|33593710|ref|NP_881354.1| lipoprotein [Bordetella pertussis Tohama I]
 gi|33563783|emb|CAE43025.1| lipoprotein [Bordetella pertussis Tohama I]
          Length = 222

 Score = 43.4 bits (101), Expect = 0.021,   Method: Composition-based stats.
 Identities = 29/196 (14%), Positives = 64/196 (32%), Gaps = 11/196 (5%)

Query: 9   IKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTES----TKYDESVQRHIQLIITEPIT 64
           +K  +  C+  +L+ T L+ C   + P   Y L                   + I     
Sbjct: 1   MKSTVARCA-PLLIATILAGCG-ASPPARYYTLQPPGATQAVQAGVAAAPFMIEILPVNV 58

Query: 65  EKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENN-GKISTVVKPNQGIY 123
               +   ++VR+    +  L   +WS  LP   +  L        G     V       
Sbjct: 59  PAQADQPQLMVRTGDGTVAPLYSERWSAPLPDEFRAALSDTLTRELGAPDVQVIKPASGT 118

Query: 124 ADYQIISAIRSFEINIDRHCAI-ITMSLKIINAHDNSLVGQKVFHVEEKLEKD-NKLHFI 181
             +++   ++ F++       +  T  ++ +N    +LV      V+     + +    +
Sbjct: 119 PVWRVQVDVQRFDLVAGGPSLLDATWRVRPVNLVAPALVC--RTRVDVPAGGERDTAALV 176

Query: 182 QSLNRAFSRISSEIID 197
           Q+  R  + ++  I  
Sbjct: 177 QAQQRGTALLARTIAS 192


>gi|289627428|ref|ZP_06460382.1| putative lipoprotein [Pseudomonas syringae pv. aesculi str.
           NCPPB3681]
 gi|289646131|ref|ZP_06477474.1| putative lipoprotein [Pseudomonas syringae pv. aesculi str. 2250]
 gi|298486742|ref|ZP_07004798.1| hypothetical protein PSA3335_2185 [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
 gi|298158609|gb|EFH99673.1| hypothetical protein PSA3335_2185 [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
          Length = 207

 Score = 43.0 bits (100), Expect = 0.022,   Method: Composition-based stats.
 Identities = 27/182 (14%), Positives = 56/182 (30%), Gaps = 14/182 (7%)

Query: 33  NNPVNIYDLTESTKYD---ESVQRHIQLIITEPITEKILNSEDIIVRSSPIEIQYLIGSQ 89
           +   + Y L           +     Q  +   +    ++   ++VR     +  L   +
Sbjct: 21  STQTHYYTLIAPMGAASSVAARPMPFQFEMLPVLMPVQVDQPPLVVRQGNGSLAILDTER 80

Query: 90  WSDKLPRMIQLKLIANFENN-GKISTVVKPNQGIYADYQIISAIRSFEINIDRHCAIITM 148
           W   L       L    E + G       P         + + +R FE  +  + A+I +
Sbjct: 81  WGSPLGDEFHDALTPQLERHFGSRDMAGLPKNSDQPVLSVRTDVRRFES-MPGNYALIDV 139

Query: 149 SLKIINAHDNSLVGQKV-----FHVEEKLEKDNKLHFIQSLNRAFSRISSEIID----WT 199
              +      +  G K        V  +   +   + I +  +A SR++ +I      WT
Sbjct: 140 VWTLGLRDAGATAGSKRQSLTCSSVIREQAGEGMENLIIAHQKAVSRLADKIAATAASWT 199

Query: 200 LS 201
             
Sbjct: 200 AQ 201


>gi|330958335|gb|EGH58595.1| putative lipoprotein [Pseudomonas syringae pv. maculicola str.
           ES4326]
          Length = 207

 Score = 43.0 bits (100), Expect = 0.023,   Method: Composition-based stats.
 Identities = 27/182 (14%), Positives = 58/182 (31%), Gaps = 12/182 (6%)

Query: 25  SLSSCFFHNNPVNIYDLTES---TKYDESVQRHIQLIITEPITEKILNSEDIIVRSSPIE 81
            +S+C   +   + Y L           +     Q  +   +    ++   ++VR     
Sbjct: 15  GISAC--TSTQTHYYTLIAPMGTATTAAASPMPFQFEMLPVLMPVQVDQPPLVVRQGNGS 72

Query: 82  IQYLIGSQWSDKLPRMIQLKLIANFE-NNGKISTVVKPNQGIYADYQIISAIRSFEINID 140
           +  L   +W   L       L    E   G       P  G      + + +R FE  + 
Sbjct: 73  LAILDTERWGSPLGDEFHDALTPQLEHRFGSRDMAGLPKNGEQPVLSVRTDVRRFES-MP 131

Query: 141 RHCAIITMSLKIINAHDNSLVGQKV-----FHVEEKLEKDNKLHFIQSLNRAFSRISSEI 195
            + A+I +   +      +  G K        V  +   +   + I +  +A +R++ +I
Sbjct: 132 GNYALIDVVWTLGLREAGATAGSKRQSLTCSSVIREQAGEGMENLIIAHQKAVARLADKI 191

Query: 196 ID 197
             
Sbjct: 192 AT 193


>gi|170721754|ref|YP_001749442.1| hypothetical protein PputW619_2579 [Pseudomonas putida W619]
 gi|169759757|gb|ACA73073.1| protein of unknown function DUF330 [Pseudomonas putida W619]
          Length = 191

 Score = 43.0 bits (100), Expect = 0.024,   Method: Composition-based stats.
 Identities = 16/174 (9%), Positives = 56/174 (32%), Gaps = 16/174 (9%)

Query: 20  VLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIITEPITEKILNSEDIIVRSSP 79
           ++   +L +C   ++P+  + LT +           +++I        ++   +++R   
Sbjct: 17  LIALMALGAC--RSDPIQFHTLTPAQPAPSFHTAPDEILIEGVNVPPQVDRPQLVIRQGD 74

Query: 80  IEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFEINI 139
             +  L    W   L   ++  L+    N      +            +   ++ F+  +
Sbjct: 75  SSLAILETQWWGATLVDELRSALVDQLSNTRPARKLS-----------LRVDVQRFDS-V 122

Query: 140 DRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISS 193
               A++    ++     N+ +  +     +     +    + +      R+ +
Sbjct: 123 PGQYALLDARWRLRARDANTQLSCR--STLQTAAGSSIDDVVIAQQANVKRLVA 174


>gi|15612421|ref|NP_224074.1| hypothetical protein jhp1356 [Helicobacter pylori J99]
 gi|4155968|gb|AAD06932.1| putative [Helicobacter pylori J99]
          Length = 225

 Score = 43.0 bits (100), Expect = 0.024,   Method: Composition-based stats.
 Identities = 27/124 (21%), Positives = 51/124 (41%), Gaps = 5/124 (4%)

Query: 15  SCSLAVLLCTSLSSCFFHNNP-VNIYDLTESTKYDESVQRHIQ-LIITEPITEKILNSED 72
           S +LA+LL   LS       P +  YDL  S+       + +  + +   ++  + N+++
Sbjct: 12  SSALALLLQGCLSINLKQMLPEIRTYDLNASSFEMTQCPKPLTEVRLISILSADLFNTKE 71

Query: 73  IIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYAD-YQIISA 131
           I+ ++   +I +    +W D    M++   +   E       V  P  G  A  Y +   
Sbjct: 72  IVFKAQDGQITHGKHQKWIDLPRNMLKTMFMQ--EAQKACLGVALPPYGAGAPTYAVRFT 129

Query: 132 IRSF 135
           I SF
Sbjct: 130 ILSF 133


>gi|300705036|ref|YP_003746639.1| hypothetical protein RCFBP_20873 [Ralstonia solanacearum CFBP2957]
 gi|299072700|emb|CBJ44053.1| conserved exported protein of unknown function [Ralstonia
           solanacearum CFBP2957]
          Length = 218

 Score = 43.0 bits (100), Expect = 0.025,   Method: Composition-based stats.
 Identities = 17/140 (12%), Positives = 50/140 (35%), Gaps = 3/140 (2%)

Query: 9   IKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIITEPITEKIL 68
            +   +  +        + +C      ++   L       E+ +      ++     + L
Sbjct: 7   TRASSLRLACVAGAAALMGACASPEPTLHTLSLRAEPPAPETARIQRAFRLSGVRVPERL 66

Query: 69  NSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVV--KPNQGIYADY 126
           +   I++R+S  ++Q L   +W+      ++  L A+  +      V    P  G+   Y
Sbjct: 67  DKPQIVLRTSDSQVQELEQQRWAAPFGAELRDALSADLADALSAVDVGGATPPAGV-PLY 125

Query: 127 QIISAIRSFEINIDRHCAII 146
           +I + ++  +    +  + +
Sbjct: 126 RIGADVQRLDARPGQDVSAL 145


>gi|146305635|ref|YP_001186100.1| hypothetical protein Pmen_0600 [Pseudomonas mendocina ymp]
 gi|145573836|gb|ABP83368.1| protein of unknown function DUF330 [Pseudomonas mendocina ymp]
          Length = 241

 Score = 43.0 bits (100), Expect = 0.027,   Method: Composition-based stats.
 Identities = 23/173 (13%), Positives = 63/173 (36%), Gaps = 6/173 (3%)

Query: 27  SSC-FFHNNPVNIYDLTESTKYDESVQRHIQLIITEPITEKILNSEDIIVRSSPIEIQYL 85
           S C      PV +Y L        +    + +++        L  + ++ R     +   
Sbjct: 19  SGCSLLQQKPVPLYQLDSGDAVTPTKDTGMAVLVGPISVADYLRQQHLLQRQPDGSLVAA 78

Query: 86  IGSQWSDKLPRMIQLKLIA--NFENNGKISTVVKPNQGIYADYQIISAIRSFEINIDRHC 143
             ++W+  L   I  +++    +    +   +     G  AD Q++  I   +    +  
Sbjct: 79  PEARWASGLANDIDQQMLRQLAWRLESQRLALAPAAPGFNADAQVMLTITRLDSGPTQP- 137

Query: 144 AIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEII 196
           AI+    ++++  +  L   ++  +EE          +++ +    R+++E+ 
Sbjct: 138 AILEAQWRLLD-RNGQLRDSRLIRMEEAHGGP-LAEQVKAQSALLQRLAAELA 188


>gi|308183562|ref|YP_003927689.1| hypothetical protein HPPC_07155 [Helicobacter pylori PeCan4]
 gi|308065747|gb|ADO07639.1| hypothetical protein HPPC_07155 [Helicobacter pylori PeCan4]
          Length = 225

 Score = 43.0 bits (100), Expect = 0.027,   Method: Composition-based stats.
 Identities = 27/124 (21%), Positives = 51/124 (41%), Gaps = 5/124 (4%)

Query: 15  SCSLAVLLCTSLSSCFFHNNP-VNIYDLTESTKYDESVQRHIQ-LIITEPITEKILNSED 72
           S +LA+LL   LS       P +  YDL  S+       + +  + +   ++  + N+++
Sbjct: 12  SSALALLLHGCLSINLKQMLPEIRTYDLNASSFEIAQCPKPLTEVRLISILSADLFNTKE 71

Query: 73  IIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYAD-YQIISA 131
           I+ ++   +I +    +W D    M++   +   E       V  P  G  A  Y +   
Sbjct: 72  IVFKAKDGQITHGKHQKWIDLPRNMLKTMFMQ--EAQKACLGVALPPYGAGAPTYAVRFT 129

Query: 132 IRSF 135
           I SF
Sbjct: 130 ILSF 133


>gi|242239091|ref|YP_002987272.1| hypothetical protein Dd703_1653 [Dickeya dadantii Ech703]
 gi|242131148|gb|ACS85450.1| protein of unknown function DUF330 [Dickeya dadantii Ech703]
          Length = 185

 Score = 43.0 bits (100), Expect = 0.028,   Method: Composition-based stats.
 Identities = 29/168 (17%), Positives = 60/168 (35%), Gaps = 9/168 (5%)

Query: 27  SSCFFHNNPVNIYDLTESTKYDE--SVQRHIQLIITEPITEKILNSEDIIVRSSPIEIQY 84
            +C       N Y L   T      S     QL++        L    I+ ++S +    
Sbjct: 14  GACSSPQK--NYYQLPAVTASSAVVSKTSGRQLLVAPVTLTDALAGNGIVFQTSDVRYTL 71

Query: 85  LIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFEINIDRHCA 144
              +QW+  L + +QL L+     +G     V  +        +   + +F+   D    
Sbjct: 72  TTQNQWASPLDQQLQLALLTA-LRSGLPGWDVTTSGAGATPVTLQVNVTAFQGRFDGRA- 129

Query: 145 IITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRIS 192
            I     ++      +   + F+VE  L +D     +++L + + ++S
Sbjct: 130 -IVRGEWVLRDKSRVV--TQPFNVEVSLHEDGYDALVKALAQGWQQVS 174


>gi|209515076|ref|ZP_03263945.1| protein of unknown function DUF330 [Burkholderia sp. H160]
 gi|209504702|gb|EEA04689.1| protein of unknown function DUF330 [Burkholderia sp. H160]
          Length = 199

 Score = 42.6 bits (99), Expect = 0.028,   Method: Composition-based stats.
 Identities = 30/212 (14%), Positives = 64/212 (30%), Gaps = 36/212 (16%)

Query: 11  KKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTE-STKYDESVQRHIQLIITEPITEKILN 69
            +  +C + V     L +C       N Y L+   +       R I  +I       +++
Sbjct: 6   ARFTACLMLVFTGALLGACKSPAT--NFYTLSPDGSLSSTGASRPIAAVIGPVTIPAVVD 63

Query: 70  SEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYAD---- 125
              I+ R+   E+      +W+  L              +G I  V+  + G   +    
Sbjct: 64  RPQIVTRTGDNEVAVNEFDRWAQPL--------------DGDIGRVIAADVGALLNSPEV 109

Query: 126 ------------YQIISAIRSFEINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLE 173
                       + +   +  F+    R   +  +   +        V  +     E + 
Sbjct: 110 SVYDAVRDPSIVWHVRIDVMRFDSVPGRDVTVDVLWA-VRPPGKGRAVTGRSV-AHETVS 167

Query: 174 KDNKLHFIQSLNRAFSRISSEIIDWTLSSLPL 205
                  I + +RA + +S +I    + S P 
Sbjct: 168 GPGIDPLIAAHDRALASVSRDIAA-AVQSHPA 198


>gi|330807213|ref|YP_004351675.1| Conserved hypothetical protein; putative exported protein
           [Pseudomonas brassicacearum subsp. brassicacearum
           NFM421]
 gi|327375321|gb|AEA66671.1| Conserved hypothetical protein; putative exported protein
           [Pseudomonas brassicacearum subsp. brassicacearum
           NFM421]
          Length = 234

 Score = 42.6 bits (99), Expect = 0.030,   Method: Composition-based stats.
 Identities = 26/167 (15%), Positives = 65/167 (38%), Gaps = 9/167 (5%)

Query: 33  NNPVNIYDLTESTKYDESVQRHIQLIITEPITEKILNSEDIIVRSSPIEIQYLIGSQWSD 92
           N PV++Y L   T    +    + +++   +    L  E ++ R     +Q     +W+ 
Sbjct: 23  NQPVSLYQLDSGTPAQPAQSTGMAVLLGPVLIADYLQRETLLQRQPDGSLQAATDGRWAG 82

Query: 93  KLPRMIQLKLIANFENNGKIST----VVKPNQGIYADYQIISAIRSFEINIDRHCAIITM 148
            L   I   L+   +  G + +    +    QG   D Q++ +I   +       A++  
Sbjct: 83  SLSSDIDQLLLR--QVAGHLDSQRVVLAPATQGFTPDVQVLLSITRLDS-GKAQPAVLDA 139

Query: 149 SLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEI 195
             ++I+     +   ++ H++E+         +Q+      R++ ++
Sbjct: 140 QWRLIDRR-GKVRENRIVHLQEQHAGT-TAAQVQAQGVLLQRLAEQL 184


>gi|162146607|ref|YP_001601066.1| hypothetical protein GDI_0785 [Gluconacetobacter diazotrophicus PAl
           5]
 gi|209543400|ref|YP_002275629.1| hypothetical protein Gdia_1231 [Gluconacetobacter diazotrophicus
           PAl 5]
 gi|161785182|emb|CAP54728.1| conserved protein [Gluconacetobacter diazotrophicus PAl 5]
 gi|209531077|gb|ACI51014.1| protein of unknown function DUF330 [Gluconacetobacter
           diazotrophicus PAl 5]
          Length = 202

 Score = 42.6 bits (99), Expect = 0.030,   Method: Composition-based stats.
 Identities = 30/205 (14%), Positives = 72/205 (35%), Gaps = 15/205 (7%)

Query: 1   MDKKLNKIIKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHI----- 55
           M ++  ++ +  +   +  V +   L+ C   + PV  Y L        +V   I     
Sbjct: 1   MTRRNRRMARLALPRLAFLV-VPAFLAGC--ASPPVRFYTLGAPAIATGAVPTGIVTPAT 57

Query: 56  -QLIITEPITEKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKIST 114
             + +        L+ +DI+VR +  +I+     +W+ +L       + A          
Sbjct: 58  PVVEVARVTLPDYLDGQDIVVR-AGNQIERSATGRWASRLSLGATDLITAQLARGRTDLF 116

Query: 115 VVKPNQGIYADYQIISAIRSFEINIDRHCAIITMSLKII-NAHDNSLVGQKVFHVEEKLE 173
           V    Q + A +++   I   ++  D   A +     II +  +  ++  +    +    
Sbjct: 117 VTDQPQSLPATWRLAVNISRLDVTRDG-TASLEADWSIIPHDANLPILHSRAAFTQAGAA 175

Query: 174 KDNKLHFIQSLNRA-FSRISSEIID 197
             +       L +A   +++  I+ 
Sbjct: 176 ATDGDT--ARLTQAVLEQLAERIVA 198


>gi|317013231|gb|ADU83839.1| hypothetical protein HPLT_07270 [Helicobacter pylori Lithuania75]
          Length = 225

 Score = 42.6 bits (99), Expect = 0.030,   Method: Composition-based stats.
 Identities = 27/125 (21%), Positives = 51/125 (40%), Gaps = 5/125 (4%)

Query: 14  ISCSLAVLLCTSLSSCFFHNNP-VNIYDLTESTKYDESVQRHIQ-LIITEPITEKILNSE 71
           +S +LA LL   LS       P +  YDL  S+       + +  + +   ++  + N++
Sbjct: 11  LSSALAFLLQGCLSINLKQMLPEIRTYDLNASSFEITQCPKPLTEVRLISILSADLFNTK 70

Query: 72  DIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYAD-YQIIS 130
           +I+ ++   +I +    +W D    M++   +   E       V  P  G  A  Y +  
Sbjct: 71  EIVFKAKDGQITHGKHQKWIDLPRNMLKTMFMQ--EAQKACLGVALPPYGTGAPTYAVRF 128

Query: 131 AIRSF 135
            I SF
Sbjct: 129 TILSF 133


>gi|260854244|ref|YP_003228135.1| hypothetical protein ECO26_1079 [Escherichia coli O26:H11 str.
           11368]
 gi|257752893|dbj|BAI24395.1| conserved predicted protein [Escherichia coli O26:H11 str. 11368]
          Length = 187

 Score = 42.6 bits (99), Expect = 0.030,   Method: Composition-based stats.
 Identities = 29/181 (16%), Positives = 63/181 (34%), Gaps = 7/181 (3%)

Query: 18  LAVLLCTSLSSCFFHNNPVNIYDLTEST--KYDESVQRHIQLIITEPITEKILNSEDIIV 75
           L  +    L+ C       N Y L          + Q +  L + +      L    ++ 
Sbjct: 5   LVTIAALWLAGCSSGEINKNYYQLPVVQSGTQSTASQGNRLLWVEQVTVPDYLAGNGVVY 64

Query: 76  RSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSF 135
           ++S ++      + W+  L + ++  L+AN         V     G   D  +   +  F
Sbjct: 65  QTSDVKYVIANNNLWASPLDQQLRNTLVANLSTQLPGWVVASQPLGSAQD-TLNVTVTEF 123

Query: 136 EINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEI 195
               D    +I     ++N     +  ++ F +E    +D     ++ L  A+S+ ++ I
Sbjct: 124 NGRYDGK--VIVSGEWLLNHQGQLI--KRPFRLEGVQTQDGYDEMVKVLASAWSQEAASI 179

Query: 196 I 196
            
Sbjct: 180 A 180


>gi|297380681|gb|ADI35568.1| Hypothetical protein HPV225_1552 [Helicobacter pylori v225d]
          Length = 225

 Score = 42.6 bits (99), Expect = 0.030,   Method: Composition-based stats.
 Identities = 27/124 (21%), Positives = 51/124 (41%), Gaps = 5/124 (4%)

Query: 15  SCSLAVLLCTSLSSCFFHNNP-VNIYDLTESTKYDESVQRHIQ-LIITEPITEKILNSED 72
           S +LA+LL   LS       P +  YDL  S+       + +  + +   ++  + N+++
Sbjct: 12  SSALALLLQGCLSINLKQMLPEIRTYDLNASSFEITQCPKPLTEVRLISILSADLFNTKE 71

Query: 73  IIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYAD-YQIISA 131
           I+ ++   +I +    +W D    M++   +   E       V  P  G  A  Y +   
Sbjct: 72  IVFKAKDGQITHGKHQKWIDLPRNMLKTMFMQ--EAQKACLGVALPPYGAGAPTYAVRFT 129

Query: 132 IRSF 135
           I SF
Sbjct: 130 ILSF 133


>gi|330987377|gb|EGH85480.1| putative lipoprotein [Pseudomonas syringae pv. lachrymans str.
           M301315]
          Length = 207

 Score = 42.6 bits (99), Expect = 0.033,   Method: Composition-based stats.
 Identities = 27/182 (14%), Positives = 56/182 (30%), Gaps = 14/182 (7%)

Query: 33  NNPVNIYDLTESTKYD---ESVQRHIQLIITEPITEKILNSEDIIVRSSPIEIQYLIGSQ 89
           +   + Y L           +     Q  +   +    ++   ++VR     +  L   +
Sbjct: 21  STQTHYYTLIAPMGAASSVAARPMPFQFEMLPVLMPVQVDQPPLVVRQGNGSLAILDTER 80

Query: 90  WSDKLPRMIQLKLIANFENN-GKISTVVKPNQGIYADYQIISAIRSFEINIDRHCAIITM 148
           W   L       L    E + G       P         + + +R FE  +  + A+I +
Sbjct: 81  WGSPLGDEFHDALTPQLERHFGSRDMAGLPKNSDQPVLSVRTDVRRFES-MPGNYALIDV 139

Query: 149 SLKIINAHDNSLVGQKV-----FHVEEKLEKDNKLHFIQSLNRAFSRISSEIID----WT 199
              +      +  G K        V  +   +   + I +  +A SR++ +I      WT
Sbjct: 140 VWTLGLRDAGATAGSKRQSLTCSSVIREQAGEGMENLIIAHQKAVSRLADKIAATAASWT 199

Query: 200 LS 201
             
Sbjct: 200 AQ 201


>gi|300692381|ref|YP_003753376.1| hypothetical protein RPSI07_2751 [Ralstonia solanacearum PSI07]
 gi|299079441|emb|CBJ52116.1| conserved exported protein of unknown function [Ralstonia
           solanacearum PSI07]
          Length = 209

 Score = 42.6 bits (99), Expect = 0.033,   Method: Composition-based stats.
 Identities = 19/144 (13%), Positives = 52/144 (36%), Gaps = 5/144 (3%)

Query: 5   LNKIIKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLI-ITEPI 63
           + +  +   +  +        + +C      ++   L  +      +QR  +L  +  P 
Sbjct: 2   MMRANRSPSLRLACVAGAAALMGACASPEPTLHTLSLQAAAPEAARIQRAFRLSGVHVP- 60

Query: 64  TEKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIY 123
             + L+   I++R+S  ++Q L   +W+      ++  L A   +      V        
Sbjct: 61  --ERLDKPQIVLRTSDSQVQELEQQRWAAPFGSELRDALSAELADALSAVDVGGATAPAG 118

Query: 124 AD-YQIISAIRSFEINIDRHCAII 146
              Y+I + ++ F+    +  + +
Sbjct: 119 VPLYRIGADVQRFDARPAQEVSAL 142


>gi|293396733|ref|ZP_06641009.1| conserved hypothetical protein [Serratia odorifera DSM 4582]
 gi|291420997|gb|EFE94250.1| conserved hypothetical protein [Serratia odorifera DSM 4582]
          Length = 185

 Score = 42.6 bits (99), Expect = 0.034,   Method: Composition-based stats.
 Identities = 30/170 (17%), Positives = 62/170 (36%), Gaps = 10/170 (5%)

Query: 18  LAVLLCTSLSSCFFHNNPVNIY-DLTE--STKYDESVQRHIQLIITEPITEKILNSEDII 74
           + V L   L +C   + P   Y  L    +     +     QL +        L    ++
Sbjct: 5   IPVALALLLGACS--STPQKTYYQLPALAAPAQVSATTASRQLWLEHVSVADYLAQNGVV 62

Query: 75  VRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRS 134
            +++ ++      + W+  L + +Q  L+ N  N      V         D  +   I  
Sbjct: 63  YQTNDVQYVIGQNNLWASPLDQQLQQSLVTNLSNALPGWLVSSQPMNSDQDV-LNVTITG 121

Query: 135 FEINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSL 184
           F    D   AII    + +  H + +V ++ F++E   ++D     +++L
Sbjct: 122 FHGRYDGK-AIIR--GEWVLKHQDRVV-KRPFNLELTQQEDGYDALVRAL 167


>gi|212634309|ref|YP_002310834.1| Curli production assembly/transport component CsgG [Shewanella
           piezotolerans WP3]
 gi|212555793|gb|ACJ28247.1| Curli production assembly/transport component CsgG, putative
           [Shewanella piezotolerans WP3]
          Length = 310

 Score = 42.6 bits (99), Expect = 0.036,   Method: Composition-based stats.
 Identities = 12/119 (10%), Positives = 41/119 (34%), Gaps = 19/119 (15%)

Query: 96  RMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFEINIDR----------HCAI 145
            M +     +  +   +  +   + G+  DY I+ ++  F  + +             A 
Sbjct: 91  IMFERLDTEDLNSENILKGIS--DSGVAVDYLIVGSVSEFGRSAESTTGIFSQSKIQKAY 148

Query: 146 ITMSLKIINAHDNSLVGQ--KVFHVEEKLEKDNKLHFIQSLNR-----AFSRISSEIID 197
             +++++++     ++           + +K        + ++     A S+  S++I 
Sbjct: 149 TKVNVRLVDVSTGRIISSVEGAGEASTETKKTLGAGTSAAFDQSLTDKALSQAISQMIS 207


>gi|32266620|ref|NP_860652.1| hypothetical protein HH1121 [Helicobacter hepaticus ATCC 51449]
 gi|32262671|gb|AAP77718.1| hypothetical protein HH_1121 [Helicobacter hepaticus ATCC 51449]
          Length = 198

 Score = 42.3 bits (98), Expect = 0.037,   Method: Composition-based stats.
 Identities = 17/136 (12%), Positives = 53/136 (38%), Gaps = 4/136 (2%)

Query: 64  TEKILNSED-IIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGI 122
                +S   I+  S  +++  + G +W +    M++ KL++  +N       ++P    
Sbjct: 61  ASTPFDSNSLILFDSKTLQVSEIKGKKWINSPKEMLKFKLLSKLQN-KCFQVSIQPFGTQ 119

Query: 123 YADYQIISAIRSFEINIDRHC--AIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHF 180
             D  +  ++ S ++  ++    A I++  ++++              +  L+  +  + 
Sbjct: 120 KFDKILKISLLSLQVLNEKGTYSAQISVFYEVMDMKTYIHNKSATLTSKVPLDSISDQNI 179

Query: 181 IQSLNRAFSRISSEII 196
                RA   +  +++
Sbjct: 180 ALGFARASDEVLDKVL 195


>gi|71737007|ref|YP_274408.1| putative lipoprotein [Pseudomonas syringae pv. phaseolicola 1448A]
 gi|257485189|ref|ZP_05639230.1| putative lipoprotein [Pseudomonas syringae pv. tabaci ATCC 11528]
 gi|71557560|gb|AAZ36771.1| lipoprotein, putative [Pseudomonas syringae pv. phaseolicola 1448A]
 gi|320324682|gb|EFW80756.1| putative lipoprotein [Pseudomonas syringae pv. glycinea str. B076]
 gi|320328790|gb|EFW84789.1| putative lipoprotein [Pseudomonas syringae pv. glycinea str. race
           4]
 gi|330880338|gb|EGH14487.1| putative lipoprotein [Pseudomonas syringae pv. glycinea str. race
           4]
 gi|331010906|gb|EGH90962.1| putative lipoprotein [Pseudomonas syringae pv. tabaci ATCC 11528]
          Length = 207

 Score = 42.3 bits (98), Expect = 0.039,   Method: Composition-based stats.
 Identities = 27/182 (14%), Positives = 56/182 (30%), Gaps = 14/182 (7%)

Query: 33  NNPVNIYDLTESTKYD---ESVQRHIQLIITEPITEKILNSEDIIVRSSPIEIQYLIGSQ 89
           +   + Y L           +     Q  +   +    ++   ++VR     +  L   +
Sbjct: 21  STQTHYYTLIAPMGAASSVAARPMPFQFEMLPVLMPVQVDQPPLVVRQGNGSLAILDTER 80

Query: 90  WSDKLPRMIQLKLIANFENN-GKISTVVKPNQGIYADYQIISAIRSFEINIDRHCAIITM 148
           W   L       L    E + G       P         + + +R FE  +  + A+I +
Sbjct: 81  WGSPLGDEFHDALTPQLERHFGSRDMAGLPKNSDQPVLSVRTDVRRFES-MPGNYALIDV 139

Query: 149 SLKIINAHDNSLVGQKV-----FHVEEKLEKDNKLHFIQSLNRAFSRISSEIID----WT 199
              +      +  G K        V  +   +   + I +  +A SR++ +I      WT
Sbjct: 140 VWTLGLRDAGATAGSKRQSLTCSSVIREQAGEGMENLIIAHQKAVSRLADKIAATAASWT 199

Query: 200 LS 201
             
Sbjct: 200 AQ 201


>gi|270156843|ref|ZP_06185500.1| putative lipoprotein [Legionella longbeachae D-4968]
 gi|289164716|ref|YP_003454854.1| hypothetical protein LLO_1380 [Legionella longbeachae NSW150]
 gi|269988868|gb|EEZ95122.1| putative lipoprotein [Legionella longbeachae D-4968]
 gi|288857889|emb|CBJ11744.1| hypothetical protein LLO_1380 [Legionella longbeachae NSW150]
          Length = 194

 Score = 42.3 bits (98), Expect = 0.040,   Method: Composition-based stats.
 Identities = 36/187 (19%), Positives = 76/187 (40%), Gaps = 9/187 (4%)

Query: 20  VLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQR--HIQLIITEPITEKILNSEDIIVRS 77
           ++L   L +C     P   Y L   +  ++ +    ++ L I +      L    +++  
Sbjct: 8   IVLGFILVACTRSKEP-QYYLLNPISLPNKQITHYNNLYLGIDDITIPAYLEKPQVMISY 66

Query: 78  SPIEIQYLIGSQWSDKLPRMIQLKLIANFEN--NGKISTVVKPNQGIYADYQIISAIRSF 135
           SP  ++     QW+  L + I+  +  N  +   G I      N     +YQ+   I  F
Sbjct: 67  SPNRVELEEYHQWAGTLDKNIKSVISTNLASLLPGAIVETSPWNAKFKPNYQLQIDIEQF 126

Query: 136 EINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEI 195
            I++  +     +  + I  H+N++V +K  +   K+      + I S+N   + ++ +I
Sbjct: 127 SIDMQGNSI---LRAEFILYHENNIVKKKDIYYRLKVSNITIENLISSMNNNLTHLTQDI 183

Query: 196 IDWTLSS 202
              T+ S
Sbjct: 184 AK-TVRS 189


>gi|253688182|ref|YP_003017372.1| hypothetical protein PC1_1795 [Pectobacterium carotovorum subsp.
           carotovorum PC1]
 gi|251754760|gb|ACT12836.1| protein of unknown function DUF330 [Pectobacterium carotovorum
           subsp. carotovorum PC1]
          Length = 188

 Score = 42.3 bits (98), Expect = 0.040,   Method: Composition-based stats.
 Identities = 28/182 (15%), Positives = 69/182 (37%), Gaps = 10/182 (5%)

Query: 19  AVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQ---LIITEPITEKILNSEDIIV 75
            ++L   LS+C   +     Y L      +       Q   L +        L +  ++ 
Sbjct: 6   TLVLALVLSACSSSSTQKTYYQLPIIADTNTVQAAVTQGHPLWVEHVSVADYLVNAGLVY 65

Query: 76  RSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQ-IISAIRS 134
           +++ ++      + W+  L + +Q  L+ N     K+   V   Q   +D   +  ++  
Sbjct: 66  QTNDVQYVIASNNLWASPLDQQLQQALVTNL--GHKLPGWVVTTQPQGSDQAVLNVSVTG 123

Query: 135 FEINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSE 194
           F    D + A++    + +  +   +V ++ F V     +D     +++L + + ++S  
Sbjct: 124 FHGRYDGN-AVVR--GEWMLTYQGKVV-KRSFSVVLPQTEDGYDALVRTLAQGWQQVSQS 179

Query: 195 II 196
           I 
Sbjct: 180 IA 181


>gi|88706601|ref|ZP_01104304.1| protein containing DUF330 [Congregibacter litoralis KT71]
 gi|88699097|gb|EAQ96213.1| protein containing DUF330 [Congregibacter litoralis KT71]
          Length = 218

 Score = 42.3 bits (98), Expect = 0.040,   Method: Composition-based stats.
 Identities = 27/200 (13%), Positives = 73/200 (36%), Gaps = 14/200 (7%)

Query: 14  ISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLI--ITEPITEKILNSE 71
           +   + VL+  +L  C   +  +    L+         +  + ++  I  P        +
Sbjct: 1   MRSLIVVLVILTLQGCAPTSLNIQHLQLSAGNAPMAVGESPVIVLDGIDIPDYLLR---D 57

Query: 72  DIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFEN--NGKISTVVKPNQGIYADYQII 129
           +++ R S   ++Y    +W++ L   IQ  L    E+  + +   +        AD+Q+ 
Sbjct: 58  ELLYRESEFTVRYDAARRWAEPLDLGIQRVLGRRLESILDTQRVILFPDATARPADWQLR 117

Query: 130 SAIRSFEINIDRHCAIITMSL--KIINAHDNSLVG-QKVFHVEEKLEKDNKLHFIQSLNR 186
             I  FE        ++ ++   +    + +S++    V+     L+  +     +++++
Sbjct: 118 VTIEEFEAVNG----VVRIAAEGRWEQENGDSIIRESVVYEDTLPLDSTSGDDIAKAMSK 173

Query: 187 AFSRISSEIIDWTLSSLPLS 206
                + E+        P +
Sbjct: 174 LLWTFAEELAAGIAEVAPAA 193


>gi|145589750|ref|YP_001156347.1| hypothetical protein Pnuc_1569 [Polynucleobacter necessarius subsp.
           asymbioticus QLW-P1DMWA-1]
 gi|145048156|gb|ABP34783.1| protein of unknown function DUF330 [Polynucleobacter necessarius
           subsp. asymbioticus QLW-P1DMWA-1]
          Length = 209

 Score = 42.3 bits (98), Expect = 0.041,   Method: Composition-based stats.
 Identities = 27/200 (13%), Positives = 70/200 (35%), Gaps = 31/200 (15%)

Query: 20  VLLCTSLSSCFFHNNPVNIYDLTE-STKYDESVQRHIQLIITEPITEKILNSEDIIVRSS 78
           +L+   L  C       + Y L         SV   +++++        ++   ++ +++
Sbjct: 8   LLISLLLWGCTSPKT--SYYKLNAEPIPVMTSVSNKMRIMVGPVSVPARMDRPQLVTQAA 65

Query: 79  PIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPN-------QGIYADYQIISA 131
             E++     +W+  L   +  ++I    ++     +  PN            DYQ++  
Sbjct: 66  GSEVEVYEYHRWAGSLKGDV-GRVI----SSNIARNLGAPNVWNFAQSTQAQYDYQVLID 120

Query: 132 IRSFEI------------NIDRHCAIITMSLKIINAH--DNSLVGQKVFHVEEKLEKDNK 177
           +++ E              I     +I    +          ++G+ +  V E +     
Sbjct: 121 VQNLESVQDGDVVVDVLWTIKPSAPVIKNQAQSARTKCVPQEIMGRSL--VREPVSGSGF 178

Query: 178 LHFIQSLNRAFSRISSEIID 197
              + + +RAFS++  +I  
Sbjct: 179 DALLSAQSRAFSKVGDDIAR 198


>gi|145297580|ref|YP_001140421.1| lipoprotein [Aeromonas salmonicida subsp. salmonicida A449]
 gi|142850352|gb|ABO88673.1| lipoprotein [Aeromonas salmonicida subsp. salmonicida A449]
          Length = 190

 Score = 42.3 bits (98), Expect = 0.042,   Method: Composition-based stats.
 Identities = 21/182 (11%), Positives = 65/182 (35%), Gaps = 6/182 (3%)

Query: 18  LAVLLCTSLSSCFFHNNPVNIYDLTE-STKYDESVQRHIQLIITEPITEKI-LNSEDIIV 75
           + + L   L+ C      ++ Y L   +       ++    ++  P+     L+   ++ 
Sbjct: 7   MTLALLGLLAGCSSAPTVLHYYSLDAEAQPAAAVTEQPQHQLVLRPVALSGQLDRVSLVY 66

Query: 76  RSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSF 135
           +    E+ +    +W+  L   +    ++   N  ++   V    G      +  ++  F
Sbjct: 67  QLEGNELHFAEYHRWAGFLDAQLNQLTLSGLSN--RLPGWVVRQDGARKGPVLSISVERF 124

Query: 136 EINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEI 195
           +   D   A+++   +++   + +++    F     L  D     +  L + + ++  +I
Sbjct: 125 QGRHDGR-AVLSGRWRLL-TEEGTVLRDVPFQQVRVLPADGYGSLVSELGQGWQQLLDQI 182

Query: 196 ID 197
             
Sbjct: 183 AA 184


>gi|85059002|ref|YP_454704.1| putative lipoprotein protein [Sodalis glossinidius str.
           'morsitans']
 gi|84779522|dbj|BAE74299.1| putative lipoprotein protein [Sodalis glossinidius str.
           'morsitans']
          Length = 222

 Score = 42.3 bits (98), Expect = 0.045,   Method: Composition-based stats.
 Identities = 23/155 (14%), Positives = 59/155 (38%), Gaps = 5/155 (3%)

Query: 42  TESTKYDESVQRHIQLIITEPITEKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLK 101
             +  +  S     +L + +      L    ++ +++ ++      + W+  L + +Q  
Sbjct: 63  AATPFHAGSPGVRPKLWVAQVSVADFLVGNGLVYQTNDVQYTTARSNLWASPLEQQLQQT 122

Query: 102 LIANFENNGKISTVVKPNQGIYADY-QIISAIRSFEINIDRHCAIITMSLKIINAHDNSL 160
           L+AN       + V     G   D  Q+   +  F    D     I   + ++  HD  +
Sbjct: 123 LVANLSAALPGTLVSTQPIGSGDDNDQLSVTLTGFHGRYDGRA--IVQGVWLL-THDGRV 179

Query: 161 VGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEI 195
           + ++ F +    EKD     +++L + +  +  ++
Sbjct: 180 I-RQPFDLALPQEKDGYDALVRTLAQGWDTVGQQV 213


>gi|77459057|ref|YP_348563.1| hypothetical protein Pfl01_2832 [Pseudomonas fluorescens Pf0-1]
 gi|77383060|gb|ABA74573.1| lipoprotein putative exported protein [Pseudomonas fluorescens
           Pf0-1]
          Length = 183

 Score = 42.3 bits (98), Expect = 0.046,   Method: Composition-based stats.
 Identities = 20/166 (12%), Positives = 55/166 (33%), Gaps = 18/166 (10%)

Query: 19  AVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIITEPITEKILNSEDIIVRSS 78
            + +   L +C   + P++ + LT +     + +   ++ I        ++   I++R  
Sbjct: 9   VLAIGLLLGAC--KSAPISFHTLTPTQPM--AGRAGSEITIEGISVPPQVDRPQIVIRQG 64

Query: 79  PIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFEIN 138
              +  L    W   L   ++  L+    N G                 +   ++ F+  
Sbjct: 65  NSGLAILETEWWGASLSDELRSALVDQLSNAGGPRKTS-----------VRIDVQRFDSI 113

Query: 139 IDR-HCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQS 183
             +     +   L+  NA D++L+  +   + +          + +
Sbjct: 114 PGQYGLIDVKWRLRQANAGDDALIACR--SLLQTPSGPTIDDLVAA 157


>gi|322835506|ref|YP_004215532.1| hypothetical protein Rahaq_4826 [Rahnella sp. Y9602]
 gi|321170707|gb|ADW76405.1| protein of unknown function DUF330 [Rahnella sp. Y9602]
          Length = 193

 Score = 42.3 bits (98), Expect = 0.047,   Method: Composition-based stats.
 Identities = 25/125 (20%), Positives = 41/125 (32%), Gaps = 7/125 (5%)

Query: 12  KIISCSLAVLLCTSLSSCFFHNNPVNIYDL-TESTKYDES-VQRHIQLIITEPITEKILN 69
            ++     V L   LS C       + Y L T +     +       L +      + LN
Sbjct: 2   NVLRVITGVCLLLGLSGCASPA--PHYYTLITPAENAPSAIPPAAFVLRVQPVTVPEQLN 59

Query: 70  SEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFE---NNGKISTVVKPNQGIYADY 126
              +++R S  EI     + W+  LP  I+  L A  E   N   I  +  P        
Sbjct: 60  QPQLVIRKSDGEIVISDSALWAAPLPEEIRSALSAQLERSLNTTDIRELTPPPDKPVITL 119

Query: 127 QIISA 131
           ++   
Sbjct: 120 RVTVQ 124


>gi|78357025|ref|YP_388474.1| putative lipoprotein [Desulfovibrio desulfuricans subsp.
           desulfuricans str. G20]
 gi|78219430|gb|ABB38779.1| lipoprotein, putative [Desulfovibrio desulfuricans subsp.
           desulfuricans str. G20]
          Length = 195

 Score = 41.9 bits (97), Expect = 0.048,   Method: Composition-based stats.
 Identities = 29/190 (15%), Positives = 64/190 (33%), Gaps = 7/190 (3%)

Query: 11  KKIISCSLAVLLCTSL-SSCFFHNNPVNIYDLTESTKYDESVQ--RHIQLIITEPITEKI 67
             ++   L +L    L + C   + P   Y L+       +V       L + +      
Sbjct: 5   SGVLRALLCLLFAAGLLTGCAGKSAPTRFYLLSADDVLPAAVPQEARAVLWLEKVEIPPY 64

Query: 68  LNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQ 127
           L+  +I+VR     I       W++ L   I   L      +     VV  +     D +
Sbjct: 65  LDRPNIVVRGDAGRIYLAEFDYWAEPLRDSISRMLARKLAGDTN-RAVVTESYAAGED-R 122

Query: 128 IISAIRSFEINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRA 187
           +   I   + + D    +  M    +++          F      +++N   ++Q+ +R 
Sbjct: 123 VKIVILRLDASTDGDVTMEAMWR--LDSGGADTGEWHYFVNRLSAQQNNYSGYVQAHSRL 180

Query: 188 FSRISSEIID 197
            + ++ +I  
Sbjct: 181 LALLAEDIAR 190


>gi|186472382|ref|YP_001859724.1| hypothetical protein Bphy_3534 [Burkholderia phymatum STM815]
 gi|184194714|gb|ACC72678.1| protein of unknown function DUF330 [Burkholderia phymatum STM815]
          Length = 253

 Score = 41.9 bits (97), Expect = 0.051,   Method: Composition-based stats.
 Identities = 23/138 (16%), Positives = 52/138 (37%), Gaps = 6/138 (4%)

Query: 12  KIISCSLAVLLCTSLSSCFFHNNPVNIYDL---TESTKYDESVQRHIQLIITEPITEKIL 68
           + ++ +L  +   +L++C   + P   Y L    + T    +     ++ +        +
Sbjct: 10  RRVARALMGVGLATLAAC--ASPPTRFYTLGIDAQPTIAVSTASPSFRIDVRPVKVPAAV 67

Query: 69  NSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANF-ENNGKISTVVKPNQGIYADYQ 127
               ++V+ +  ++Q L   +W   LP  I+  LIA   +  G  +            Y+
Sbjct: 68  ARSQLVVQINAAQVQVLEDDRWVSSLPDEIRAALIAGVSQQAGAPAAKTLVPGEDVPVYE 127

Query: 128 IISAIRSFEINIDRHCAI 145
           +   I+ FE     H  +
Sbjct: 128 VTVDIQRFESWPGSHVLV 145


>gi|46581530|ref|YP_012338.1| putative lipoprotein [Desulfovibrio vulgaris str. Hildenborough]
 gi|46450952|gb|AAS97598.1| lipoprotein, putative [Desulfovibrio vulgaris str. Hildenborough]
 gi|311235177|gb|ADP88031.1| protein of unknown function DUF330 [Desulfovibrio vulgaris RCH1]
          Length = 205

 Score = 41.9 bits (97), Expect = 0.053,   Method: Composition-based stats.
 Identities = 25/181 (13%), Positives = 57/181 (31%), Gaps = 10/181 (5%)

Query: 10  KKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQ---RHIQLIITEPITEK 66
            +  ++ +L ++   + S C     P   Y L        S     + + + +   I   
Sbjct: 4   SRTGLAAALVLVCAVASSGCGGAQAPTRYYSLLAEAGQRPSAAPTEKTLSVSVGPVIIPD 63

Query: 67  ILNSEDIIVRSSPIEIQYLIGSQWS---DK-LPRMIQLKLIANFENNGKISTVVKPNQGI 122
           IL    I               +WS   D+ + R +   L            V   +Q  
Sbjct: 64  ILKQTRIATSKGDGSYNLSEYHRWSGDVDRDIARALAEHLGRGLGTEQVF--VFPWDQAG 121

Query: 123 YADYQIISAIRSFEINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQ 182
              Y++++ + S   N D   A + +   ++     +    +   + EK    +   ++ 
Sbjct: 122 APAYRVLADVISMGGNPDG-EATLHVRWTVVPRSGAAEPVTRRTDLSEKCPGPDHADWVA 180

Query: 183 S 183
           +
Sbjct: 181 A 181


>gi|317014877|gb|ADU82313.1| hypothetical protein HPGAM_07700 [Helicobacter pylori Gambia94/24]
          Length = 225

 Score = 41.9 bits (97), Expect = 0.056,   Method: Composition-based stats.
 Identities = 27/124 (21%), Positives = 51/124 (41%), Gaps = 5/124 (4%)

Query: 15  SCSLAVLLCTSLSSCFFHNNP-VNIYDLTESTKYDESVQRHIQ-LIITEPITEKILNSED 72
           S +LA+LL   LS       P +  YDL  S+       + +  + +   ++  + N+++
Sbjct: 12  SSALALLLQGCLSINLKQMLPEIRTYDLNASSFEMTQCAKPLTEVRLISILSADLFNTKE 71

Query: 73  IIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYAD-YQIISA 131
           I+ ++   +I +    +W D    M++   +   E       V  P  G  A  Y +   
Sbjct: 72  IVFKAQDGQITHGKHQKWIDLPRNMLKTMFMQ--EAQKACLGVALPPYGAGAPTYAVRFT 129

Query: 132 IRSF 135
           I SF
Sbjct: 130 ILSF 133


>gi|120601307|ref|YP_965707.1| hypothetical protein Dvul_0256 [Desulfovibrio vulgaris DP4]
 gi|120561536|gb|ABM27280.1| protein of unknown function DUF330 [Desulfovibrio vulgaris DP4]
          Length = 205

 Score = 41.9 bits (97), Expect = 0.056,   Method: Composition-based stats.
 Identities = 25/181 (13%), Positives = 57/181 (31%), Gaps = 10/181 (5%)

Query: 10  KKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQ---RHIQLIITEPITEK 66
            +  ++ +L ++   + S C     P   Y L        S     + + + +   I   
Sbjct: 4   SRTGLAAALVLVCAVASSGCGGAQAPTRYYSLLAEAGQRPSAAPTEKTLSVSVGPVIIPD 63

Query: 67  ILNSEDIIVRSSPIEIQYLIGSQWS---DK-LPRMIQLKLIANFENNGKISTVVKPNQGI 122
           IL    I               +WS   D+ + R +   L            V   +Q  
Sbjct: 64  ILKQTRIATSKGDGSYNLSEYHRWSGDVDRDIARALAEHLGRGLGTEQVF--VFPWDQAG 121

Query: 123 YADYQIISAIRSFEINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQ 182
              Y++++ + S   N D   A + +   ++     +    +   + EK    +   ++ 
Sbjct: 122 APAYRVLADVISMGGNPDG-EATLHVRWTVVPRSGAAEPVTRRTDLSEKCPGPDHADWVA 180

Query: 183 S 183
           +
Sbjct: 181 A 181


>gi|254779975|ref|YP_003058082.1| hypothetical protein HELPY_1435 [Helicobacter pylori B38]
 gi|254001888|emb|CAX30138.1| Conserved hypothetical protein; putative signal peptide
           [Helicobacter pylori B38]
          Length = 225

 Score = 41.9 bits (97), Expect = 0.058,   Method: Composition-based stats.
 Identities = 27/125 (21%), Positives = 51/125 (40%), Gaps = 5/125 (4%)

Query: 14  ISCSLAVLLCTSLSSCFFHNNP-VNIYDLTESTKYDESVQRHIQ-LIITEPITEKILNSE 71
           +S +LA LL   LS       P +  YDL  S+       + +  + +   ++  + N++
Sbjct: 11  LSSALAFLLQGCLSINLKQMLPEIRTYDLNVSSFEITQCPKPLTEVRLISILSADLFNTK 70

Query: 72  DIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYAD-YQIIS 130
           +I+ ++   +I +    +W D    M++   +   E       V  P  G  A  Y +  
Sbjct: 71  EIVFKAQDGQITHGKHQKWIDLPRNMLKTMFMQ--EAQKACLGVALPPYGAGAPTYAVRF 128

Query: 131 AIRSF 135
            I SF
Sbjct: 129 TILSF 133


>gi|99078305|ref|YP_611563.1| hypothetical protein TM1040_3329 [Ruegeria sp. TM1040]
 gi|99035443|gb|ABF62301.1| protein of unknown function DUF330 [Ruegeria sp. TM1040]
          Length = 185

 Score = 41.9 bits (97), Expect = 0.060,   Method: Composition-based stats.
 Identities = 26/166 (15%), Positives = 64/166 (38%), Gaps = 10/166 (6%)

Query: 16  CSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQL-IITEPITEKILNSEDII 74
             L++ +  +LS+C   N+P  +   T + +      R +++ +++ P      +   I+
Sbjct: 4   LVLSLCVAGALSACSSANDPRYLIAATPAERVKNLSARTVEVQLVSLPSYASASD---IV 60

Query: 75  VRSSPIEIQYLIGSQWSDKLPRMIQLKLIANF-ENNGKISTVVKPNQGIYADYQIISAIR 133
                  +     +QW+D   R + + +     +  G    V        AD ++   I 
Sbjct: 61  SEGDGGALYSQERAQWADDPARGMSVAIARGLSDRTGAAVAVEPWPLNTPADARLDVRI- 119

Query: 134 SFEINIDRHCAIITMSLK-IINAHDNSLVG-QKVFHVEEKLEKDNK 177
             + +  R   +  +S +  +++ D  +    K FH+E  + +   
Sbjct: 120 --DQSYARADGLFELSGQYAVSSPDGRVREFVKRFHIETPVTESGP 163


>gi|269138617|ref|YP_003295317.1| hypothetical protein ETAE_1263 [Edwardsiella tarda EIB202]
 gi|267984277|gb|ACY84106.1| hypothetical protein ETAE_1263 [Edwardsiella tarda EIB202]
 gi|304558630|gb|ADM41294.1| putative lipoprotein [Edwardsiella tarda FL6-60]
          Length = 188

 Score = 41.5 bits (96), Expect = 0.064,   Method: Composition-based stats.
 Identities = 24/185 (12%), Positives = 70/185 (37%), Gaps = 10/185 (5%)

Query: 17  SLAVLLCTSLSSCFFHNNPVNIYDLT----ESTKYDESVQRHIQLIITEPITEKILNSED 72
            + +L   +LS+C   ++  + Y L           ++  +  QL +       +L    
Sbjct: 4   GMMLLAVLALSACS-ASDQKSYYQLPTTSAAKASVVQTAPQARQLWVQPVNVTDLLGGMG 62

Query: 73  IIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAI 132
           ++ + + ++      + W+  L + +   L+A          V      +  D  +   +
Sbjct: 63  VVYQQNDVQFVTASNNLWASPLAQQLTQSLVAGLSAGMPGWLVSAQPLEMGQD-TLTVNV 121

Query: 133 RSFEINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRIS 192
            +F    D     + ++ + + +H  +L+ QK FH+    + +     +++L + + +  
Sbjct: 122 NAFYGRYDGK---VVVAGEWLLSHQGTLM-QKAFHIVLPQQGNGYDALVRTLAQGWQQEI 177

Query: 193 SEIID 197
           + +  
Sbjct: 178 ASMAG 182


>gi|108563877|ref|YP_628193.1| hypothetical protein HPAG1_1452 [Helicobacter pylori HPAG1]
 gi|107837650|gb|ABF85519.1| hypothetical protein HPAG1_1452 [Helicobacter pylori HPAG1]
          Length = 225

 Score = 41.5 bits (96), Expect = 0.067,   Method: Composition-based stats.
 Identities = 25/125 (20%), Positives = 50/125 (40%), Gaps = 5/125 (4%)

Query: 14  ISCSLAVLLCTSLSSCFFHNNP-VNIYDLTESTKYDESVQRHIQ-LIITEPITEKILNSE 71
           +S +LA+L    LS       P +  YDL  S+       + +  + +   ++  + N++
Sbjct: 11  LSSALALLFQGCLSINLKQMLPEIRTYDLNASSFEITQCPKPLTEVRLISILSADLFNTK 70

Query: 72  DIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIY-ADYQIIS 130
           +I+ ++   +I +    +W D    M++   +   E       V  P  G     Y +  
Sbjct: 71  EIVFKAKDGQITHGKHQKWIDLPRNMLKTMFMQ--EAQKACLGVALPPYGAGTPTYAVRF 128

Query: 131 AIRSF 135
            I SF
Sbjct: 129 TILSF 133


>gi|298506722|gb|ADI85445.1| protein of unknown function DUF330 [Geobacter sulfurreducens KN400]
          Length = 207

 Score = 41.5 bits (96), Expect = 0.072,   Method: Composition-based stats.
 Identities = 33/200 (16%), Positives = 66/200 (33%), Gaps = 20/200 (10%)

Query: 11  KKIISCSLAVLLCTSLSSCFFHNNPVNIYDLT--ESTKYDESVQRHIQ---LIITEPITE 65
           +     +L        ++C     P   Y L+    +  +E      Q   ++   P+  
Sbjct: 4   RSAGYVALFFYAAIHCAACGGTP-PARFYTLSSLAGSGSEEGRPSAGQQRKVLGIGPVAL 62

Query: 66  KI-LNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKI----STVVKPNQ 120
              L    I  RS P  +      +W   L   +   L+   EN G++      VV P  
Sbjct: 63  AGYLYHPGITTRSGPNTVSRAELDRWGSPLGDEVTRVLV---ENMGELLPHGRYVVLPWL 119

Query: 121 GIYA-DYQIISAIRSFEINIDRHCAIITMSLK--IINAHDNSLVGQKVFHVEEKLEKDNK 177
              A D ++   I  F+  ++     + ++    +     N++       + E L     
Sbjct: 120 EASALDCRVQLTITRFDGPLEGP---VVLNASWILFGGGANTVRASGEVSITEPLRGSGY 176

Query: 178 LHFIQSLNRAFSRISSEIID 197
                +++RA + +S  I  
Sbjct: 177 GATADAMSRALAGLSRRIAT 196


>gi|323157154|gb|EFZ43277.1| hypothetical protein ECEPECA14_0945 [Escherichia coli EPECa14]
          Length = 182

 Score = 41.5 bits (96), Expect = 0.072,   Method: Composition-based stats.
 Identities = 29/173 (16%), Positives = 63/173 (36%), Gaps = 7/173 (4%)

Query: 26  LSSCFFHNNPVNIYDLTEST--KYDESVQRHIQLIITEPITEKILNSEDIIVRSSPIEIQ 83
           L+ C       N Y L          + Q +  L + +      L    ++ ++S ++  
Sbjct: 8   LAGCSSGEINKNYYQLPVVQSGTQSTASQGNRLLWVEQVTVPDYLAGNGVVYQTSDVKYV 67

Query: 84  YLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFEINIDRHC 143
               + W+  L + ++  L+AN         V     G   D  +   +  F    D   
Sbjct: 68  IANNNLWASPLDQQLRNTLVANLSTQLPGWVVASQPLGSAQD-TLNVTVTEFNGRYDGK- 125

Query: 144 AIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEII 196
             + +S + +  H   L+ ++ F +E    +D     ++ L  A+S+ ++ I 
Sbjct: 126 --VIVSGEWLLNHQGQLI-KRPFRLEGVQTQDGYDEMVKVLASAWSQEAASIA 175


>gi|296533183|ref|ZP_06895810.1| conserved hypothetical protein [Roseomonas cervicalis ATCC 49957]
 gi|296266491|gb|EFH12489.1| conserved hypothetical protein [Roseomonas cervicalis ATCC 49957]
          Length = 197

 Score = 41.5 bits (96), Expect = 0.077,   Method: Composition-based stats.
 Identities = 17/152 (11%), Positives = 51/152 (33%), Gaps = 8/152 (5%)

Query: 39  YDLTESTKYDESVQRHIQLIITEPITEKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMI 98
           Y LT      +     + + +      + L+  +I        +  + G++W++ L  M+
Sbjct: 34  YRLTARPGPAQGGAAPL-IELRRIGLARYLDRSEITRGGGGARVALVSGARWAEPLGEMV 92

Query: 99  QLKLIANFENNGKISTVVKPNQGIYA--DYQIISAIRSFEINIDRHCAIIT--MSLKIIN 154
                 N       S ++     + A  + Q  + I   E   +    +I   ++ + + 
Sbjct: 93  TRITAENLRQRLPGSGILAEGSALTAVPEAQAEAEIARLE-EDEEGRVVIEAQLAARRLG 151

Query: 155 AHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNR 186
            +   ++  +       L   +      ++++
Sbjct: 152 GNARPVL--RSLRETVPLAGTDTEALAAAMSQ 181


>gi|222109467|ref|YP_002551731.1| hypothetical protein Dtpsy_0247 [Acidovorax ebreus TPSY]
 gi|221728911|gb|ACM31731.1| protein of unknown function DUF330 [Acidovorax ebreus TPSY]
          Length = 224

 Score = 41.5 bits (96), Expect = 0.078,   Method: Composition-based stats.
 Identities = 24/212 (11%), Positives = 63/212 (29%), Gaps = 27/212 (12%)

Query: 14  ISCSLAVLLCTSLSSCFFHNNP---VNIYDLTESTKYDESVQRHIQL---IITEPITEKI 67
           +           ++ C     P    ++YD                L    + E     +
Sbjct: 15  VKAIFGFTFMALMAGCSILPEPPVRADVYDFGPGPLQAPGPAASAPLPPIALAEVTATGL 74

Query: 68  LNSE-----DIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGI 122
                     +    +  +++    ++WS     ++   +       G+   V+  + G+
Sbjct: 75  PEGSTALLYRLAYT-NAQQLRPYTQARWSLPPAVLLHQAVRERL---GQRRAVLSGDDGM 130

Query: 123 YADYQ-------IISAIRSFEINIDRHCA---IITMSLKIINAHDN--SLVGQKVFHVEE 170
               +       +   +  F        A   ++ +   + +A     +LV Q+VF    
Sbjct: 131 AVLLERGRMPSVLRLELEEFSHVFGAPQASAGLVRVRAVLADASTAGETLVTQRVFVARR 190

Query: 171 KLEKDNKLHFIQSLNRAFSRISSEIIDWTLSS 202
                +     ++L  A ++++ E+  W   S
Sbjct: 191 DAATPDAAGGAKALADAAAQVAEELAAWVEQS 222


>gi|49082044|gb|AAT50422.1| PA4963 [synthetic construct]
          Length = 237

 Score = 41.1 bits (95), Expect = 0.086,   Method: Composition-based stats.
 Identities = 27/185 (14%), Positives = 65/185 (35%), Gaps = 8/185 (4%)

Query: 16  CSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIITEPITEKILNSEDIIV 75
             L+++    L+ C  H  P  +Y L               +++        L  + ++ 
Sbjct: 8   ACLSLVSLLGLTGCAVHP-PAQLYQLDVGAAAVPKKDGGAAVLLGPVQLADYLKRDVMVQ 66

Query: 76  RSSPIEIQYLIGSQWSDKLPRMIQLKLIANF--ENNGKISTVVKPNQGIYADYQIISAIR 133
           R +   +     ++W+  L   +  +L+     E       +     G     Q++  I 
Sbjct: 67  RQADGILSLSTDARWAGNLETNVSQQLLRQMSSELGSSRLALFPEKPGFTPQVQVMLTIS 126

Query: 134 SFEINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEK---LEKDNKLHFIQSLNRAFSR 190
             +    +  A+I    ++++    +L   +VFH EE+      D        L R  ++
Sbjct: 127 RLDS-GPKQPAVIEARWRLLDQK-GNLKDSRVFHEEEQHQGSIGDQIRAQSDLLKRLAAQ 184

Query: 191 ISSEI 195
           ++ ++
Sbjct: 185 LAKDV 189


>gi|317178167|dbj|BAJ55956.1| hypothetical protein HPF16_1359 [Helicobacter pylori F16]
          Length = 225

 Score = 41.1 bits (95), Expect = 0.088,   Method: Composition-based stats.
 Identities = 28/124 (22%), Positives = 52/124 (41%), Gaps = 5/124 (4%)

Query: 15  SCSLAVLLCTSLSSCFFHNNP-VNIYDLTESTKYDESVQRH-IQLIITEPITEKILNSED 72
           S +LA+LL   LS       P +  YDL  S+       +  I++ +   ++  + N+++
Sbjct: 12  SSALALLLQGCLSINLKQMLPEIRTYDLNASSFEIMQCPKPLIEVRLISILSADLFNTKE 71

Query: 73  IIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYAD-YQIISA 131
           I+ ++   +I +    +W D    M++   +   E       V  P  G  A  Y +   
Sbjct: 72  IVFKAKDGQITHGKHQKWIDLPRNMLKTMFMQ--EAQKACLGVALPPYGAGAPTYAVRFT 129

Query: 132 IRSF 135
           I SF
Sbjct: 130 ILSF 133


>gi|217033906|ref|ZP_03439330.1| hypothetical protein HP9810_870g38 [Helicobacter pylori 98-10]
 gi|216943669|gb|EEC23114.1| hypothetical protein HP9810_870g38 [Helicobacter pylori 98-10]
          Length = 227

 Score = 41.1 bits (95), Expect = 0.088,   Method: Composition-based stats.
 Identities = 19/102 (18%), Positives = 41/102 (40%), Gaps = 4/102 (3%)

Query: 36  VNIYDLTESTKYDESVQRHIQ-LIITEPITEKILNSEDIIVRSSPIEIQYLIGSQWSDKL 94
           +  YDL  S+       + +  + +   ++  + N+++I+ ++   +I +    +W D  
Sbjct: 34  IRTYDLNASSFETTQCPKPLTEVRLISILSADLFNTKEIVFKAKDGQITHGKHQKWIDLP 93

Query: 95  PRMIQLKLIANFENNGKISTVVKPNQGIYAD-YQIISAIRSF 135
             M++   +   E       V  P  G  A  Y +   I SF
Sbjct: 94  RNMLKTMFMQ--EAQKACLGVALPPYGAGAPTYAVRFTILSF 133


>gi|320181978|gb|EFW56883.1| hypothetical protein SGB_00699 [Shigella boydii ATCC 9905]
 gi|332092509|gb|EGI97582.1| hypothetical protein SB521682_1266 [Shigella boydii 5216-82]
          Length = 187

 Score = 41.1 bits (95), Expect = 0.096,   Method: Composition-based stats.
 Identities = 29/181 (16%), Positives = 63/181 (34%), Gaps = 7/181 (3%)

Query: 18  LAVLLCTSLSSCFFHNNPVNIYDLTEST--KYDESVQRHIQLIITEPITEKILNSEDIIV 75
           L  +    L+ C       N Y L      K   + Q +  L + +      L    ++ 
Sbjct: 5   LVTIAALWLAGCSSGEINKNYYQLPVVQSGKQSTASQGNRLLWVEQVTVPDYLAGNGMVY 64

Query: 76  RSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSF 135
           ++S ++      + W+  L + ++  L+AN         V     G   D  +   +  F
Sbjct: 65  QTSDVKYVIANNNLWASPLDQQLRNTLVANLSTQLPGWVVASQPLGSAQD-TLNVTVTEF 123

Query: 136 EINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEI 195
               D    +I     ++N     +  ++ F +E    +D     ++ L   +S+ ++ I
Sbjct: 124 NGRYDGK--VIVSGEWLLNHQGQLI--KRPFRLEGVQTQDGYDEMVKVLASVWSQEAASI 179

Query: 196 I 196
            
Sbjct: 180 A 180


>gi|315585852|gb|ADU40233.1| conserved hypothetical protein [Helicobacter pylori 35A]
          Length = 225

 Score = 41.1 bits (95), Expect = 0.096,   Method: Composition-based stats.
 Identities = 20/102 (19%), Positives = 42/102 (41%), Gaps = 4/102 (3%)

Query: 36  VNIYDLTESTKYDESVQRH-IQLIITEPITEKILNSEDIIVRSSPIEIQYLIGSQWSDKL 94
           +  YDL  S+       +  I++ +   ++  + N+++I+ ++   +I +    +W D  
Sbjct: 34  IRTYDLNASSFETTQCPKPLIEVRLISILSADLFNTKEIVFKAKDGQITHGKHQKWIDLP 93

Query: 95  PRMIQLKLIANFENNGKISTVVKPNQGIYAD-YQIISAIRSF 135
             M++   +   E       V  P  G  A  Y +   I SF
Sbjct: 94  RNMLKTMFMQ--EAQKACLGVALPPYGAGAPTYAVRFTILSF 133


>gi|261840137|gb|ACX99902.1| hypothetical protein HPKB_1365 [Helicobacter pylori 52]
          Length = 225

 Score = 41.1 bits (95), Expect = 0.096,   Method: Composition-based stats.
 Identities = 20/102 (19%), Positives = 42/102 (41%), Gaps = 4/102 (3%)

Query: 36  VNIYDLTESTKYDESVQRH-IQLIITEPITEKILNSEDIIVRSSPIEIQYLIGSQWSDKL 94
           +  YDL  S+       +  I++ +   ++  + N+++I+ ++   +I +    +W D  
Sbjct: 34  IRTYDLNASSFETTQCPKPLIEVRLISILSADLFNTKEIVFKAKDGQITHGKHQKWIDLP 93

Query: 95  PRMIQLKLIANFENNGKISTVVKPNQGIYAD-YQIISAIRSF 135
             M++   +   E       V  P  G  A  Y +   I SF
Sbjct: 94  RNMLKTMFMQ--EAQKACLGVALPPYGAGAPTYAVRFTILSF 133


>gi|261838738|gb|ACX98504.1| hypothetical protein KHP_1314 [Helicobacter pylori 51]
          Length = 225

 Score = 41.1 bits (95), Expect = 0.096,   Method: Composition-based stats.
 Identities = 20/102 (19%), Positives = 42/102 (41%), Gaps = 4/102 (3%)

Query: 36  VNIYDLTESTKYDESVQRH-IQLIITEPITEKILNSEDIIVRSSPIEIQYLIGSQWSDKL 94
           +  YDL  S+       +  I++ +   ++  + N+++I+ ++   +I +    +W D  
Sbjct: 34  IRTYDLNASSFETTQCPKPLIEVRLISILSADLFNTKEIVFKAKDGQITHGKHQKWIDLP 93

Query: 95  PRMIQLKLIANFENNGKISTVVKPNQGIYAD-YQIISAIRSF 135
             M++   +   E       V  P  G  A  Y +   I SF
Sbjct: 94  RNMLKTMFMQ--EAQKACLGVALPPYGAGAPTYAVRFTILSF 133


>gi|331641481|ref|ZP_08342616.1| paraquat-inducible protein B [Escherichia coli H736]
 gi|331038279|gb|EGI10499.1| paraquat-inducible protein B [Escherichia coli H736]
          Length = 733

 Score = 41.1 bits (95), Expect = 0.097,   Method: Composition-based stats.
 Identities = 23/146 (15%), Positives = 49/146 (33%), Gaps = 3/146 (2%)

Query: 2   DKKLNKIIKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTEST--KYDESVQRHIQLII 59
           DKK ++  + + +   L  +    L+ C       N Y L          + Q +  L +
Sbjct: 535 DKKRSRAEEGETMKKWLVTIAALWLAGCSSGEINKNYYQLPVVQSGTQSTASQGNRLLWV 594

Query: 60  TEPITEKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPN 119
            +      L    ++ ++S ++      + W+  L + ++  L+AN         V    
Sbjct: 595 EQVTVPDYLAGNGVVYQTSDVKYVIANNNLWASPLDQQLRNTLVANLSTQLPGWVVASQP 654

Query: 120 QGIYADYQIISAIRSFEINIDRHCAI 145
            G   D  +   +  F    D    +
Sbjct: 655 LGSAQD-TLNVTVTEFNGRYDGKVIV 679


>gi|210135630|ref|YP_002302069.1| hypothetical protein HPP12_1441 [Helicobacter pylori P12]
 gi|210133598|gb|ACJ08589.1| hypothetical protein HPP12_1441 [Helicobacter pylori P12]
          Length = 225

 Score = 41.1 bits (95), Expect = 0.10,   Method: Composition-based stats.
 Identities = 27/125 (21%), Positives = 51/125 (40%), Gaps = 5/125 (4%)

Query: 14  ISCSLAVLLCTSLSSCFFHNNP-VNIYDLTESTKYDESVQRHIQ-LIITEPITEKILNSE 71
           +S +LA LL   LS       P +  YDL  S+       + +  + +   ++  + N++
Sbjct: 11  LSSALAFLLQGCLSINLKQMLPEIRTYDLNASSFEIVQCAKPLTEVRLISILSADLFNTK 70

Query: 72  DIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYAD-YQIIS 130
           +I+ ++   +I +    +W D    M++   +   E       V  P  G  A  Y +  
Sbjct: 71  EIVFKAQDGQITHGKHQKWIDLPRNMLKTMFMQ--EAQKACLGVALPPYGAGAPTYAVRF 128

Query: 131 AIRSF 135
            I SF
Sbjct: 129 TILSF 133


>gi|209516509|ref|ZP_03265364.1| protein of unknown function DUF330 [Burkholderia sp. H160]
 gi|209503113|gb|EEA03114.1| protein of unknown function DUF330 [Burkholderia sp. H160]
          Length = 249

 Score = 41.1 bits (95), Expect = 0.10,   Method: Composition-based stats.
 Identities = 34/194 (17%), Positives = 69/194 (35%), Gaps = 17/194 (8%)

Query: 12  KIISCSLAVLLCTSLSSCFFHNNPVNIYDL-----TESTKYDESVQRHIQLI-ITEPITE 65
           + +   L+ +  T L++C         Y L     +  T    S    I +  +  P   
Sbjct: 10  RAMGGILSAIGLTLLAACASPAT--RFYTLGTDARSTITGSTGSPSFRIDVRPVKVPAAV 67

Query: 66  KILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANF-ENNGKISTVVKPNQGIYA 124
                  ++V+ S  +++ L   +W+  LP  I   LIA   +  G  +       G   
Sbjct: 68  AR---SQLVVQDSATQVKVLEQDRWASSLPDEIHDALIAGVSQQAGVPAANTVARDGNSP 124

Query: 125 DYQIISAIRSFEINIDRHCAI-ITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQS 183
            Y++  + + FE     H  I +  +++  +A   +L    V   +     D     +  
Sbjct: 125 VYEVDVSFQRFESWPGSHVLIDVVWNVR-TSAGAGTLTCHSVVSEQV---SDGYQAIVDG 180

Query: 184 LNRAFSRISSEIID 197
              A S ++ +I +
Sbjct: 181 HRHAISAVAEQIAE 194


>gi|157368614|ref|YP_001476603.1| hypothetical protein Spro_0367 [Serratia proteamaculans 568]
 gi|157373086|ref|YP_001481075.1| hypothetical protein Spro_4854 [Serratia proteamaculans 568]
 gi|157320378|gb|ABV39475.1| protein of unknown function DUF330 [Serratia proteamaculans 568]
 gi|157324850|gb|ABV43947.1| protein of unknown function DUF330 [Serratia proteamaculans 568]
          Length = 182

 Score = 40.7 bits (94), Expect = 0.11,   Method: Composition-based stats.
 Identities = 32/170 (18%), Positives = 61/170 (35%), Gaps = 10/170 (5%)

Query: 18  LAVLLCTSLSSCFFHNNPVNIY-DLTESTKYDE--SVQRHIQLIITEPITEKILNSEDII 74
           L V L   LS+C   N P   Y  L       +  S     QL +        L    ++
Sbjct: 5   LPVALALLLSACS--NTPQKTYYQLPALGTPAQVNSGASTRQLWLEHVFVADYLMQNGVV 62

Query: 75  VRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRS 134
            +++ ++      + W+  L + +Q  L+ N  +      V         D  +   I  
Sbjct: 63  YQTNGVQYAIAQNNLWASPLDQQLQQTLVTNLSSALPGWVVSSQPMSSDQDV-LNVTISG 121

Query: 135 FEINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSL 184
           F    D   A+I    + +  H    + ++ F++E K  +D     +++L
Sbjct: 122 FHGRFDGK-AVIR--GEWVLNHQGR-LTKRPFNLELKQSEDGYDALVRTL 167


>gi|308185231|ref|YP_003929364.1| hypothetical protein HPSJM_07455 [Helicobacter pylori SJM180]
 gi|308061151|gb|ADO03047.1| hypothetical protein HPSJM_07455 [Helicobacter pylori SJM180]
          Length = 225

 Score = 40.7 bits (94), Expect = 0.11,   Method: Composition-based stats.
 Identities = 26/125 (20%), Positives = 51/125 (40%), Gaps = 5/125 (4%)

Query: 14  ISCSLAVLLCTSLSSCFFHNNP-VNIYDLTESTKYDESVQRHIQ-LIITEPITEKILNSE 71
           +S + A+LL   LS       P +  YDL  S+       + +  + +   ++  + N++
Sbjct: 11  LSSAFALLLQGCLSINLKQMLPEIRTYDLNASSFEIMQCPKPLTEVRLISILSADLFNTK 70

Query: 72  DIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYAD-YQIIS 130
           +I+ ++   +I +    +W D    M++   +   E       V  P  G  A  Y +  
Sbjct: 71  EIVFKAKDGQITHGKHQKWIDLPRNMLKTMFMQ--EAQKACLGVALPPYGAGAPTYAVRF 128

Query: 131 AIRSF 135
            I SF
Sbjct: 129 TILSF 133


>gi|146311121|ref|YP_001176195.1| hypothetical protein Ent638_1464 [Enterobacter sp. 638]
 gi|145317997|gb|ABP60144.1| protein of unknown function DUF330 [Enterobacter sp. 638]
          Length = 188

 Score = 40.7 bits (94), Expect = 0.11,   Method: Composition-based stats.
 Identities = 33/191 (17%), Positives = 80/191 (41%), Gaps = 11/191 (5%)

Query: 18  LAVLLCTSLSSCFFHNNPVNIYDLTEST---KYDESVQRHIQLIITEPITEKILNSEDII 74
           L ++    L++C   ++  + Y L  +        + Q +  L + + +    L    ++
Sbjct: 5   LFIVGVMVLTACSSGSDNKSYYQLPLAAQTGGQTSTSQGNRLLWVEQVVIPDSLAGNGVV 64

Query: 75  VRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKIS-TVVKPNQGIYADYQIISAIR 133
            ++S ++      + W+  L + ++  L+AN  N+      V     G   D  +   + 
Sbjct: 65  YQTSDVQYVIANNNLWASPLDQQLRNTLVANL-NSQLPGWIVASQPLGSNQD-TLNVTVT 122

Query: 134 SFEINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISS 193
            F    D     + +S + +  H   L+ ++ F++E K ++D     ++ L + +++ S+
Sbjct: 123 GFHGRYDGK---VIISGEWLLNHQGQLI-KRPFYLELKQQQDGYDEMVKMLAQGWAQESA 178

Query: 194 EIIDWTLSSLP 204
            I    +S LP
Sbjct: 179 SIAK-EISRLP 188


>gi|84687031|ref|ZP_01014914.1| lipoprotein, putative [Maritimibacter alkaliphilus HTCC2654]
 gi|84665005|gb|EAQ11486.1| lipoprotein, putative [Rhodobacterales bacterium HTCC2654]
          Length = 186

 Score = 40.7 bits (94), Expect = 0.12,   Method: Composition-based stats.
 Identities = 26/182 (14%), Positives = 62/182 (34%), Gaps = 5/182 (2%)

Query: 18  LAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIITEPITEKILNSEDIIVRS 77
           L   +   L++C   N P  + D     +  ++  +   L + +          +I+V  
Sbjct: 4   LLPFVLVLLAACG-SNGPRYLLDRAPVDEAAKTRVKAGTLEVMDVSLPTYAEDAEIMVED 62

Query: 78  SPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFEI 137
               +  +  + W+D   R I   L+         +T  +P   + +  Q    +R  E+
Sbjct: 63  GNGALSPVKNALWADDPGRAITQLLVDQIGRTSTATTAAEP-WPLESPPQAAVHVRVSEM 121

Query: 138 NIDRHCAIITMSLKIINAHDNSLVGQKV--FHVEEKLEKDNKLHFIQSLNRAFSRISSEI 195
                 +   +  +   +    +V +++  F V   L          + + A   +S+ I
Sbjct: 122 VASASGSF-DLRGQFAISSYGYVVRERIEPFAVSVPLADTKPGTIAAASSAALRELSAVI 180

Query: 196 ID 197
           + 
Sbjct: 181 VR 182


>gi|253687836|ref|YP_003017026.1| hypothetical protein PC1_1444 [Pectobacterium carotovorum subsp.
           carotovorum PC1]
 gi|251754414|gb|ACT12490.1| protein of unknown function DUF330 [Pectobacterium carotovorum
           subsp. carotovorum PC1]
          Length = 208

 Score = 40.7 bits (94), Expect = 0.12,   Method: Composition-based stats.
 Identities = 19/135 (14%), Positives = 46/135 (34%), Gaps = 7/135 (5%)

Query: 14  ISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIITEPITEKILNSEDI 73
           ++  L++ +  SLS+C       +      S     +      + +      + L++  +
Sbjct: 4   VTLLLSLAVIASLSACSSPPVRYHTLLAPASPTATTAHSVPFFIDVLPVGVPEQLDTSQL 63

Query: 74  IVRSSPIEIQYLIGSQWSDKLPRMIQ----LKLIANFENNGKISTVVKPNQGIYADYQII 129
           ++R        L   +W   L   I+      L+        +S +++P        +I 
Sbjct: 64  VIRQGDSGAVVLDNERWLSPLGEEIRTALSANLVQRLHTQD-VSGLMRPTGIPV--VRIH 120

Query: 130 SAIRSFEINIDRHCA 144
             +R F+    +  A
Sbjct: 121 LQVRRFDSWPGQSVA 135


>gi|317181146|dbj|BAJ58932.1| hypothetical protein HPF32_1350 [Helicobacter pylori F32]
          Length = 225

 Score = 40.7 bits (94), Expect = 0.12,   Method: Composition-based stats.
 Identities = 27/124 (21%), Positives = 51/124 (41%), Gaps = 5/124 (4%)

Query: 15  SCSLAVLLCTSLSSCFFHNNP-VNIYDLTESTKYDESVQRHIQ-LIITEPITEKILNSED 72
           S +LA+LL   LS       P +  YDL  S+       + +  + +   ++  + N+++
Sbjct: 12  SSALALLLQGCLSINLKQMLPEIRTYDLNASSFEITQCHKPLTEVRLISILSADLFNTKE 71

Query: 73  IIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYAD-YQIISA 131
           I+ ++   +I +    +W D    M++   +   E       V  P  G  A  Y +   
Sbjct: 72  IVFKAKDGQITHGKHQKWIDLPRNMLKTMFMQ--EAQKACLGVALPPYGAGAPTYAVRFT 129

Query: 132 IRSF 135
           I SF
Sbjct: 130 ILSF 133


>gi|311280146|ref|YP_003942377.1| hypothetical protein Entcl_2845 [Enterobacter cloacae SCF1]
 gi|308749341|gb|ADO49093.1| protein of unknown function DUF330 [Enterobacter cloacae SCF1]
          Length = 188

 Score = 40.7 bits (94), Expect = 0.13,   Method: Composition-based stats.
 Identities = 32/191 (16%), Positives = 76/191 (39%), Gaps = 8/191 (4%)

Query: 16  CSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQ--LIITEPITEKILNSEDI 73
               V+ C   +     ++    Y L  +    +S        L + +      L    +
Sbjct: 4   WLPVVVACLLSACSSSGSDSKTYYQLPLAQAGAQSSASQNSHLLWVEQVSIPDYLAGNGV 63

Query: 74  IVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIR 133
           + ++S ++      + W+  L + ++  L+AN  N      V     G   D  +  ++ 
Sbjct: 64  VYQTSDVQYVIATNNLWASPLDQQLRTTLVANLSNQLPGWVVASQPLGSDQD-TLNVSVS 122

Query: 134 SFEINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISS 193
            F    D     + +S + +  H   L+ ++ FH+E K  +D     +++L +A+S+ ++
Sbjct: 123 GFHGRYDG---RVIVSGEWLLKHQGQLI-KRPFHIELKQPQDGYDAMVKTLAQAWSQEAA 178

Query: 194 EIIDWTLSSLP 204
            +   +++ LP
Sbjct: 179 AMAQ-SINRLP 188


>gi|54293185|ref|YP_125600.1| hypothetical protein lpl0231 [Legionella pneumophila str. Lens]
 gi|53753017|emb|CAH14460.1| hypothetical protein lpl0231 [Legionella pneumophila str. Lens]
          Length = 241

 Score = 40.7 bits (94), Expect = 0.13,   Method: Composition-based stats.
 Identities = 39/198 (19%), Positives = 77/198 (38%), Gaps = 16/198 (8%)

Query: 9   IKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQR--HIQLIITEPITEK 66
           ++KK +   L + +  +L  C         Y LT  +    S     H+Q+ + E     
Sbjct: 45  LRKKPVKFLLILFIALTLCDCGRSKE-TQFYLLTPISPQKNSRNSYNHLQIGVDEVSIPD 103

Query: 67  ILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQG----I 122
            +    +++  +P  +     +QW+  L + I L L  N   +  +  VV          
Sbjct: 104 YMKKPQLMIHQTPHHLTLEEFNQWAGALDKNITLVLTTNL--STLMPGVVVQTSPWNNKF 161

Query: 123 YADYQIISAIRSFEINIDRHCAIITMSLKIINAHDNSLV--GQKVFHVEEKLEKDNKLHF 180
           + DY +   I  FEI+I  +    T+  +        L+  G   +H++  L   +    
Sbjct: 162 HPDYHLQVMISQFEIDIHGNS---TLRAEYFIYRKEELIYKGNAYYHIKVPL--ISIETL 216

Query: 181 IQSLNRAFSRISSEIIDW 198
           +QS+N   + ++ EI  +
Sbjct: 217 VQSMNTNLTHLTEEIARF 234


>gi|157369990|ref|YP_001477979.1| hypothetical protein Spro_1747 [Serratia proteamaculans 568]
 gi|157321754|gb|ABV40851.1| protein of unknown function DUF330 [Serratia proteamaculans 568]
          Length = 185

 Score = 40.7 bits (94), Expect = 0.13,   Method: Composition-based stats.
 Identities = 31/183 (16%), Positives = 65/183 (35%), Gaps = 10/183 (5%)

Query: 18  LAVLLCTSLSSCFFHNNPVNIY-DLTE--STKYDESVQRHIQLIITEPITEKILNSEDII 74
           + V L   LS+C   + P   Y  L    S           QL +        L    ++
Sbjct: 5   IPVALALLLSACS--STPQKTYYQLPALGSPAQVSGSTTSRQLWLEHVSVADYLAQSGVV 62

Query: 75  VRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRS 134
            +++ ++      + W+  L + +Q  L+ N  +      V         D  +   I  
Sbjct: 63  YQTNDVQYVIAQNNLWASPLDQQLQQTLVTNLSSALPGWVVSSQPMSSEQDV-LNVTISG 121

Query: 135 FEINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSE 194
           F    D   AII     + +  +   + ++ F +E K  +D     +++L + + + + +
Sbjct: 122 FHGRFDGK-AIIRGEWVLNHQGN---LTKRPFSLELKQGEDGYDALVRTLAQGWQQEAQD 177

Query: 195 IID 197
           I  
Sbjct: 178 IAA 180


>gi|15600156|ref|NP_253650.1| hypothetical protein PA4963 [Pseudomonas aeruginosa PAO1]
 gi|9951245|gb|AAG08348.1|AE004909_4 hypothetical protein PA4963 [Pseudomonas aeruginosa PAO1]
          Length = 236

 Score = 40.3 bits (93), Expect = 0.15,   Method: Composition-based stats.
 Identities = 27/185 (14%), Positives = 64/185 (34%), Gaps = 8/185 (4%)

Query: 16  CSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIITEPITEKILNSEDIIV 75
             L+++    L+ C  H  P  +Y L               +++        L  + ++ 
Sbjct: 8   ACLSLVSLLGLTGCAVHP-PAQLYQLDVGAAAVPKKDGGAAVLLGPVQLADYLKRDVMVQ 66

Query: 76  RSSPIEIQYLIGSQWSDKLPRMIQLKLIANF--ENNGKISTVVKPNQGIYADYQIISAIR 133
           R +   +     ++W+  L   +  +L+     E       +     G     Q++  I 
Sbjct: 67  RQADGILSLSTDARWAGNLETNVSQQLLRQMSSELGSSRLALFPEKPGFTPQVQVMLTIS 126

Query: 134 SFEINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEK---LEKDNKLHFIQSLNRAFSR 190
             +    +  A+I    ++++     L   +VFH EE+      D        L R  ++
Sbjct: 127 RLDS-GPKQPAVIEARWRLLDQK-GDLKDSRVFHEEEQHQGSIGDQIRAQSDLLKRLAAQ 184

Query: 191 ISSEI 195
           ++ ++
Sbjct: 185 LAKDV 189


>gi|300921008|ref|ZP_07137395.1| conserved hypothetical protein [Escherichia coli MS 115-1]
 gi|300411999|gb|EFJ95309.1| conserved hypothetical protein [Escherichia coli MS 115-1]
          Length = 187

 Score = 40.3 bits (93), Expect = 0.15,   Method: Composition-based stats.
 Identities = 29/181 (16%), Positives = 63/181 (34%), Gaps = 7/181 (3%)

Query: 18  LAVLLCTSLSSCFFHNNPVNIYDLTESTKYDES--VQRHIQLIITEPITEKILNSEDIIV 75
           L  +    L+ C       N Y L       +S   Q +  L + +      L    ++ 
Sbjct: 5   LVTIAALWLAGCSSGEINKNYYQLPVVQGGTQSTASQGNRLLWVEQVTVPDYLAGNGVVY 64

Query: 76  RSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSF 135
           ++S ++      + W+  L + ++  L+AN         V     G   D  +   +  F
Sbjct: 65  QTSDVKYVIANNNLWASPLDQQLRNTLVANLSTQLPGWVVASQPLGSAQD-TLNVTVTEF 123

Query: 136 EINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEI 195
               D    +I     ++N     +  ++ F +E    +D     ++ L   +S+ ++ I
Sbjct: 124 NGRYDGK--VIVSGEWLLNHQGQLI--KRPFRLEGVQTQDGYDEMVKVLASVWSQEAASI 179

Query: 196 I 196
            
Sbjct: 180 A 180


>gi|271501398|ref|YP_003334423.1| hypothetical protein Dd586_2883 [Dickeya dadantii Ech586]
 gi|270344953|gb|ACZ77718.1| protein of unknown function DUF330 [Dickeya dadantii Ech586]
          Length = 201

 Score = 40.3 bits (93), Expect = 0.15,   Method: Composition-based stats.
 Identities = 34/199 (17%), Positives = 73/199 (36%), Gaps = 23/199 (11%)

Query: 14  ISCSLAVLLCTSLSSCFFHNNPVNI---YDLTESTKYDESVQRHIQLIITEPITEKILNS 70
           +  SL + + + L+ C   +   +    YD + S            L +  P     L+S
Sbjct: 3   VVLSLILGVTSVLAGCSSPHVRYHTLVSYD-SVSHMVTPPEFVIDLLPVGVP---AQLDS 58

Query: 71  EDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYAD----- 125
           + ++VR S   +  L   +W   L   +Q  L  +     +++TV     G+  D     
Sbjct: 59  QQVVVRQSNSRMVVLDDDRWLSPLGDELQTAL--SLGMTQQLNTV--DVAGLARDNRKPV 114

Query: 126 YQIISAIRSFEINIDRHCAI-ITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSL 184
            +++  +R F+       ++    SL I     N  +  +  ++ + +   +      + 
Sbjct: 115 VRVLIQVRRFDNWPGNAVSLYAEWSLSIQQEGKNRRLVCRS-NITQPVAG-DPAQIFSAG 172

Query: 185 NRAFSRISSEI----IDWT 199
            +   R+S +I     DW 
Sbjct: 173 QQVVKRLSIQIGQVATDWV 191


>gi|116053112|ref|YP_793431.1| hypothetical protein PA14_65590 [Pseudomonas aeruginosa UCBPP-PA14]
 gi|296391803|ref|ZP_06881278.1| hypothetical protein PaerPAb_26779 [Pseudomonas aeruginosa PAb1]
 gi|115588333|gb|ABJ14348.1| conserved hypothetical protein [Pseudomonas aeruginosa UCBPP-PA14]
          Length = 236

 Score = 40.3 bits (93), Expect = 0.16,   Method: Composition-based stats.
 Identities = 27/185 (14%), Positives = 64/185 (34%), Gaps = 8/185 (4%)

Query: 16  CSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIITEPITEKILNSEDIIV 75
             L+++    L+ C  H  P  +Y L               +++        L  + ++ 
Sbjct: 8   ACLSLVSLLGLTGCAVHP-PAQLYQLDVGAAAVPKKDGGAAVLLGPVQLADYLKRDVMVQ 66

Query: 76  RSSPIEIQYLIGSQWSDKLPRMIQLKLIANF--ENNGKISTVVKPNQGIYADYQIISAIR 133
           R +   +     ++W+  L   +  +L+     E       +     G     Q++  I 
Sbjct: 67  RQADGILSLSTDARWAGNLETNVSQQLLRQMSSELGSSRLALFPEKPGFTPQVQVMLTIS 126

Query: 134 SFEINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEK---LEKDNKLHFIQSLNRAFSR 190
             +    +  A+I    ++++     L   +VFH EE+      D        L R  ++
Sbjct: 127 RLDS-GPKQPAVIEARWRLLDQK-GDLKDSRVFHEEERHQGSIGDQIRAQSDLLKRLAAQ 184

Query: 191 ISSEI 195
           ++ ++
Sbjct: 185 LAKDV 189


>gi|270264503|ref|ZP_06192769.1| putative lipoprotein [Serratia odorifera 4Rx13]
 gi|270041639|gb|EFA14737.1| putative lipoprotein [Serratia odorifera 4Rx13]
          Length = 197

 Score = 40.3 bits (93), Expect = 0.17,   Method: Composition-based stats.
 Identities = 30/161 (18%), Positives = 53/161 (32%), Gaps = 9/161 (5%)

Query: 15  SCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIITEPITEKI-LNSEDI 73
           S    ++L  SL++C   +  V+ + L         VQ    LI   P+     ++   +
Sbjct: 5   SRLCFLMLMVSLTACSSPS--VHYHTLVAPAADPPPVQPAPFLIAVLPVGIPPQIDLSQL 62

Query: 74  IVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANF-ENNGKISTVVKPNQGIYADYQIISAI 132
           +VR        L   +W   L   I+  L A   +  G          G     +I   I
Sbjct: 63  VVRQGQSGALVLENERWLSPLGDEIRTALSAELAQRLGTQDVAGLAKAGESTTVRIQLEI 122

Query: 133 RSFEINIDRHCAIITMSLKI-INAHDNSLV-GQKVFHVEEK 171
           R F+    R    + +     +N     LV   ++    + 
Sbjct: 123 RRFDAWPGR---AVELDAGWSLNVQGRRLVCRSRLTQAVQP 160


>gi|315123361|ref|YP_004065367.1| hypothetical protein PSM_B0421 [Pseudoalteromonas sp. SM9913]
 gi|315017121|gb|ADT70458.1| conserved hypothetical protein [Pseudoalteromonas sp. SM9913]
          Length = 202

 Score = 40.3 bits (93), Expect = 0.17,   Method: Composition-based stats.
 Identities = 27/188 (14%), Positives = 56/188 (29%), Gaps = 12/188 (6%)

Query: 15  SCSLAVLLCTSLSSCFFH-NNPVNIYDLTESTKYDES--VQRHIQLIITEPITEKILNSE 71
           +  L +     +S C       +  Y   +              QL +        LN+ 
Sbjct: 3   ALFLLLTGVIFISGCSSAIQTTIQYYQFEQPINDSSRNVQDTQAQLRVQTVTLRGALNNR 62

Query: 72  DIIVRSSPIEIQYLIGSQWSDKLPRMI----QLKLIANFENNGKIST-VVKPNQGIYADY 126
            I ++    +I       W +    M+    Q  L     N   I    V  +Q     Y
Sbjct: 63  GIAMKVDSNQIHAANYHLWGESPDVMLSASAQQTLFNTMTNWMVIKGLPVITDQQQQTFY 122

Query: 127 QIISAIRSFEINIDRHCAIITMSLKIIN---AHDNSLVGQKVFHVEEKLEKDNKLHFIQS 183
           ++   +  F  ++  + A I+   ++          L+    F     +  D     + +
Sbjct: 123 ELEYELHHFNGDLQGN-ADISGLWRLYYTHPESGRRLLSIHNFSSVMPINDDGYDSLVAT 181

Query: 184 LNRAFSRI 191
           L + + +I
Sbjct: 182 LEKMWQQI 189


>gi|318606227|emb|CBY27725.1| putative lipoprotein protein YPO1422 [Yersinia enterocolitica
           subsp. palearctica Y11]
          Length = 183

 Score = 40.3 bits (93), Expect = 0.17,   Method: Composition-based stats.
 Identities = 25/134 (18%), Positives = 51/134 (38%), Gaps = 9/134 (6%)

Query: 18  LAVLLCTSLSSCFFHNNPVNIY-DLTE--STKYDESVQRHIQLIITEPITEKILNSEDII 74
           +AV+    LS+C   + P   Y  L    +     S     QL +        L +  ++
Sbjct: 5   MAVIAALLLSACS--STPSKTYYQLPALSAPAGATSSVASRQLWVEHVSVADYLAAAGVV 62

Query: 75  VRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADY-QIISAIR 133
            +++ ++      + W+  L + +Q  L+ N  N   +   +  +Q + +D   +   + 
Sbjct: 63  YQTNDVQYVIASNNLWASPLDQQLQQTLVTNLSNA--LPGWLVSSQPLDSDQDVLNITVT 120

Query: 134 SFEINIDRHCAIIT 147
            F    D   AII 
Sbjct: 121 GFHGRYDGR-AIIR 133


>gi|194435233|ref|ZP_03067458.1| putative lipoprotein [Shigella dysenteriae 1012]
 gi|194416522|gb|EDX32666.1| putative lipoprotein [Shigella dysenteriae 1012]
 gi|332095906|gb|EGJ00913.1| hypothetical protein SD15574_1297 [Shigella dysenteriae 155-74]
          Length = 187

 Score = 40.3 bits (93), Expect = 0.17,   Method: Composition-based stats.
 Identities = 30/181 (16%), Positives = 65/181 (35%), Gaps = 7/181 (3%)

Query: 18  LAVLLCTSLSSCFFHNNPVNIYDLTEST--KYDESVQRHIQLIITEPITEKILNSEDIIV 75
           L  +    L+ C       N Y L      K   + Q +  L + +      L    ++ 
Sbjct: 5   LVTIAALWLAGCSSGEINKNYYQLPVVQSGKQSTASQGNRLLWVEQVTVPDYLAGNGMVY 64

Query: 76  RSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSF 135
           ++S ++      + W+  L + ++  L+AN         V     G   D  +   +  F
Sbjct: 65  QTSDVKYVIANNNLWASPLDQQLRNTLVANLSTQLPGWVVASQPLGSAQD-MLNVTVTEF 123

Query: 136 EINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEI 195
               D     + +S + +  H   L+ ++ F +E    +D     ++ L   +S+ ++ I
Sbjct: 124 NGRYDGK---VIVSGEWLLNHQGQLI-KRPFRLEGVQTQDGYDEMVKVLASVWSQEAASI 179

Query: 196 I 196
            
Sbjct: 180 A 180


>gi|117618513|ref|YP_858242.1| hypothetical protein AHA_3794 [Aeromonas hydrophila subsp.
           hydrophila ATCC 7966]
 gi|117559920|gb|ABK36868.1| conserved hypothetical protein [Aeromonas hydrophila subsp.
           hydrophila ATCC 7966]
          Length = 189

 Score = 40.3 bits (93), Expect = 0.18,   Method: Composition-based stats.
 Identities = 21/175 (12%), Positives = 60/175 (34%), Gaps = 6/175 (3%)

Query: 25  SLSSCFFHNNPVNIYDLTESTKYDES--VQRHIQLIITEPITEKILNSEDIIVRSSPIEI 82
            L+ C      ++ Y L    +   +   Q   QL++        L+   ++ +    E+
Sbjct: 13  LLAGCSSAPTQLHYYSLDAEAQQPAAVVAQPQHQLVLKPVSLSGQLDRMSLVYQLEGKEL 72

Query: 83  QYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFEINIDRH 142
            +    +W+  L   +    +     + ++   V    G      +  ++  F+   D  
Sbjct: 73  HFAEYHRWAGSLDAQLDQLTLNGL--SSRLPGWVVRQDGARKGPVLTISVERFQGRHDGR 130

Query: 143 CAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEIID 197
            A+++   +++   + +++    F     L  D     +  L   + ++  +I  
Sbjct: 131 -AVLSGRWRLL-TEEGTVLRDVPFQQVRVLPADGYGTLVSELGAGWQQLLDQIAA 183


>gi|114771205|ref|ZP_01448625.1| metallopeptidase, family M24 [alpha proteobacterium HTCC2255]
 gi|114548130|gb|EAU51017.1| metallopeptidase, family M24 [alpha proteobacterium HTCC2255]
          Length = 379

 Score = 40.3 bits (93), Expect = 0.18,   Method: Composition-based stats.
 Identities = 30/158 (18%), Positives = 54/158 (34%), Gaps = 21/158 (13%)

Query: 1   MDKKLNKIIKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIIT 60
           M +       +  +S +  +++  +LS+      P   Y     T++ +S  R   LI+ 
Sbjct: 2   MQRGFLDKEFQNRVSLAQGLMVKNNLSALLLTTEPDVRYFTGFLTQFWQSPARPWFLIV- 60

Query: 61  EPITEKILNSEDIIVRSSPIEIQYLIGSQWSDK-----LPRMIQL---KLIANFE---NN 109
            P + K      I V  S      L+ S W D       P M+      LI        +
Sbjct: 61  -PASGKP-----IAVIPSIG--YSLMNSTWIDDIRTWLAPNMVDDGIGLLIDTLNEVAKD 112

Query: 110 GKISTVVKPNQGIYADYQIISAIRSFEINIDRHCAIIT 147
           G+I         +   Y  +  +   E++I     I+ 
Sbjct: 113 GRIGIPDGLESHVRMPYADMKKLSE-EVDISSDYGIVR 149


>gi|50085793|ref|YP_047303.1| hypothetical protein ACIAD2734 [Acinetobacter sp. ADP1]
 gi|49531769|emb|CAG69481.1| conserved hypothetical protein [Acinetobacter sp. ADP1]
          Length = 217

 Score = 39.9 bits (92), Expect = 0.18,   Method: Composition-based stats.
 Identities = 30/208 (14%), Positives = 71/208 (34%), Gaps = 32/208 (15%)

Query: 21  LLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHI--QLIITEPITEKILNSEDIIVRSS 78
           +L   LS+C     P N Y LT       S    +   L +  P     L+   ++++ +
Sbjct: 1   MLPVLLSACSGSPTP-NYYSLTPQVMPLASSSVRVIEVLPVGLPD---RLSRSPLVIQET 56

Query: 79  PIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYA---DYQIISAIRSF 135
             + + L   +W+      ++  L A  +   K+  V + + G+      Y+I +    F
Sbjct: 57  NGQSKVLDNERWTSTFDAELRDGLSAGLQQ--KLGAVDRYSSGMTGGKVSYRIATDFSRF 114

Query: 136 EI--NIDRHCAIITMSLKIINAHDNSLVG-------------QK------VFHVEEKLEK 174
           +I    +     I +++  I   D+                  +       F  +     
Sbjct: 115 DIVKQAESGNLNIDVAVAWIIKRDDPAKALTLPANASQAADWSRQLSCRLAFQQKVSKGG 174

Query: 175 DNKLHFIQSLNRAFSRISSEIIDWTLSS 202
                 +++ + A +++   +    ++S
Sbjct: 175 HETREIVRASSLALNQVVEAVSASVIAS 202


>gi|90023426|ref|YP_529253.1| hypothetical protein Sde_3786 [Saccharophagus degradans 2-40]
 gi|89953026|gb|ABD83041.1| Curli production assembly/transport component CsgG [Saccharophagus
           degradans 2-40]
          Length = 321

 Score = 39.9 bits (92), Expect = 0.18,   Method: Composition-based stats.
 Identities = 35/181 (19%), Positives = 56/181 (30%), Gaps = 36/181 (19%)

Query: 12  KIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIITEPITEKILNSE 71
           KI++  L V L  S +S       V            E  QR  Q  + E    K L  +
Sbjct: 2   KIVTTGLMVALLCSCASQDPRLKDVE-------PTISEQQQREAQAKLLEAQATKTLALK 54

Query: 72  D-IIVRSSPIEIQY---LIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPN-------- 119
             I V     E  Y   L+GS  +D L   +    + +  N+G      +P+        
Sbjct: 55  RKIAVGRLSNETSYGKSLLGSSKNDVLGEKVSDMFVQSLANSGNYLIFERPDLELLENEA 114

Query: 120 -------QGIYADYQIISAIRSFEINIDR----------HCAIITMSLKIINAHDNSLVG 162
                    I  D  +I ++  F  N               A  T+ L+++      +  
Sbjct: 115 RLTGETVNLIGVDTLVIGSLTQFGRNTTGESGFLSSSKKQEATATVDLRLVETKTGRVFA 174

Query: 163 Q 163
            
Sbjct: 175 S 175


>gi|89092165|ref|ZP_01165120.1| hypothetical protein MED92_08356 [Oceanospirillum sp. MED92]
 gi|89083900|gb|EAR63117.1| hypothetical protein MED92_08356 [Oceanospirillum sp. MED92]
          Length = 194

 Score = 39.9 bits (92), Expect = 0.20,   Method: Composition-based stats.
 Identities = 21/159 (13%), Positives = 61/159 (38%), Gaps = 7/159 (4%)

Query: 39  YDLTESTKYDESVQRHIQLIITEPITEKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMI 98
           Y L+  ++          + ++       +N+  I + +    I+      W+++ P + 
Sbjct: 31  YLLSSDSQSYTKSDTRSVIGVSPVNVAAYINTPGIALLTKENHIRIANHHLWAEQ-PDLA 89

Query: 99  QLKLIAN-FENNGKISTVVKPNQGIYAD--YQIISAIRSFEINIDRHCAIITMSLKIINA 155
             +++ +  +     S V     G  +D  Y I + I  F        A+++   +  N 
Sbjct: 90  ISRVLHSELDALLPHSRVDSGELGRQSDWQYTITTQIDQFHGTASG-EAVLSGFWQFKNE 148

Query: 156 HDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSE 194
               ++  + F++++ + K      + SL    ++++ +
Sbjct: 149 --QRVLVTQRFNMKQPIGKPGYAPLVDSLRELLTQLAEQ 185


>gi|307638116|gb|ADN80566.1| hypothetical protein hp908_1445 [Helicobacter pylori 908]
 gi|325996716|gb|ADZ52121.1| hypothetical protein hp2018_1399 [Helicobacter pylori 2018]
 gi|325998310|gb|ADZ50518.1| hypothetical protein hp2017_1397 [Helicobacter pylori 2017]
          Length = 225

 Score = 39.9 bits (92), Expect = 0.21,   Method: Composition-based stats.
 Identities = 19/102 (18%), Positives = 41/102 (40%), Gaps = 4/102 (3%)

Query: 36  VNIYDLTESTKYDESVQRHIQ-LIITEPITEKILNSEDIIVRSSPIEIQYLIGSQWSDKL 94
           +  YDL  S+       + +  + +   ++  + N+++I+ ++   +I +    +W D  
Sbjct: 34  IRTYDLNASSFEMTQCPKPLTEVRLISILSADLFNTKEIVFKAQDGQITHGKHQKWIDLP 93

Query: 95  PRMIQLKLIANFENNGKISTVVKPNQGIYAD-YQIISAIRSF 135
             M++   +   E       V  P  G  A  Y +   I SF
Sbjct: 94  RNMLKTMFMQ--EAQKACLGVALPPYGAGAPTYAVRFTILSF 133


>gi|297569474|ref|YP_003690818.1| protein of unknown function DUF330 [Desulfurivibrio alkaliphilus
           AHT2]
 gi|296925389|gb|ADH86199.1| protein of unknown function DUF330 [Desulfurivibrio alkaliphilus
           AHT2]
          Length = 228

 Score = 39.9 bits (92), Expect = 0.22,   Method: Composition-based stats.
 Identities = 27/199 (13%), Positives = 65/199 (32%), Gaps = 30/199 (15%)

Query: 27  SSCFFHNNPVNI---YDLTESTKYDESVQRHIQLIITEPITEKILNS--------EDIIV 75
           S C     P      Y+L      DE +   +++    P  E ++ S          +  
Sbjct: 15  SGCGLVAEPPPAPAYYELRLPLPQDEPLANTVRVGQAGPRVEVLVPSWLRSRTMQYRLAY 74

Query: 76  RSSP-IEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGI------------ 122
           R    +  +    S+W  +   MI   L   F N G+++      +G             
Sbjct: 75  RDDGELRRREYRESRWVAEPGEMIARSLERYFAN-GRLTAEGDRPEGAEWPEPQALAAGL 133

Query: 123 ---YADYQIISAIRSFEINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLH 179
                   +   ++ F+   D H  ++ +  ++I+    +   ++ F   ++    +   
Sbjct: 134 ELCRLRLTLDEFVQIFQTASDSHT-LLEVRAELISPA-GTAASRRKFAFRQQAPSPDAFG 191

Query: 180 FIQSLNRAFSRISSEIIDW 198
            + +  R   +++  +  W
Sbjct: 192 GVVAHRRGLQQLAEALQGW 210


>gi|148261076|ref|YP_001235203.1| hypothetical protein Acry_2085 [Acidiphilium cryptum JF-5]
 gi|146402757|gb|ABQ31284.1| protein of unknown function DUF330 [Acidiphilium cryptum JF-5]
          Length = 184

 Score = 39.9 bits (92), Expect = 0.23,   Method: Composition-based stats.
 Identities = 25/184 (13%), Positives = 51/184 (27%), Gaps = 11/184 (5%)

Query: 16  CSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIITEPITEKILNSEDIIV 75
            +LA+ L   L+ C        IY     T       R   + +   +    ++   +  
Sbjct: 6   ATLAMALTLGLAGCAGQRT---IYLALSPTSGPTFHTRGAAIAVAHVLMPPTIDRIYLTT 62

Query: 76  RSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGI-YADYQIISAIRS 134
            + P        ++W+  L    Q  L  +         V  P   +  A   +   +  
Sbjct: 63  ATGPNTRAVSRRARWTAPLAGQAQAILARDLARRLPERRVAMPGDPVPRAALLVHVEVTD 122

Query: 135 FEINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQ---SLNRAFSRI 191
           F      H   + ++           V      + E+              +L R   RI
Sbjct: 123 F----IPHPGHVELAADWRGVRAGKAVAAGRVRIAERCGGGAAAEAHAMSVALGRLADRI 178

Query: 192 SSEI 195
           ++ +
Sbjct: 179 AARL 182


>gi|217031802|ref|ZP_03437305.1| hypothetical protein HPB128_199g10 [Helicobacter pylori B128]
 gi|298735568|ref|YP_003728089.1| hypothetical protein HPB8_68 [Helicobacter pylori B8]
 gi|216946454|gb|EEC25056.1| hypothetical protein HPB128_199g10 [Helicobacter pylori B128]
 gi|298354753|emb|CBI65625.1| conserved hypothetical protein [Helicobacter pylori B8]
          Length = 225

 Score = 39.9 bits (92), Expect = 0.23,   Method: Composition-based stats.
 Identities = 19/102 (18%), Positives = 41/102 (40%), Gaps = 4/102 (3%)

Query: 36  VNIYDLTESTKYDESVQRHIQ-LIITEPITEKILNSEDIIVRSSPIEIQYLIGSQWSDKL 94
           +  YDL  S+       + +  + +   ++  + N+++I+ ++   +I +    +W D  
Sbjct: 34  IRTYDLNASSFEITQCPKPLTEVRLISILSADLFNTKEIVFKAQDGQITHGKHQKWIDLP 93

Query: 95  PRMIQLKLIANFENNGKISTVVKPNQGIYAD-YQIISAIRSF 135
             M++   +   E       V  P  G  A  Y +   I SF
Sbjct: 94  RNMLKTMFMQ--EAQKACLGVALPPYGAGAPTYAVRFTILSF 133


>gi|329119773|ref|ZP_08248450.1| lipoprotein [Neisseria bacilliformis ATCC BAA-1200]
 gi|327464118|gb|EGF10426.1| lipoprotein [Neisseria bacilliformis ATCC BAA-1200]
          Length = 176

 Score = 39.6 bits (91), Expect = 0.24,   Method: Composition-based stats.
 Identities = 21/168 (12%), Positives = 54/168 (32%), Gaps = 18/168 (10%)

Query: 33  NNPVNIYDLTE-----STKYDESVQRHIQLIITEPITEKILNSEDIIVRSSPIEIQYLIG 87
           + P   + L +             +  +++++ EP+    L       +   +++ +   
Sbjct: 19  SPPAAYFTLPDSRFQMPEHTQGKSETAVRVVLAEPLNRGGL-----AYQPDALQLNHARS 73

Query: 88  SQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFEINIDRHCAIIT 147
             W+  L +    +    F   G       P     A   +   + +F+           
Sbjct: 74  HLWAQPLDQAAAARFANEFNRAGDARRYFVPAHQSSAAQSLTVYLEAFQGTYKGST---- 129

Query: 148 MSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEI 195
               ++  +  S  G + F  E     D     +QSL++  S  ++++
Sbjct: 130 ----VVEGYVRSDAGSRRFRAETPQRGDGYEAMLQSLSQGVSAAAAQV 173


>gi|281178076|dbj|BAI54406.1| conserved hypothetical protein [Escherichia coli SE15]
          Length = 187

 Score = 39.6 bits (91), Expect = 0.24,   Method: Composition-based stats.
 Identities = 29/181 (16%), Positives = 63/181 (34%), Gaps = 7/181 (3%)

Query: 18  LAVLLCTSLSSCFFHNNPVNIYDLTEST--KYDESVQRHIQLIITEPITEKILNSEDIIV 75
           L  +    L+ C       N Y L          + Q +  L + +      L    ++ 
Sbjct: 5   LVTIAALWLAGCSSGEINKNYYQLPVVQSGTQSTASQGNRLLWVEQVAVPDYLAGNGVVY 64

Query: 76  RSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSF 135
           ++S ++      + W+  L + ++  L+AN         V     G   D  +   +  F
Sbjct: 65  QTSDVKYVIANNNLWASPLDQQLRNTLVANLSTQLPGWVVASQPLGSAQD-TLNVTVTEF 123

Query: 136 EINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEI 195
               D    +I     ++N     +  ++ F +E    +D     ++ L R +S+ ++ I
Sbjct: 124 NGRYDGK--VIVSGEWLLNHQGQLI--KRPFRLEGVQTQDGYDEMVKVLARVWSQEAASI 179

Query: 196 I 196
            
Sbjct: 180 A 180


>gi|322832268|ref|YP_004212295.1| hypothetical protein Rahaq_1546 [Rahnella sp. Y9602]
 gi|321167469|gb|ADW73168.1| protein of unknown function DUF330 [Rahnella sp. Y9602]
          Length = 188

 Score = 39.6 bits (91), Expect = 0.25,   Method: Composition-based stats.
 Identities = 25/188 (13%), Positives = 65/188 (34%), Gaps = 15/188 (7%)

Query: 18  LAVLLCTSLSSCFFHNNPVNIYDLTESTKYDE------SVQRHIQLIITEPITEKILNSE 71
           + V+L   L++C   ++    Y L   +          +      L +        L   
Sbjct: 5   IPVVLALFLTACS-SSDQKTYYQLPVLSSTVTTGSVMSAGAVQRHLWVERVSVADYLAGS 63

Query: 72  DIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISA 131
            ++ +++ ++      + W+  L + +Q  L+     +   S V            +   
Sbjct: 64  GLVYQTNDVQYTLTQNNLWASPLDQQLQQALVTYLRRDLPGSLVSTQAANTDDQDVLNVN 123

Query: 132 IRSFEINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSL----NRA 187
           +  F    D    I+ +S       +  ++ Q+ F +  K  +D     +++L     + 
Sbjct: 124 VTGFHGRYDG---IVIVSGSWSLTRNGQMI-QRDFTLNLKQNEDGYDALVRTLATGWQQE 179

Query: 188 FSRISSEI 195
             +I+++I
Sbjct: 180 AGQIAAQI 187


>gi|209918204|ref|YP_002292288.1| hypothetical protein ECSE_1013 [Escherichia coli SE11]
 gi|260867124|ref|YP_003233526.1| hypothetical protein ECO111_1020 [Escherichia coli O111:H- str.
           11128]
 gi|293409330|ref|ZP_06652906.1| conserved hypothetical protein [Escherichia coli B354]
 gi|293433249|ref|ZP_06661677.1| lipoprotein ymbA [Escherichia coli B088]
 gi|301023080|ref|ZP_07186887.1| conserved hypothetical protein [Escherichia coli MS 69-1]
 gi|307311661|ref|ZP_07591301.1| protein of unknown function DUF330 [Escherichia coli W]
 gi|309795058|ref|ZP_07689478.1| conserved hypothetical protein [Escherichia coli MS 145-7]
 gi|209911463|dbj|BAG76537.1| conserved hypothetical protein [Escherichia coli SE11]
 gi|257763480|dbj|BAI34975.1| conserved predicted protein [Escherichia coli O111:H- str. 11128]
 gi|291324068|gb|EFE63490.1| lipoprotein ymbA [Escherichia coli B088]
 gi|291469798|gb|EFF12282.1| conserved hypothetical protein [Escherichia coli B354]
 gi|300397201|gb|EFJ80739.1| conserved hypothetical protein [Escherichia coli MS 69-1]
 gi|306908216|gb|EFN38715.1| protein of unknown function DUF330 [Escherichia coli W]
 gi|308121362|gb|EFO58624.1| conserved hypothetical protein [Escherichia coli MS 145-7]
 gi|315060237|gb|ADT74564.1| conserved hypothetical protein [Escherichia coli W]
 gi|323175420|gb|EFZ61015.1| hypothetical protein ECOK1180_5704 [Escherichia coli 1180]
 gi|323379203|gb|ADX51471.1| protein of unknown function DUF330 [Escherichia coli KO11]
 gi|324019036|gb|EGB88255.1| hypothetical protein HMPREF9542_02231 [Escherichia coli MS 117-3]
 gi|324117183|gb|EGC11091.1| hypothetical protein ERBG_02898 [Escherichia coli E1167]
          Length = 187

 Score = 39.6 bits (91), Expect = 0.26,   Method: Composition-based stats.
 Identities = 30/181 (16%), Positives = 65/181 (35%), Gaps = 7/181 (3%)

Query: 18  LAVLLCTSLSSCFFHNNPVNIYDLTESTKYDES--VQRHIQLIITEPITEKILNSEDIIV 75
           L  +    L+ C       N Y L       +S   Q +  L + +      L    ++ 
Sbjct: 5   LVTIAALWLAGCSSGEINKNYYQLPVVQSGTQSTASQGNRLLWVEQVTVPDYLAGNGVVY 64

Query: 76  RSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSF 135
           ++S ++      + W+  L + ++  L+AN         V     G   D  +   +  F
Sbjct: 65  QTSDVKYVIANNNLWASPLDQQLRNTLVANLSTQLPGWVVASQPLGSAQD-TLNVTVTEF 123

Query: 136 EINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEI 195
               D     + +S + +  H   L+ ++ F +E    +D     ++ L   +S+ ++ I
Sbjct: 124 NGRYDGK---VIVSGEWLLNHQGQLI-KRPFRLEGVQTQDGYDEMVKVLASVWSQEAASI 179

Query: 196 I 196
            
Sbjct: 180 A 180


>gi|308064222|gb|ADO06109.1| hypothetical protein HPSAT_07035 [Helicobacter pylori Sat464]
          Length = 225

 Score = 39.6 bits (91), Expect = 0.27,   Method: Composition-based stats.
 Identities = 19/102 (18%), Positives = 41/102 (40%), Gaps = 4/102 (3%)

Query: 36  VNIYDLTESTKYDESVQRHIQ-LIITEPITEKILNSEDIIVRSSPIEIQYLIGSQWSDKL 94
           +  YDL  S+       + +  + +   ++  + N+++I+ ++   +I +    +W D  
Sbjct: 34  IRTYDLNASSFEITQCPKPLTEVRLISILSADLFNTKEIVFKAKDGQITHGKHQKWIDLP 93

Query: 95  PRMIQLKLIANFENNGKISTVVKPNQGIYAD-YQIISAIRSF 135
             M++   +   E       V  P  G  A  Y +   I SF
Sbjct: 94  RNMLKTMFMQ--EAQKACLGVALPPYGAGAPTYAVRFTILSF 133


>gi|308062727|gb|ADO04615.1| hypothetical protein HPCU_07375 [Helicobacter pylori Cuz20]
          Length = 225

 Score = 39.6 bits (91), Expect = 0.27,   Method: Composition-based stats.
 Identities = 19/102 (18%), Positives = 41/102 (40%), Gaps = 4/102 (3%)

Query: 36  VNIYDLTESTKYDESVQRHIQ-LIITEPITEKILNSEDIIVRSSPIEIQYLIGSQWSDKL 94
           +  YDL  S+       + +  + +   ++  + N+++I+ ++   +I +    +W D  
Sbjct: 34  IRTYDLNASSFEITQCPKPLTEVRLISILSADLFNTKEIVFKAKDGQITHGKHQKWIDLP 93

Query: 95  PRMIQLKLIANFENNGKISTVVKPNQGIYAD-YQIISAIRSF 135
             M++   +   E       V  P  G  A  Y +   I SF
Sbjct: 94  RNMLKTMFMQ--EAQKACLGVALPPYGAGAPTYAVRFTILSF 133


>gi|188528235|ref|YP_001910922.1| hypothetical protein HPSH_07495 [Helicobacter pylori Shi470]
 gi|188144475|gb|ACD48892.1| hypothetical protein HPSH_07495 [Helicobacter pylori Shi470]
          Length = 225

 Score = 39.6 bits (91), Expect = 0.27,   Method: Composition-based stats.
 Identities = 19/102 (18%), Positives = 41/102 (40%), Gaps = 4/102 (3%)

Query: 36  VNIYDLTESTKYDESVQRHIQ-LIITEPITEKILNSEDIIVRSSPIEIQYLIGSQWSDKL 94
           +  YDL  S+       + +  + +   ++  + N+++I+ ++   +I +    +W D  
Sbjct: 34  IRTYDLNASSFEITQCPKPLTEVRLISILSADLFNTKEIVFKAKDGQITHGKHQKWIDLP 93

Query: 95  PRMIQLKLIANFENNGKISTVVKPNQGIYAD-YQIISAIRSF 135
             M++   +   E       V  P  G  A  Y +   I SF
Sbjct: 94  RNMLKTMFMQ--EAQKACLGVALPPYGAGAPTYAVRFTILSF 133


>gi|300902885|ref|ZP_07120830.1| hypothetical protein HMPREF9536_01030 [Escherichia coli MS 84-1]
 gi|301302432|ref|ZP_07208563.1| hypothetical protein HMPREF9347_01009 [Escherichia coli MS 124-1]
 gi|300405027|gb|EFJ88565.1| hypothetical protein HMPREF9536_01030 [Escherichia coli MS 84-1]
 gi|300842271|gb|EFK70031.1| hypothetical protein HMPREF9347_01009 [Escherichia coli MS 124-1]
 gi|315258000|gb|EFU37968.1| putative lipoprotein [Escherichia coli MS 85-1]
          Length = 187

 Score = 39.6 bits (91), Expect = 0.28,   Method: Composition-based stats.
 Identities = 20/130 (15%), Positives = 41/130 (31%), Gaps = 3/130 (2%)

Query: 18  LAVLLCTSLSSCFFHNNPVNIYDLTEST--KYDESVQRHIQLIITEPITEKILNSEDIIV 75
           L  +    L+ C       N Y L          + Q +  L + +      L    ++ 
Sbjct: 5   LVTIATLWLAGCSSGEINKNYYQLPVVQSGTQSTASQGNRLLWVEQVTVPDYLAGNGVVY 64

Query: 76  RSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSF 135
           ++S ++      + W+  L + ++  L+AN         V     G   D  +   +  F
Sbjct: 65  QTSDVKYVIANNNLWASPLDQQLRNTLVANLSTQLPGWVVASQPLGSAQD-TLNVTVTEF 123

Query: 136 EINIDRHCAI 145
               D    +
Sbjct: 124 NGRYDGKVIV 133


>gi|167585311|ref|ZP_02377699.1| ABC-type uncharacterized transport system auxiliary component-like
           protein [Burkholderia ubonensis Bu]
          Length = 109

 Score = 39.6 bits (91), Expect = 0.28,   Method: Composition-based stats.
 Identities = 13/105 (12%), Positives = 37/105 (35%), Gaps = 4/105 (3%)

Query: 1   MDKKLNKIIKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIIT 60
           M + L + ++    + +   L   +  +          YDL  +     + +    L + 
Sbjct: 6   MSRTLARTLRPAAAALAALTLALAAGCASENAALSNARYDLGPAGPVATAGRGP-ALKVL 64

Query: 61  EPITEKILNSEDIIVRS---SPIEIQYLIGSQWSDKLPRMIQLKL 102
           +    + L+S+  + R        +     S+W+    +++  +L
Sbjct: 65  DVAAPEALDSDKFVYRLAYADAQRMAVYRDSRWTAPPAQLLTQRL 109


>gi|300722569|ref|YP_003711859.1| hypothetical protein XNC1_1598 [Xenorhabdus nematophila ATCC 19061]
 gi|297629076|emb|CBJ89661.1| conserved hypothetical protein; putative exported protein
           [Xenorhabdus nematophila ATCC 19061]
          Length = 208

 Score = 39.6 bits (91), Expect = 0.28,   Method: Composition-based stats.
 Identities = 37/208 (17%), Positives = 69/208 (33%), Gaps = 19/208 (9%)

Query: 1   MDKKLNKIIKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHI----- 55
           M K + K+      S S  V+    +S C         Y L        S  + +     
Sbjct: 1   MKKLILKLAF--FTSVSAFVIGSVFISGCSSSQPQKTYYQLPVLPGKPASQGKSVSLEGK 58

Query: 56  -------QLIITEPITEKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFEN 108
                  QL +        L +  I+ ++  +         W+  L + +Q  LI+    
Sbjct: 59  LGAKHEPQLWVKSVNLSDYLAASGIVYQTGDVSYINASNHLWASPLQQQLQQLLISELSA 118

Query: 109 NGKISTVVKPNQGIYADYQIISAIRSFEINIDRHCAIITMSLKIINAHDNSLVGQKVFHV 168
                 V        A   +   I +F    D    I      I++  DN +  ++ F++
Sbjct: 119 AFPHRLVSGQELEKEA-VALDITITAFHGRYDGQVLIAGYW--ILSNSDNVI--KRPFNI 173

Query: 169 EEKLEKDNKLHFIQSLNRAFSRISSEII 196
           E K +KD     + +L + +S++   I 
Sbjct: 174 ELKQQKDGYAELVLTLAKGYSQLVQSIA 201


>gi|238749736|ref|ZP_04611241.1| Uncharacterized lipoprotein ymbA [Yersinia rohdei ATCC 43380]
 gi|238712391|gb|EEQ04604.1| Uncharacterized lipoprotein ymbA [Yersinia rohdei ATCC 43380]
          Length = 182

 Score = 39.6 bits (91), Expect = 0.29,   Method: Composition-based stats.
 Identities = 22/132 (16%), Positives = 49/132 (37%), Gaps = 8/132 (6%)

Query: 18  LAVLLCTSLSSCFFHNNPVNIY-DLTESTKYDESVQ--RHIQLIITEPITEKILNSEDII 74
           +AV+    LS+C   + P   Y  L   +    +       QL I        L +  ++
Sbjct: 1   MAVIAALLLSACS--SEPSKTYYQLPALSAPATASSSIASRQLWIEHVGVADYLAAAGVV 58

Query: 75  VRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADY-QIISAIR 133
            +++ ++      + W+  L + +Q  L+ N  N   +   +  +Q + +D   +   + 
Sbjct: 59  YQTNDVQYVIASNNLWASPLDQQLQQTLVTNLSNA--LPGWLVSSQPLDSDQDVLNVTVT 116

Query: 134 SFEINIDRHCAI 145
            F    D    +
Sbjct: 117 GFHGRYDGRAIV 128


>gi|121603102|ref|YP_980431.1| putative lipoprotein [Polaromonas naphthalenivorans CJ2]
 gi|120592071|gb|ABM35510.1| putative lipoprotein [Polaromonas naphthalenivorans CJ2]
          Length = 234

 Score = 39.6 bits (91), Expect = 0.30,   Method: Composition-based stats.
 Identities = 27/208 (12%), Positives = 68/208 (32%), Gaps = 26/208 (12%)

Query: 20  VLLCTSLSSCFFHNNP--VNIYD-----LTESTKYDESVQRHIQLIITEPITEKILNSED 72
           +     ++ C   + P    +YD     L        +       I     +   L+++ 
Sbjct: 30  IFALGLVAGCSVVDKPTRAALYDFGPGELPTQAAATPAPALPPLAIADIATSGGALDNQA 89

Query: 73  IIVRSS---PIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYAD---- 125
           ++ R       +++    ++WS    ++++ +L       G+   V    +G+  +    
Sbjct: 90  VLYRLGYLDAQQLRPYSQARWSMPPAQLLRQRLRER---LGQQRAVFNAREGVALNRSQN 146

Query: 126 ---YQIISAIRSFEINIDRHCA---IITMSLKIINA--HDNSLVGQKVFHVEEKLEKDNK 177
                +   +  F        A   +I +   ++        LV Q+   V+    + + 
Sbjct: 147 ANLLMLRLELEEFSQLFSAPDASVGLIRLHATLVEITPAGERLVAQRNLSVQRPATRADA 206

Query: 178 LHFIQSLNRAFSRISSEIIDWTLSSLPL 205
              +++L  A      E+  W L  +P 
Sbjct: 207 AGGVRALTAATDAAIDELDQW-LRQMPA 233


>gi|332162174|ref|YP_004298751.1| putative lipoprotein [Yersinia enterocolitica subsp. palearctica
           105.5R(r)]
 gi|325666404|gb|ADZ43048.1| putative lipoprotein protein [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|330860153|emb|CBX70474.1| uncharacterized lipoprotein ymbA [Yersinia enterocolitica W22703]
          Length = 183

 Score = 39.6 bits (91), Expect = 0.30,   Method: Composition-based stats.
 Identities = 25/134 (18%), Positives = 51/134 (38%), Gaps = 9/134 (6%)

Query: 18  LAVLLCTSLSSCFFHNNPVNIY-DLTE--STKYDESVQRHIQLIITEPITEKILNSEDII 74
           +AV+    LS+C   + P   Y  L    +     S     QL +        L +  ++
Sbjct: 5   MAVIAALLLSACS--SIPSKTYYQLPALSAPAGATSSVASRQLWVEHVSVADYLAAAGVV 62

Query: 75  VRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADY-QIISAIR 133
            +++ ++      + W+  L + +Q  L+ N  N   +   +  +Q + +D   +   + 
Sbjct: 63  YQTNDVQYVIASNNLWASPLDQQLQQTLVTNLSNA--LPGWLVSSQPLDSDQDVLNITVT 120

Query: 134 SFEINIDRHCAIIT 147
            F    D   AII 
Sbjct: 121 GFHGRYDGR-AIIR 133


>gi|193064667|ref|ZP_03045746.1| putative lipoprotein [Escherichia coli E22]
 gi|260843201|ref|YP_003220979.1| hypothetical protein ECO103_0998 [Escherichia coli O103:H2 str.
           12009]
 gi|192927724|gb|EDV82339.1| putative lipoprotein [Escherichia coli E22]
 gi|257758348|dbj|BAI29845.1| conserved predicted protein [Escherichia coli O103:H2 str. 12009]
 gi|323159583|gb|EFZ45563.1| hypothetical protein ECE128010_4199 [Escherichia coli E128010]
          Length = 187

 Score = 39.6 bits (91), Expect = 0.31,   Method: Composition-based stats.
 Identities = 20/130 (15%), Positives = 41/130 (31%), Gaps = 3/130 (2%)

Query: 18  LAVLLCTSLSSCFFHNNPVNIYDLTEST--KYDESVQRHIQLIITEPITEKILNSEDIIV 75
           L  +    L+ C       N Y L          + Q +  L + +      L    ++ 
Sbjct: 5   LVTIAALWLAGCSSGEINKNYYQLPVVQSGTQSTASQGNRLLWVEQITVPDYLAGNGVVY 64

Query: 76  RSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSF 135
           ++S ++      + W+  L + ++  L+AN         V     G   D  +   +  F
Sbjct: 65  QTSDVKYVIANNNLWASPLDQQLRNTLVANLSTQLPGWVVASQPLGSAQD-TLNVTVTEF 123

Query: 136 EINIDRHCAI 145
               D    +
Sbjct: 124 NGRYDGKVIV 133


>gi|24112365|ref|NP_706875.1| hypothetical protein SF0953 [Shigella flexneri 2a str. 301]
 gi|30062489|ref|NP_836660.1| hypothetical protein S1018 [Shigella flexneri 2a str. 2457T]
 gi|110804968|ref|YP_688488.1| hypothetical protein SFV_0961 [Shigella flexneri 5 str. 8401]
 gi|145698237|ref|NP_415472.2| conserved protein [Escherichia coli str. K-12 substr. MG1655]
 gi|157156583|ref|YP_001462185.1| hypothetical protein EcE24377A_1067 [Escherichia coli E24377A]
 gi|157160473|ref|YP_001457791.1| hypothetical protein EcHS_A1061 [Escherichia coli HS]
 gi|170020647|ref|YP_001725601.1| hypothetical protein EcolC_2644 [Escherichia coli ATCC 8739]
 gi|170080610|ref|YP_001729930.1| hypothetical protein ECDH10B_1022 [Escherichia coli str. K-12
           substr. DH10B]
 gi|188491869|ref|ZP_02999139.1| putative lipoprotein [Escherichia coli 53638]
 gi|193071862|ref|ZP_03052741.1| putative lipoprotein [Escherichia coli E110019]
 gi|238900210|ref|YP_002926006.1| hypothetical protein BWG_0804 [Escherichia coli BW2952]
 gi|253774019|ref|YP_003036850.1| hypothetical protein ECBD_2643 [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|256023346|ref|ZP_05437211.1| hypothetical protein E4_08229 [Escherichia sp. 4_1_40B]
 gi|293414232|ref|ZP_06656881.1| hypothetical protein ECDG_00785 [Escherichia coli B185]
 gi|297520185|ref|ZP_06938571.1| putative lipoprotein [Escherichia coli OP50]
 gi|300819195|ref|ZP_07099396.1| conserved hypothetical protein [Escherichia coli MS 107-1]
 gi|300925367|ref|ZP_07141253.1| hypothetical protein HMPREF9548_03446 [Escherichia coli MS 182-1]
 gi|300929651|ref|ZP_07145112.1| conserved hypothetical protein [Escherichia coli MS 187-1]
 gi|300949678|ref|ZP_07163660.1| conserved hypothetical protein [Escherichia coli MS 116-1]
 gi|300955394|ref|ZP_07167770.1| hypothetical protein HMPREF9547_01281 [Escherichia coli MS 175-1]
 gi|301022474|ref|ZP_07186353.1| conserved hypothetical protein [Escherichia coli MS 196-1]
 gi|301327220|ref|ZP_07220480.1| conserved hypothetical protein [Escherichia coli MS 78-1]
 gi|301643475|ref|ZP_07243523.1| conserved hypothetical protein [Escherichia coli MS 146-1]
 gi|307137582|ref|ZP_07496938.1| putative lipoprotein [Escherichia coli H736]
 gi|312971085|ref|ZP_07785264.1| conserved hypothetical protein [Escherichia coli 1827-70]
 gi|331651974|ref|ZP_08352993.1| putative lipoprotein [Escherichia coli M718]
 gi|150387816|sp|P0AB10|YMBA_ECOLI RecName: Full=Uncharacterized lipoprotein ymbA; Flags: Precursor
 gi|150387817|sp|P0AB11|YMBA_SHIFL RecName: Full=Uncharacterized lipoprotein ymbA; Flags: Precursor
 gi|24051232|gb|AAN42582.1| orf, conserved hypothetical protein [Shigella flexneri 2a str. 301]
 gi|30040735|gb|AAP16466.1| hypothetical protein S1018 [Shigella flexneri 2a str. 2457T]
 gi|110614516|gb|ABF03183.1| conserved hypothetical protein [Shigella flexneri 5 str. 8401]
 gi|145693109|gb|AAC74038.2| conserved protein [Escherichia coli str. K-12 substr. MG1655]
 gi|157066153|gb|ABV05408.1| putative lipoprotein [Escherichia coli HS]
 gi|157078613|gb|ABV18321.1| putative lipoprotein [Escherichia coli E24377A]
 gi|169755575|gb|ACA78274.1| protein of unknown function DUF330 [Escherichia coli ATCC 8739]
 gi|169888445|gb|ACB02152.1| conserved protein [Escherichia coli str. K-12 substr. DH10B]
 gi|188487068|gb|EDU62171.1| putative lipoprotein [Escherichia coli 53638]
 gi|192954824|gb|EDV85348.1| putative lipoprotein [Escherichia coli E110019]
 gi|238860456|gb|ACR62454.1| conserved protein [Escherichia coli BW2952]
 gi|253325063|gb|ACT29665.1| protein of unknown function DUF330 [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|260449902|gb|ACX40324.1| protein of unknown function DUF330 [Escherichia coli DH1]
 gi|281600314|gb|ADA73298.1| putative lipoprotein [Shigella flexneri 2002017]
 gi|291434290|gb|EFF07263.1| hypothetical protein ECDG_00785 [Escherichia coli B185]
 gi|299881237|gb|EFI89448.1| conserved hypothetical protein [Escherichia coli MS 196-1]
 gi|300317683|gb|EFJ67467.1| hypothetical protein HMPREF9547_01281 [Escherichia coli MS 175-1]
 gi|300418496|gb|EFK01807.1| hypothetical protein HMPREF9548_03446 [Escherichia coli MS 182-1]
 gi|300450918|gb|EFK14538.1| conserved hypothetical protein [Escherichia coli MS 116-1]
 gi|300462428|gb|EFK25921.1| conserved hypothetical protein [Escherichia coli MS 187-1]
 gi|300528214|gb|EFK49276.1| conserved hypothetical protein [Escherichia coli MS 107-1]
 gi|300846171|gb|EFK73931.1| conserved hypothetical protein [Escherichia coli MS 78-1]
 gi|301078189|gb|EFK92995.1| conserved hypothetical protein [Escherichia coli MS 146-1]
 gi|310336846|gb|EFQ02013.1| conserved hypothetical protein [Escherichia coli 1827-70]
 gi|313650800|gb|EFS15201.1| hypothetical protein SF2457T_0803 [Shigella flexneri 2a str. 2457T]
 gi|315135600|dbj|BAJ42759.1| hypothetical protein ECDH1ME8569_0903 [Escherichia coli DH1]
 gi|315619149|gb|EFU99729.1| conserved hypothetical protein [Escherichia coli 3431]
 gi|323938058|gb|EGB34320.1| hypothetical protein ERCG_00784 [Escherichia coli E1520]
 gi|323942868|gb|EGB39033.1| hypothetical protein ERDG_00736 [Escherichia coli E482]
 gi|323962839|gb|EGB58414.1| hypothetical protein ERGG_00694 [Escherichia coli H489]
 gi|323973171|gb|EGB68363.1| hypothetical protein ERHG_00830 [Escherichia coli TA007]
 gi|331050252|gb|EGI22310.1| putative lipoprotein [Escherichia coli M718]
          Length = 187

 Score = 39.6 bits (91), Expect = 0.31,   Method: Composition-based stats.
 Identities = 21/130 (16%), Positives = 42/130 (32%), Gaps = 3/130 (2%)

Query: 18  LAVLLCTSLSSCFFHNNPVNIYDLTESTKYDES--VQRHIQLIITEPITEKILNSEDIIV 75
           L  +    L+ C       N Y L       +S   Q +  L + +      L    ++ 
Sbjct: 5   LVTIAALWLAGCSSGEINKNYYQLPVVQSGTQSTASQGNRLLWVEQVTVPDYLAGNGVVY 64

Query: 76  RSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSF 135
           ++S ++      + W+  L + ++  L+AN         V     G   D  +   +  F
Sbjct: 65  QTSDVKYVIANNNLWASPLDQQLRNTLVANLSTQLPGWVVASQPLGSAQD-TLNVTVTEF 123

Query: 136 EINIDRHCAI 145
               D    +
Sbjct: 124 NGRYDGKVIV 133


>gi|330866702|gb|EGH01411.1| putative lipoprotein [Pseudomonas syringae pv. aesculi str.
           0893_23]
          Length = 143

 Score = 39.2 bits (90), Expect = 0.33,   Method: Composition-based stats.
 Identities = 25/138 (18%), Positives = 45/138 (32%), Gaps = 11/138 (7%)

Query: 74  IVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENN-GKISTVVKPNQGIYADYQIISAI 132
           +VR     +  L   +W   L       L    E + G       P         + + +
Sbjct: 1   MVRQGNGSLAILDTERWGSPLGDEFHDALTPQLERHFGSRDMAGLPKNSDQPVLSVRTDV 60

Query: 133 RSFEINIDRHCAIITMSLKIINAHDNSLVGQKV-----FHVEEKLEKDNKLHFIQSLNRA 187
           R FE  +  + A+I +   +      +  G K        V  +   +   + I +  +A
Sbjct: 61  RRFES-MPGNYALIDVVWTLGLRDAGATAGSKRQSLTCSSVIREQAGEGMENLIIAHQKA 119

Query: 188 FSRISSEIID----WTLS 201
            SR+S +I      WT  
Sbjct: 120 VSRLSDKIAATAASWTAQ 137


>gi|326404478|ref|YP_004284560.1| hypothetical protein ACMV_23310 [Acidiphilium multivorum AIU301]
 gi|325051340|dbj|BAJ81678.1| hypothetical protein ACMV_23310 [Acidiphilium multivorum AIU301]
          Length = 184

 Score = 39.2 bits (90), Expect = 0.34,   Method: Composition-based stats.
 Identities = 25/184 (13%), Positives = 51/184 (27%), Gaps = 11/184 (5%)

Query: 16  CSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIITEPITEKILNSEDIIV 75
            +LA+ L   L+ C        IY     T       R   + +   +    ++   +  
Sbjct: 6   ATLAMALTLGLAGCAGQRT---IYLALSPTSGPTFHTRGAAIAVAHVLMPPTIDRIYLTT 62

Query: 76  RSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGI-YADYQIISAIRS 134
            + P        ++W+  L    Q  L  +         V  P   +  A   +   +  
Sbjct: 63  ATGPNTRAVSRRARWTAPLAGQAQAILARDLARRLPERRVAMPGDPVPRAALLVHVEVTE 122

Query: 135 FEINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQ---SLNRAFSRI 191
           F      H   + ++           V      + E+              +L R   RI
Sbjct: 123 F----MPHPGHVELAADWRGVRAGKAVAAGRVRIAERCGGGAAAEAHAMSVALGRLADRI 178

Query: 192 SSEI 195
           ++ +
Sbjct: 179 AARL 182


>gi|92114131|ref|YP_574059.1| hypothetical protein Csal_2009 [Chromohalobacter salexigens DSM
           3043]
 gi|91797221|gb|ABE59360.1| protein of unknown function DUF330 [Chromohalobacter salexigens DSM
           3043]
          Length = 221

 Score = 39.2 bits (90), Expect = 0.34,   Method: Composition-based stats.
 Identities = 28/182 (15%), Positives = 66/182 (36%), Gaps = 11/182 (6%)

Query: 25  SLSSCFFHNNPVNIYDLTESTKYDESVQR------HIQLIITEPITEKILNSEDIIVRSS 78
           SL+ C         Y L +    D+             + ++       L+ + I+++  
Sbjct: 30  SLAGCATQGTEDTRYTLPDDPLSDDRAAAEAVGDFDGSVWLSPLSLTSYLDDQGIVMQLD 89

Query: 79  PIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADY-QIISAIR--SF 135
            I I       W++ L   +  +L          + +++  Q   A    +   +R   F
Sbjct: 90  DIRIHQARHHLWAEPLDSQLMRQLRERLSTALPEADILRRGQTAQAASPALHVDLRVERF 149

Query: 136 EINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEI 195
           +   D   A++    +I +A D   + ++ F +E  L+ D     +++L  A+  +   +
Sbjct: 150 QGRDDG-MAVVGGDWRIRDAQD-RTLSRESFAIERPLDSDGYPALVRALGGAWDTLGERL 207

Query: 196 ID 197
            +
Sbjct: 208 AE 209


>gi|170682434|ref|YP_001744217.1| putative lipoprotein [Escherichia coli SMS-3-5]
 gi|170520152|gb|ACB18330.1| putative lipoprotein [Escherichia coli SMS-3-5]
          Length = 187

 Score = 39.2 bits (90), Expect = 0.36,   Method: Composition-based stats.
 Identities = 29/181 (16%), Positives = 63/181 (34%), Gaps = 7/181 (3%)

Query: 18  LAVLLCTSLSSCFFHNNPVNIYDLTESTKYDES--VQRHIQLIITEPITEKILNSEDIIV 75
           L  +    L+ C       N Y L       +S   Q +  L + +      L    ++ 
Sbjct: 5   LVTIAALWLAGCSSGEINKNYYQLPVVQGGTQSTASQGNRLLWVEQVAVPDYLAGNGVVY 64

Query: 76  RSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSF 135
           ++S ++      + W+  L + ++  L+AN         V     G   D  +   +  F
Sbjct: 65  QTSDVKYVIANNNLWASPLDQQLRNTLVANLSTQLPGWVVASQPLGSAQD-TLNVTVTEF 123

Query: 136 EINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEI 195
               D    +I     ++N     +  ++ F +E    +D     ++ L   +S+ ++ I
Sbjct: 124 NGRYDGK--VIVSGEWLLNHQGQLI--KRPFRLEGVQTQDGYDEMVKVLASVWSQEAASI 179

Query: 196 I 196
            
Sbjct: 180 A 180


>gi|17545319|ref|NP_518721.1| hypothetical protein RSc0600 [Ralstonia solanacearum GMI1000]
 gi|17427611|emb|CAD14130.1| hypothetical protein of unknown function duf330 [Ralstonia
           solanacearum GMI1000]
          Length = 211

 Score = 39.2 bits (90), Expect = 0.36,   Method: Composition-based stats.
 Identities = 16/143 (11%), Positives = 50/143 (34%), Gaps = 1/143 (0%)

Query: 5   LNKIIKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIITEPIT 64
           + +  +   +  +        + +C      ++   L  +    E+ +      ++    
Sbjct: 2   MMRANRSSFLRLAGMAGAAALMGACASPEPTLHTLSLRAAAPAPEAARIQRAFRLSGVRV 61

Query: 65  EKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYA 124
            + L+   I++R+S  ++Q L   +W+      ++  L A   +      V         
Sbjct: 62  PERLDKPQIVLRTSDSQVQELEQQRWAAPFGSELRDALSAGLADALAAVDVGGATAPAGV 121

Query: 125 D-YQIISAIRSFEINIDRHCAII 146
             Y+I + ++ F+    +  + +
Sbjct: 122 PLYRISTDVQRFDARPAQDVSAL 144


>gi|114047607|ref|YP_738157.1| hypothetical protein Shewmr7_2112 [Shewanella sp. MR-7]
 gi|113889049|gb|ABI43100.1| protein of unknown function DUF330 [Shewanella sp. MR-7]
          Length = 197

 Score = 39.2 bits (90), Expect = 0.37,   Method: Composition-based stats.
 Identities = 23/195 (11%), Positives = 68/195 (34%), Gaps = 29/195 (14%)

Query: 18  LAVLLCTSLSSCFFHNNPVNIY-DLTESTKYDESVQRHIQ-----LIITEPITEKILNSE 71
           L + +   ++ C     P   +  L  +T                L +        LN+ 
Sbjct: 4   LVLFIVFLMAGCSSQPTPKTYFIALQHTTDPGLISPTMGSGSLCTLAVNRVNLADYLNTN 63

Query: 72  DIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISA 131
            ++ ++SP E+       W+  L   IQ +L          + ++     + A + + + 
Sbjct: 64  GLLYQTSPQELVVARQHLWAGSLAEQIQFRL----------NNLLSQPCSVPATWTLSTD 113

Query: 132 -----------IRSFEINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHF 180
                      +  F  +     A++    ++++     ++ ++ F     L ++     
Sbjct: 114 EPTKLGQLDLTVTEFYGSYTG-EAVVGGQWRLMD-KMQQVLLEQPFQYRIALPEEGYTAL 171

Query: 181 IQSLNRAFSRISSEI 195
           + S+++   +++++I
Sbjct: 172 VSSMDKGLIQLAADI 186


>gi|320176234|gb|EFW51295.1| hypothetical protein SDB_01207 [Shigella dysenteriae CDC 74-1112]
          Length = 187

 Score = 39.2 bits (90), Expect = 0.39,   Method: Composition-based stats.
 Identities = 20/130 (15%), Positives = 41/130 (31%), Gaps = 3/130 (2%)

Query: 18  LAVLLCTSLSSCFFHNNPVNIYDLTEST--KYDESVQRHIQLIITEPITEKILNSEDIIV 75
           L  +    L+ C       N Y L          + Q +  L + +      L    ++ 
Sbjct: 5   LVTIAALWLAGCSSGEINKNYYQLPVVQSGTQSTASQGNRLLWVEQVTVPDYLAGNGVVY 64

Query: 76  RSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSF 135
           ++S ++      + W+  L + ++  L+AN         V     G   D  +   +  F
Sbjct: 65  QTSDVKYVIANNNLWASPLDQQLRNILVANLSTQLPGWVVASQPLGSVQD-TLNVTVTEF 123

Query: 136 EINIDRHCAI 145
               D    +
Sbjct: 124 NGRYDGKVIV 133


>gi|187730231|ref|YP_001880851.1| putative lipoprotein [Shigella boydii CDC 3083-94]
 gi|187427223|gb|ACD06497.1| putative lipoprotein [Shigella boydii CDC 3083-94]
 gi|320187163|gb|EFW61864.1| hypothetical protein SGF_00593 [Shigella flexneri CDC 796-83]
 gi|332093418|gb|EGI98476.1| hypothetical protein SB359474_2635 [Shigella boydii 3594-74]
          Length = 187

 Score = 38.8 bits (89), Expect = 0.42,   Method: Composition-based stats.
 Identities = 20/130 (15%), Positives = 41/130 (31%), Gaps = 3/130 (2%)

Query: 18  LAVLLCTSLSSCFFHNNPVNIYDLTEST--KYDESVQRHIQLIITEPITEKILNSEDIIV 75
           L  +    L+ C       N Y L          + Q +  L + +      L    ++ 
Sbjct: 5   LVTIAALWLAGCSSGEINKNYYQLPVVQSGTQSTASQGNRLLWVEQVTVPDYLAGNGVVY 64

Query: 76  RSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSF 135
           ++S ++      + W+  L + ++  L+AN         V     G   D  +   +  F
Sbjct: 65  QTSDVKYVIANNNLWASPLDQQLRNTLVANLSTQLPGWVVASQPLGSVQD-TLNVTVTEF 123

Query: 136 EINIDRHCAI 145
               D    +
Sbjct: 124 NGRYDGKVIV 133


>gi|186894867|ref|YP_001871979.1| hypothetical protein YPTS_1550 [Yersinia pseudotuberculosis PB1/+]
 gi|186697893|gb|ACC88522.1| protein of unknown function DUF330 [Yersinia pseudotuberculosis
           PB1/+]
          Length = 186

 Score = 38.8 bits (89), Expect = 0.43,   Method: Composition-based stats.
 Identities = 29/183 (15%), Positives = 71/183 (38%), Gaps = 10/183 (5%)

Query: 18  LAVLLCTSLSSCFFHNNPVNIYDLTE--STKYDESVQRHIQLIITEPITEKILNSEDIIV 75
           +AV++   LS+C    +    Y L    +     S     QL +        L +  ++ 
Sbjct: 5   MAVIVALLLSACSSETS-KTYYQLPALNAPATVSSSVASRQLWVEHVSVADYLAAVGVVY 63

Query: 76  RSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADY-QIISAIRS 134
           +++ ++      + W+  L + +Q  L+ N   +  +   +   Q + +D   +   +  
Sbjct: 64  QTNDVQYVIANNNLWASPLDQQLQQTLVTNLSYS--LPGWLVSAQPLDSDQDVLNVTVTG 121

Query: 135 FEINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSE 194
           F    D   A+I   + I+      +  ++ F++E K  +D     +++L   + + +  
Sbjct: 122 FHGRYDGR-AVIR-GVWILKHQGQLI--KQPFNLELKQSEDGYDALVRTLAEGWQQEAKT 177

Query: 195 IID 197
           I  
Sbjct: 178 IAA 180


>gi|110835179|ref|YP_694038.1| hypothetical protein ABO_2318 [Alcanivorax borkumensis SK2]
 gi|110648290|emb|CAL17766.1| conserved hypothetical protein [Alcanivorax borkumensis SK2]
          Length = 169

 Score = 38.8 bits (89), Expect = 0.43,   Method: Composition-based stats.
 Identities = 33/186 (17%), Positives = 63/186 (33%), Gaps = 21/186 (11%)

Query: 13  IISCSLAVLLCTSLSSCFFHNNPVNI-YDLTESTKYDESVQRHIQLIITEPITEKILNSE 71
           +I       +  +L SC     P    Y L  +T         I++ +        LN  
Sbjct: 1   MIRLLAIAAILCTLWSCSHAPQPSPPGYVLPSAT-LSAHSPLTIKVALAN-----YLNRG 54

Query: 72  DIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISA 131
            I+++ S  EIQ     +W++ L   +  + +      G                 +   
Sbjct: 55  GIVMQLSDSEIQVARHHRWAEPLATQLH-RALEAHMTTGHEQ-------------TLTVE 100

Query: 132 IRSFEINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRI 191
           +  F+           +S +   A DN  V +     E  LE     + I++L+R +  +
Sbjct: 101 LTRFQGLQGEDRDAAVISGRWTLAGDNGEVAKGRIQWEAALENGGYANLIRTLDRGWQAV 160

Query: 192 SSEIID 197
           ++EI  
Sbjct: 161 AAEIAT 166


>gi|94309523|ref|YP_582733.1| hypothetical protein Rmet_0578 [Cupriavidus metallidurans CH34]
 gi|93353375|gb|ABF07464.1| conserved hypothetical protein; putative exported protein
           [Cupriavidus metallidurans CH34]
          Length = 195

 Score = 38.8 bits (89), Expect = 0.43,   Method: Composition-based stats.
 Identities = 19/134 (14%), Positives = 49/134 (36%), Gaps = 9/134 (6%)

Query: 57  LIITEPITEKILNSEDIIVRSS-PIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTV 115
           + ++     + LN   ++V       ++ L  S+WS  LP  ++  L    +   K+  V
Sbjct: 49  IEVSPVRVPERLNRTQLVVADGNAGVVKMLDLSRWSAPLPDELRDALSQQLQA--KLGAV 106

Query: 116 VKPNQGI---YADYQIISAIRSFEINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKL 172
               QG+      Y++ + +   + +     A  +++  +    D  ++G +    E   
Sbjct: 107 DIYQQGLSEVEPVYRVTTEVVRLDADP-GQRASASIAWTVRRLPDGKVLGGRT-EAELPA 164

Query: 173 EKDNKLHFIQSLNR 186
                   + +  +
Sbjct: 165 PG-QVDGVVNAYRQ 177


>gi|254784637|ref|YP_003072065.1| lipoprotein [Teredinibacter turnerae T7901]
 gi|237686369|gb|ACR13633.1| putative lipoprotein [Teredinibacter turnerae T7901]
          Length = 207

 Score = 38.8 bits (89), Expect = 0.44,   Method: Composition-based stats.
 Identities = 25/191 (13%), Positives = 60/191 (31%), Gaps = 14/191 (7%)

Query: 11  KKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQR---HIQLIITEPITEKI 67
             ++ C L   L  S + C         Y L    + ++  +     +   +   I  + 
Sbjct: 2   SNLLRCGLVAGLLMSFAGCGVSGPKTQYYSLFPGVEANQETRLEGDDLSFGVGPIILPEY 61

Query: 68  LNSEDIIVRSSPIEIQYLIGSQWS----DKLPRMIQLKLIANFENNGKISTVVKPNQGIY 123
           L    I+ R++  ++     + W       L R++   L   ++ +   +     +    
Sbjct: 62  LQQTSIVSRNAGQQLTVSGVNAWGGDLNATLSRVLATNLSTLWQQDDVWAFPW--DTRAR 119

Query: 124 ADYQIISAIRSFEINIDRHCAIITMSLK--IINAHDNSLVGQKVFHVEEKLEKDNKLHFI 181
            +YQI      F          +T+  +  ++       +      + E    ++   ++
Sbjct: 120 PNYQIRIVFEDFSGVRGGK---VTLKARWLLLGNKGKQQLAVGSQELSESTSSNSAEAYV 176

Query: 182 QSLNRAFSRIS 192
             LN    R S
Sbjct: 177 SVLNNLLKRFS 187


>gi|324113724|gb|EGC07699.1| hypothetical protein ERIG_02142 [Escherichia fergusonii B253]
          Length = 187

 Score = 38.8 bits (89), Expect = 0.45,   Method: Composition-based stats.
 Identities = 29/181 (16%), Positives = 64/181 (35%), Gaps = 7/181 (3%)

Query: 18  LAVLLCTSLSSCFFHNNPVNIYDLTEST--KYDESVQRHIQLIITEPITEKILNSEDIIV 75
           L  +    L+ C       N Y L          + Q +  L + +      L    ++ 
Sbjct: 5   LVTIAALWLAGCSSGEINKNYYQLPVVQSGTQSTASQGNRLLWVEQVAVPDYLAGNGVVY 64

Query: 76  RSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSF 135
           ++S ++      + W+  L + ++  L+AN         V     G   D  +   +  F
Sbjct: 65  QTSDVKYVIANNNLWASPLDQQLRNTLVANLSTQLPGWVVASQPLGSAQD-TLNVTVTEF 123

Query: 136 EINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEI 195
               D     + +S + +  H   L+ ++ F +E    +D     ++ L   +S+ ++ I
Sbjct: 124 NGRYDGK---VIVSGEWLLNHQGQLI-KRPFRLEGVQTQDGYDEMVKVLASVWSQEAASI 179

Query: 196 I 196
            
Sbjct: 180 A 180


>gi|295096311|emb|CBK85401.1| Uncharacterized protein conserved in bacteria [Enterobacter cloacae
           subsp. cloacae NCTC 9394]
          Length = 188

 Score = 38.8 bits (89), Expect = 0.46,   Method: Composition-based stats.
 Identities = 36/190 (18%), Positives = 77/190 (40%), Gaps = 9/190 (4%)

Query: 18  LAVLLCTSLSSCFFHNNPVNIYDLT---ESTKYDESVQRHIQLIITEPITEKILNSEDII 74
           L +     L++C   ++  + Y L    +S     S Q    L + +      L    ++
Sbjct: 5   LIIAGALVLTACSSGSDNKSYYQLPLSAQSGAQSSSSQGSRLLWVEQVAVPDYLAGNGVV 64

Query: 75  VRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRS 134
            ++S ++      + W+  L + ++  L+AN  +      V     G   D  +   +  
Sbjct: 65  YQTSDVQYVIANNNLWASPLDQQLRNTLVANLSSQLPGWVVASQPLGSDQD-TLNVNVTG 123

Query: 135 FEINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSE 194
           F    D     + +S + +  H   L+ ++ FH+E K +KD     ++ L + +++ S+ 
Sbjct: 124 FHGRYDG---AVVISGEWLLNHQGQLI-KRPFHLELKQQKDGYDEMVKVLAQGWAQESAA 179

Query: 195 IIDWTLSSLP 204
           I    +S LP
Sbjct: 180 IAR-EISRLP 188


>gi|317179639|dbj|BAJ57427.1| hypothetical protein HPF30_1330 [Helicobacter pylori F30]
          Length = 225

 Score = 38.8 bits (89), Expect = 0.47,   Method: Composition-based stats.
 Identities = 20/102 (19%), Positives = 43/102 (42%), Gaps = 4/102 (3%)

Query: 36  VNIYDLTESTKYDESVQRH-IQLIITEPITEKILNSEDIIVRSSPIEIQYLIGSQWSDKL 94
           +  YDL  S+       +  I++ +   ++  + N+++I+ ++   +I +    +W D  
Sbjct: 34  IRTYDLNASSFEIMQCPKPLIEVRLISILSADLFNTKEIVFKAKDGQITHGKHQKWIDLP 93

Query: 95  PRMIQLKLIANFENNGKISTVVKPNQGIYA-DYQIISAIRSF 135
             M++   +   E       V  P  G+ A  Y +   I SF
Sbjct: 94  RNMLKTMFMQ--EAQKACLGVALPPYGVGALTYAVRFTILSF 133


>gi|317010164|gb|ADU80744.1| hypothetical protein HPIN_07800 [Helicobacter pylori India7]
          Length = 227

 Score = 38.8 bits (89), Expect = 0.49,   Method: Composition-based stats.
 Identities = 18/102 (17%), Positives = 40/102 (39%), Gaps = 4/102 (3%)

Query: 36  VNIYDLTESTKYDESVQRHIQ-LIITEPITEKILNSEDIIVRSSPIEIQYLIGSQWSDKL 94
           +  YDL  S+       + +  + +   ++  + N+++I+ ++   +I +    +W D  
Sbjct: 34  IRTYDLNASSFEITQCPKPLTEVRLISILSADLFNTKEIVFKAQDGQITHGKHQKWIDLP 93

Query: 95  PRMIQLKLIANFENNGKISTVVKPNQGIY-ADYQIISAIRSF 135
             M++   +   E       V  P  G     Y +   I SF
Sbjct: 94  RNMLKTMFMQ--EAQKACLGVALPPYGAGTPTYAVRFTILSF 133


>gi|208435331|ref|YP_002266997.1| hypothetical protein HPG27_1386 [Helicobacter pylori G27]
 gi|208433260|gb|ACI28131.1| hypothetical protein HPG27_1386 [Helicobacter pylori G27]
          Length = 225

 Score = 38.8 bits (89), Expect = 0.49,   Method: Composition-based stats.
 Identities = 18/102 (17%), Positives = 40/102 (39%), Gaps = 4/102 (3%)

Query: 36  VNIYDLTESTKYDESVQRHIQ-LIITEPITEKILNSEDIIVRSSPIEIQYLIGSQWSDKL 94
           +  YDL  S+       + +  + +   ++  + N+++I+ ++   +I +    +W D  
Sbjct: 34  IRTYDLNASSFEITQCPKPLTEVRLISILSADLFNTKEIVFKAQDGQITHGKHQKWIDLP 93

Query: 95  PRMIQLKLIANFENNGKISTVVKPNQGIY-ADYQIISAIRSF 135
             M++   +   E       V  P  G     Y +   I SF
Sbjct: 94  RNMLKTMFMQ--EAQKACLGVALPPYGAGTPTYAVRFTILSF 133


>gi|207108349|ref|ZP_03242511.1| hypothetical protein HpylH_01683 [Helicobacter pylori
           HPKX_438_CA4C1]
          Length = 225

 Score = 38.8 bits (89), Expect = 0.50,   Method: Composition-based stats.
 Identities = 15/101 (14%), Positives = 40/101 (39%), Gaps = 2/101 (1%)

Query: 36  VNIYDLTESTKYDESVQRHIQ-LIITEPITEKILNSEDIIVRSSPIEIQYLIGSQWSDKL 94
           +  YDL  S+       + +  + +   ++  + N+++I+ ++   +I +    +W D  
Sbjct: 34  IRTYDLNASSFEITQCPKPLTEVRLISILSADLFNTKEIVFKAKDGQITHGKYQKWIDLP 93

Query: 95  PRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSF 135
             M++   +   +       ++    G    Y +   I SF
Sbjct: 94  RNMLKTMFMQEAQKACLGVALLPYGTG-APTYAVRFTILSF 133


>gi|50121455|ref|YP_050622.1| putative lipoprotein [Pectobacterium atrosepticum SCRI1043]
 gi|49611981|emb|CAG75430.1| putative lipoprotein [Pectobacterium atrosepticum SCRI1043]
          Length = 188

 Score = 38.8 bits (89), Expect = 0.51,   Method: Composition-based stats.
 Identities = 27/183 (14%), Positives = 66/183 (36%), Gaps = 12/183 (6%)

Query: 19  AVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQ---LIITEPITEKILNSEDIIV 75
            + L   LS+C   N     Y L        +     Q   L +        L +  ++ 
Sbjct: 6   TLALVLVLSACSSSNTQKTYYQLPTIADTSTAQTAVTQGRPLWVEHVSVADYLVNTGLVY 65

Query: 76  RSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKIST--VVKPNQGIYADYQIISAIR 133
           +++ ++      + W+  L + +Q  L+ N     K+    V    QG      +  ++ 
Sbjct: 66  QTNDVQYVIASNNLWASPLDQQLQQALVVNL--GHKLPGWIVTTQPQGSE-QAVLNVSVT 122

Query: 134 SFEINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISS 193
            F    D +   + +  + +  +   ++ ++ F V     +D     +++L + + ++S 
Sbjct: 123 GFHGRYDGN---VVVRGEWMLTYQGKVL-KRPFSVLLPQTEDGYDALVRTLAQGWQQVSQ 178

Query: 194 EII 196
            I 
Sbjct: 179 SIA 181


>gi|261821348|ref|YP_003259454.1| hypothetical protein Pecwa_2068 [Pectobacterium wasabiae WPP163]
 gi|261605361|gb|ACX87847.1| protein of unknown function DUF330 [Pectobacterium wasabiae WPP163]
          Length = 188

 Score = 38.8 bits (89), Expect = 0.52,   Method: Composition-based stats.
 Identities = 26/181 (14%), Positives = 67/181 (37%), Gaps = 8/181 (4%)

Query: 19  AVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQ---LIITEPITEKILNSEDIIV 75
            + L   LS+C   N     Y L      + +     Q   L +        L +  ++ 
Sbjct: 6   TLALVLVLSACSSSNTQKTYYQLPVIADTNITQTAVTQGHPLWVEHVSVADYLVNTGLVY 65

Query: 76  RSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSF 135
           +++ ++      + W+  L + +Q  L+AN   +     VV           +  ++  F
Sbjct: 66  QTNDVQYVIASNNLWASPLDQQLQQALVANL-GHKLPGWVVTTQPQGSEQAVLNVSVTGF 124

Query: 136 EINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEI 195
               D +   + +  + +  +   ++ ++ F+V     +D     +++L + + ++S  I
Sbjct: 125 HGRYDGN---VVVRGEWMLTYQGKVL-KRPFNVVLPQTEDGYDALVRTLAQGWQQVSQSI 180

Query: 196 I 196
            
Sbjct: 181 A 181


>gi|194765047|ref|XP_001964639.1| GF22941 [Drosophila ananassae]
 gi|190614911|gb|EDV30435.1| GF22941 [Drosophila ananassae]
          Length = 649

 Score = 38.8 bits (89), Expect = 0.53,   Method: Composition-based stats.
 Identities = 15/109 (13%), Positives = 38/109 (34%), Gaps = 11/109 (10%)

Query: 97  MIQLKLIANFENNGKISTVVKPNQGIYADYQIIS-------AIRSFEINIDRHCAIITMS 149
           ++    +  FE + + +   K +Q    D Q+          +  F+     H       
Sbjct: 208 LLDDNFLEEFEASNRRTLEQKISQPAAGDVQLEESLCGLKEDLEKFQAKQSEHNQRKEAV 267

Query: 150 LKIINAHDNSLVGQKVFHVEE---KLEKDNKLHFIQSLNRAFSRISSEI 195
             ++N     + G + F  E+    L        +++ N+  S ++ ++
Sbjct: 268 DSVLNGFRG-IFGSETFTEEDFDDPLIGSKIESMVRAFNQVSSTVAEQL 315


>gi|123441885|ref|YP_001005868.1| putative lipoprotein protein [Yersinia enterocolitica subsp.
           enterocolitica 8081]
 gi|122088846|emb|CAL11652.1| putative lipoprotein protein [Yersinia enterocolitica subsp.
           enterocolitica 8081]
          Length = 183

 Score = 38.4 bits (88), Expect = 0.55,   Method: Composition-based stats.
 Identities = 25/134 (18%), Positives = 51/134 (38%), Gaps = 9/134 (6%)

Query: 18  LAVLLCTSLSSCFFHNNPVNIY-DLTE--STKYDESVQRHIQLIITEPITEKILNSEDII 74
           +AV+    LS+C   + P   Y  L    +     S     QL +        L +  ++
Sbjct: 5   MAVIAALLLSACS--STPSKTYYQLPALSAPAGATSSVASRQLWVEHVGVADYLAAAGVV 62

Query: 75  VRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADY-QIISAIR 133
            +++ ++      + W+  L + +Q  L+ N  N   +   +  +Q + +D   +   + 
Sbjct: 63  YQTNDVQYVIASNNLWASPLDQQLQQTLVTNLSNA--LPGWLVSSQPLDSDQDVLNVTVT 120

Query: 134 SFEINIDRHCAIIT 147
            F    D   AII 
Sbjct: 121 GFHGRYDGR-AIIR 133


>gi|259418288|ref|ZP_05742206.1| conserved hypothetical protein [Silicibacter sp. TrichCH4B]
 gi|259345683|gb|EEW57527.1| conserved hypothetical protein [Silicibacter sp. TrichCH4B]
          Length = 185

 Score = 38.4 bits (88), Expect = 0.56,   Method: Composition-based stats.
 Identities = 19/163 (11%), Positives = 51/163 (31%), Gaps = 6/163 (3%)

Query: 18  LAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIITEPITEKILNSEDIIVRS 77
           L   LC + +      +    Y +  +            + +         ++ +I+   
Sbjct: 4   LFAFLCLATALTACSGSNDARYLIAATPGEPVKNLSSRSIEVRLVSLPTYASASEIVSEG 63

Query: 78  SPIEIQYLIGSQWSDKLPRMIQLKLIANF-ENNGKISTVVKPNQGIYADYQIISAIRSFE 136
               +     +QW+D   R + + L     +  G    V        AD ++   +   +
Sbjct: 64  EGGALFNEDRAQWADDPARGMSVALARGLSDRTGAAVAVEPWPLNTPADVRLDVRV---D 120

Query: 137 INIDRHCAIITMSLK-IINAHDNSLVG-QKVFHVEEKLEKDNK 177
            +  R   +   S +  +++ +  +    K F +E  + +   
Sbjct: 121 QSYARAGGVFEFSGQYAVSSPEGRVREFVKRFDIETPVAEPGP 163


>gi|324009874|gb|EGB79093.1| hypothetical protein HMPREF9532_00383 [Escherichia coli MS 57-2]
          Length = 187

 Score = 38.4 bits (88), Expect = 0.57,   Method: Composition-based stats.
 Identities = 30/181 (16%), Positives = 65/181 (35%), Gaps = 7/181 (3%)

Query: 18  LAVLLCTSLSSCFFHNNPVNIYDLTEST--KYDESVQRHIQLIITEPITEKILNSEDIIV 75
           L  +    L+ C       N Y L          + Q +  L + +      L    ++ 
Sbjct: 5   LVTIAALWLAGCSSGEINKNYYQLPVVQSGTQSTASQGNRLLWVEQVAVPDYLAGNGVVY 64

Query: 76  RSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSF 135
           ++S ++      + W+  L + ++  L+AN         V     G   D  +   +  F
Sbjct: 65  QTSDVKYVIANNNLWASPLDQQLRNTLVANLSTQLPGWVVASQPLGSAQD-TLNVTVTEF 123

Query: 136 EINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEI 195
               D     + +S + +  H   L+ ++ FH+E    +D     ++ L   +S+ ++ I
Sbjct: 124 NGRYDGK---VIVSGEWLLNHQGQLI-KRPFHLEGVQTQDGYDEMVKVLASVWSQEAASI 179

Query: 196 I 196
            
Sbjct: 180 A 180


>gi|186474044|ref|YP_001861386.1| hypothetical protein Bphy_5258 [Burkholderia phymatum STM815]
 gi|184196376|gb|ACC74340.1| protein of unknown function DUF330 [Burkholderia phymatum STM815]
          Length = 194

 Score = 38.4 bits (88), Expect = 0.57,   Method: Composition-based stats.
 Identities = 23/190 (12%), Positives = 63/190 (33%), Gaps = 1/190 (0%)

Query: 8   IIKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIITEPITEKI 67
           + +       +A+L+ TSL+ C        +      +    +  R   + +T      +
Sbjct: 1   MTRSASTLARVAMLIGTSLAGCGHSPATHYVRLNASPSGALLATTRIAPVQLTAVHIPTV 60

Query: 68  LNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQ 127
           L+  +++ + SP  +     + W   L +M++  L  +          V P+     D +
Sbjct: 61  LDRPEVVTQVSPNRLTVDDRNHWGAPLAQMMRGTLAQDLTMRLPAGAFVFPDAPAPPDTR 120

Query: 128 IISAIRSFEINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRA 187
            +  +   +   D           +++     +   +   +   L   +      +L+R 
Sbjct: 121 TLV-VTVLDAEADTKTMTFQAGWTLLSGQPPHVTLTREVTLTSTLTSRDAAEQAAALSRI 179

Query: 188 FSRISSEIID 197
              ++  I+ 
Sbjct: 180 LGELADRIVA 189


>gi|308186294|ref|YP_003930425.1| hypothetical protein Pvag_0774 [Pantoea vagans C9-1]
 gi|308056804|gb|ADO08976.1| Uncharacterized lipoprotein ymbA precursor [Pantoea vagans C9-1]
          Length = 189

 Score = 38.4 bits (88), Expect = 0.57,   Method: Composition-based stats.
 Identities = 31/188 (16%), Positives = 65/188 (34%), Gaps = 13/188 (6%)

Query: 15  SCSLAVLLCTSLSSCFFHNNPVNIYDLT--ESTKYDESVQRHIQ---LIITEPITEKILN 69
              L   L  S  S    N     Y L    ++    S Q +     L + +      L 
Sbjct: 4   GLILCAALVLSACSSSVDNT---WYQLPSGAASMQVTSSQLNEAQPMLWVQQVTVPDYLA 60

Query: 70  SEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQII 129
              ++ ++S ++      + W+  L + +Q  LI N         V     G   D  + 
Sbjct: 61  GNGLVYQTSDVKYVIAANNLWASPLDQQLQQTLITNLSKALPGRLVAGSPLGAQHD-TLN 119

Query: 130 SAIRSFEINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFS 189
             I  F+   D   AI++    +   H    + ++ F++     +D     +++L   + 
Sbjct: 120 VTITGFQGRYDGK-AIVSGEWTL--EHQGR-LTKQAFNLVLPQTEDGYDAMVRTLAAGWQ 175

Query: 190 RISSEIID 197
           + + +I +
Sbjct: 176 QTAQKIAN 183


>gi|309701231|emb|CBJ00531.1| putative lipoprotein [Escherichia coli ETEC H10407]
          Length = 182

 Score = 38.4 bits (88), Expect = 0.61,   Method: Composition-based stats.
 Identities = 20/122 (16%), Positives = 40/122 (32%), Gaps = 3/122 (2%)

Query: 26  LSSCFFHNNPVNIYDLTESTKYDES--VQRHIQLIITEPITEKILNSEDIIVRSSPIEIQ 83
           L+ C       N Y L       +S   Q +  L + +      L    ++ ++S ++  
Sbjct: 8   LAGCSSGEINKNYYQLPVVQSGTQSTASQGNRLLWVEQVTVPDYLAGNGVVYQTSDVKYV 67

Query: 84  YLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFEINIDRHC 143
               + W+  L + ++  L+AN         V     G   D  +   +  F    D   
Sbjct: 68  IANNNLWASPLDQQLRNTLVANLSTQLPGWVVASQPLGSAQD-TLNVTVTEFNGRYDGKV 126

Query: 144 AI 145
            +
Sbjct: 127 IV 128


>gi|15646072|ref|NP_208254.1| hypothetical protein HP1463 [Helicobacter pylori 26695]
 gi|2314644|gb|AAD08508.1| predicted coding region HP1463 [Helicobacter pylori 26695]
          Length = 225

 Score = 38.4 bits (88), Expect = 0.61,   Method: Composition-based stats.
 Identities = 19/102 (18%), Positives = 41/102 (40%), Gaps = 4/102 (3%)

Query: 36  VNIYDLTESTKYDESVQRHIQ-LIITEPITEKILNSEDIIVRSSPIEIQYLIGSQWSDKL 94
           +  YDL  S+       + +  + +   ++  + N+++I+ ++   +I +    +W D  
Sbjct: 34  IRTYDLNASSFEITQCAKPLTEVRLISILSADLFNTKEIVFKAKDGQITHGKHQKWIDLP 93

Query: 95  PRMIQLKLIANFENNGKISTVVKPNQGIYAD-YQIISAIRSF 135
             M++   +   E       V  P  G  A  Y +   I SF
Sbjct: 94  RNMLKTMFMQ--EAQKACLGVALPPYGAGAPTYAVRFTILSF 133


>gi|74311509|ref|YP_309928.1| hypothetical protein SSON_0956 [Shigella sonnei Ss046]
 gi|191169750|ref|ZP_03031411.1| putative lipoprotein [Escherichia coli B7A]
 gi|218694427|ref|YP_002402094.1| hypothetical protein EC55989_1001 [Escherichia coli 55989]
 gi|73854986|gb|AAZ87693.1| conserved hypothetical protein [Shigella sonnei Ss046]
 gi|190900210|gb|EDV60098.1| putative lipoprotein [Escherichia coli B7A]
 gi|218351159|emb|CAU96863.1| conserved hypothetical protein [Escherichia coli 55989]
 gi|320202350|gb|EFW76921.1| hypothetical protein ECoL_00397 [Escherichia coli EC4100B]
 gi|323165432|gb|EFZ51219.1| hypothetical protein SS53G_4116 [Shigella sonnei 53G]
 gi|323174941|gb|EFZ60556.1| hypothetical protein ECLT68_0498 [Escherichia coli LT-68]
 gi|323185337|gb|EFZ70701.1| hypothetical protein ECOK1357_1290 [Escherichia coli 1357]
          Length = 182

 Score = 38.4 bits (88), Expect = 0.63,   Method: Composition-based stats.
 Identities = 27/173 (15%), Positives = 60/173 (34%), Gaps = 7/173 (4%)

Query: 26  LSSCFFHNNPVNIYDLTEST--KYDESVQRHIQLIITEPITEKILNSEDIIVRSSPIEIQ 83
           L+ C       N Y L          + Q +  L + +      L    ++ ++S ++  
Sbjct: 8   LAGCSSGEINKNYYQLPVVQSGTQSTASQGNRLLWVEQVTVPDYLAGNGVVYQTSDVKYV 67

Query: 84  YLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFEINIDRHC 143
               + W+  L + ++  L+AN         V     G   D  +   +  F    D   
Sbjct: 68  IANNNLWASPLDQQLRNTLVANLSTQLPGWVVASQPLGSAQD-TLNVTVTEFNGRYDGK- 125

Query: 144 AIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEII 196
            +I     ++N     +  ++ F +E    +D     ++ L   +S+ ++ I 
Sbjct: 126 -VIVSGEWLLNHQGQLI--KRPFRLEGVQTQDGYDEMVKVLASVWSQEAASIA 175


>gi|95930827|ref|ZP_01313558.1| protein of unknown function DUF330 [Desulfuromonas acetoxidans DSM
           684]
 gi|95133069|gb|EAT14737.1| protein of unknown function DUF330 [Desulfuromonas acetoxidans DSM
           684]
          Length = 185

 Score = 38.4 bits (88), Expect = 0.63,   Method: Composition-based stats.
 Identities = 19/121 (15%), Positives = 36/121 (29%), Gaps = 9/121 (7%)

Query: 8   IIKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTES---TKYDESVQRHIQLIITEPIT 64
           + +       +  L    ++ C     P   Y L           S    I +     ++
Sbjct: 1   MRRASFYLTIVTTLGLLLVAGCSSPTTPKTHYYLIAPDYQASAVLSPPATISVECAPFLS 60

Query: 65  EKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYA 124
           +  L     +V      I      +W++ LP MI   L    + +G  +    P   +  
Sbjct: 61  QGGL-----VVEHGDQTIATAHYHRWAEPLPGMISRYLQRRLQ-SGLRTETTPPTMTLLI 114

Query: 125 D 125
           D
Sbjct: 115 D 115


>gi|91210047|ref|YP_540033.1| hypothetical protein UTI89_C1017 [Escherichia coli UTI89]
 gi|110641141|ref|YP_668871.1| hypothetical protein ECP_0957 [Escherichia coli 536]
 gi|117623163|ref|YP_852076.1| hypothetical protein APECO1_58 [Escherichia coli APEC O1]
 gi|191172142|ref|ZP_03033686.1| putative lipoprotein [Escherichia coli F11]
 gi|215486070|ref|YP_002328501.1| hypothetical protein E2348C_0938 [Escherichia coli O127:H6 str.
           E2348/69]
 gi|237707065|ref|ZP_04537546.1| conserved hypothetical protein [Escherichia sp. 3_2_53FAA]
 gi|293404251|ref|ZP_06648245.1| lipoprotein ymbA [Escherichia coli FVEC1412]
 gi|298380035|ref|ZP_06989640.1| lipoprotein ymbA [Escherichia coli FVEC1302]
 gi|300896331|ref|ZP_07114874.1| conserved hypothetical protein [Escherichia coli MS 198-1]
 gi|300982996|ref|ZP_07176400.1| hypothetical protein HMPREF9553_02370 [Escherichia coli MS 200-1]
 gi|306812601|ref|ZP_07446794.1| putative lipoprotein [Escherichia coli NC101]
 gi|312968989|ref|ZP_07783196.1| conserved hypothetical protein [Escherichia coli 2362-75]
 gi|331657017|ref|ZP_08357979.1| putative lipoprotein [Escherichia coli TA206]
 gi|331672481|ref|ZP_08373271.1| putative lipoprotein [Escherichia coli TA280]
 gi|331682456|ref|ZP_08383075.1| putative lipoprotein [Escherichia coli H299]
 gi|91071621|gb|ABE06502.1| conserved hypothetical protein [Escherichia coli UTI89]
 gi|110342733|gb|ABG68970.1| hypothetical protein ECP_0957 [Escherichia coli 536]
 gi|115512287|gb|ABJ00362.1| conserved hypothetical protein [Escherichia coli APEC O1]
 gi|190907669|gb|EDV67264.1| putative lipoprotein [Escherichia coli F11]
 gi|215264142|emb|CAS08486.1| predicted protein [Escherichia coli O127:H6 str. E2348/69]
 gi|222032676|emb|CAP75415.1| Uncharacterized lipoprotein ymbA [Escherichia coli LF82]
 gi|226898275|gb|EEH84534.1| conserved hypothetical protein [Escherichia sp. 3_2_53FAA]
 gi|284920796|emb|CBG33859.1| putative lipoprotein [Escherichia coli 042]
 gi|291428837|gb|EFF01862.1| lipoprotein ymbA [Escherichia coli FVEC1412]
 gi|294492613|gb|ADE91369.1| putative lipoprotein [Escherichia coli IHE3034]
 gi|298279733|gb|EFI21241.1| lipoprotein ymbA [Escherichia coli FVEC1302]
 gi|300307013|gb|EFJ61533.1| hypothetical protein HMPREF9553_02370 [Escherichia coli MS 200-1]
 gi|300359796|gb|EFJ75666.1| conserved hypothetical protein [Escherichia coli MS 198-1]
 gi|305853364|gb|EFM53803.1| putative lipoprotein [Escherichia coli NC101]
 gi|307627628|gb|ADN71932.1| putative lipoprotein [Escherichia coli UM146]
 gi|312286391|gb|EFR14304.1| conserved hypothetical protein [Escherichia coli 2362-75]
 gi|312945465|gb|ADR26292.1| hypothetical protein NRG857_04325 [Escherichia coli O83:H1 str. NRG
           857C]
 gi|315287568|gb|EFU46974.1| conserved hypothetical protein [Escherichia coli MS 110-3]
 gi|315296238|gb|EFU55545.1| conserved hypothetical protein [Escherichia coli MS 16-3]
 gi|320196561|gb|EFW71184.1| hypothetical protein EcoM_01101 [Escherichia coli WV_060327]
 gi|323190766|gb|EFZ76035.1| hypothetical protein ECRN5871_1005 [Escherichia coli RN587/1]
 gi|323953346|gb|EGB49212.1| hypothetical protein ERKG_00231 [Escherichia coli H252]
 gi|323958251|gb|EGB53960.1| hypothetical protein ERLG_00690 [Escherichia coli H263]
 gi|323976668|gb|EGB71756.1| hypothetical protein ERFG_02457 [Escherichia coli TW10509]
 gi|324012934|gb|EGB82153.1| hypothetical protein HMPREF9533_03041 [Escherichia coli MS 60-1]
 gi|331055265|gb|EGI27274.1| putative lipoprotein [Escherichia coli TA206]
 gi|331070387|gb|EGI41752.1| putative lipoprotein [Escherichia coli TA280]
 gi|331080087|gb|EGI51266.1| putative lipoprotein [Escherichia coli H299]
          Length = 187

 Score = 38.4 bits (88), Expect = 0.67,   Method: Composition-based stats.
 Identities = 28/181 (15%), Positives = 62/181 (34%), Gaps = 7/181 (3%)

Query: 18  LAVLLCTSLSSCFFHNNPVNIYDLTEST--KYDESVQRHIQLIITEPITEKILNSEDIIV 75
           L  +    L+ C       N Y L          + Q +  L + +      L    ++ 
Sbjct: 5   LVTIAALWLAGCSSGEINKNYYQLPVVQSGTQSTASQGNRLLWVEQVAVPDYLAGNGVVY 64

Query: 76  RSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSF 135
           ++S ++      + W+  L + ++  L+AN         V     G   D  +   +  F
Sbjct: 65  QTSDVKYVIANNNLWASPLDQQLRNTLVANLSTQLPGWVVASQPLGSAQD-TLNVTVTEF 123

Query: 136 EINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEI 195
               D    +I     ++N     +  ++ F +E    +D     ++ L   +S+ ++ I
Sbjct: 124 NGRYDGK--VIVSGEWLLNHQGQLI--KRPFRLEGVQTQDGYDEMVKVLASVWSQEAASI 179

Query: 196 I 196
            
Sbjct: 180 A 180


>gi|323947258|gb|EGB43266.1| hypothetical protein EREG_01203 [Escherichia coli H120]
          Length = 187

 Score = 38.4 bits (88), Expect = 0.67,   Method: Composition-based stats.
 Identities = 30/181 (16%), Positives = 64/181 (35%), Gaps = 7/181 (3%)

Query: 18  LAVLLCTSLSSCFFHNNPVNIYDLTESTKYDES--VQRHIQLIITEPITEKILNSEDIIV 75
           L  +    L  C       N Y L       +S   Q +  L + +      L    ++ 
Sbjct: 5   LVTIAALWLVGCSSGEINKNYYQLPVVQSGTQSTASQGNRLLWVEQVTVPDYLAGNGVVY 64

Query: 76  RSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSF 135
           ++S ++      + W+  L + ++  L+AN         V     G   D  +   +  F
Sbjct: 65  QTSDVKYVIANNNLWASPLDQQLRNTLVANLSTQLPGWVVASQPLGSAQD-TLNVTVTEF 123

Query: 136 EINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEI 195
               D     + +S + +  H   L+ ++ F +E    +D     ++ L   +S+ ++ I
Sbjct: 124 NGRYDGK---VIVSGEWLLNHQGQLI-KRPFRLEGVQTQDGYDEMVKVLASVWSQEAASI 179

Query: 196 I 196
            
Sbjct: 180 A 180


>gi|300937699|ref|ZP_07152501.1| conserved hypothetical protein [Escherichia coli MS 21-1]
 gi|300457260|gb|EFK20753.1| conserved hypothetical protein [Escherichia coli MS 21-1]
          Length = 187

 Score = 38.4 bits (88), Expect = 0.67,   Method: Composition-based stats.
 Identities = 20/130 (15%), Positives = 41/130 (31%), Gaps = 3/130 (2%)

Query: 18  LAVLLCTSLSSCFFHNNPVNIYDLTEST--KYDESVQRHIQLIITEPITEKILNSEDIIV 75
           L  +    L+ C       N Y L          + Q +  L + +      L    ++ 
Sbjct: 5   LVTIAALWLAGCSSGEINKNYYQLPVVQSGTQSTASQGNRLLWVEQVAVPDYLAGNGVVY 64

Query: 76  RSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSF 135
           ++S ++      + W+  L + ++  L+AN         V     G   D  +   +  F
Sbjct: 65  QTSDVKYVIANNNLWASPLDQQLRNTLVANLSTQLPGWVVASQPLGSAQD-TLNVTVTEF 123

Query: 136 EINIDRHCAI 145
               D    +
Sbjct: 124 NGRYDGKVIV 133


>gi|325496883|gb|EGC94742.1| hypothetical protein ECD227_0980 [Escherichia fergusonii ECD227]
          Length = 187

 Score = 38.0 bits (87), Expect = 0.69,   Method: Composition-based stats.
 Identities = 21/130 (16%), Positives = 42/130 (32%), Gaps = 3/130 (2%)

Query: 18  LAVLLCTSLSSCFFHNNPVNIYDLTESTKYDES--VQRHIQLIITEPITEKILNSEDIIV 75
           L  +    L+ C       N Y L       +S   Q +  L + +      L    ++ 
Sbjct: 5   LVTIAALWLAGCSSGEINKNYYQLPVVQSGTQSTASQGNRLLWVEQVAVPDYLAGNGVVY 64

Query: 76  RSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSF 135
           ++S ++      + W+  L + ++  L+AN         V     G   D  +   +  F
Sbjct: 65  QTSDVKYVIANNNLWASPLDQQLRNTLVANLSTQLPGWVVASQPLGSAQD-TLNVTVTEF 123

Query: 136 EINIDRHCAI 145
               D    +
Sbjct: 124 NGRYDGKVIV 133


>gi|227884089|ref|ZP_04001894.1| lipoprotein [Escherichia coli 83972]
 gi|300978387|ref|ZP_07174238.1| conserved hypothetical protein [Escherichia coli MS 45-1]
 gi|301047791|ref|ZP_07194844.1| conserved hypothetical protein [Escherichia coli MS 185-1]
 gi|227838841|gb|EEJ49307.1| lipoprotein [Escherichia coli 83972]
 gi|300300323|gb|EFJ56708.1| conserved hypothetical protein [Escherichia coli MS 185-1]
 gi|300409675|gb|EFJ93213.1| conserved hypothetical protein [Escherichia coli MS 45-1]
 gi|307552784|gb|ADN45559.1| putative lipoprotein [Escherichia coli ABU 83972]
 gi|315291206|gb|EFU50566.1| conserved hypothetical protein [Escherichia coli MS 153-1]
 gi|330910725|gb|EGH39235.1| putative lipoprotein [Escherichia coli AA86]
          Length = 187

 Score = 38.0 bits (87), Expect = 0.69,   Method: Composition-based stats.
 Identities = 21/130 (16%), Positives = 42/130 (32%), Gaps = 3/130 (2%)

Query: 18  LAVLLCTSLSSCFFHNNPVNIYDLTESTKYDES--VQRHIQLIITEPITEKILNSEDIIV 75
           L  +    L+ C       N Y L       +S   Q +  L + +      L    ++ 
Sbjct: 5   LVTIAALWLAGCSSGEINKNYYQLPVVQSGTQSTASQGNRLLWVEQVAVPDYLAGNGVVY 64

Query: 76  RSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSF 135
           ++S ++      + W+  L + ++  L+AN         V     G   D  +   +  F
Sbjct: 65  QTSDVKYVIANNNLWASPLDQQLRNTLVANLSTQLPGWVVASQPLGSAQD-TLNVTVTEF 123

Query: 136 EINIDRHCAI 145
               D    +
Sbjct: 124 NGRYDGKVIV 133


>gi|89107802|ref|AP_001582.1| hypothetical protein [Escherichia coli str. K-12 substr. W3110]
 gi|254161066|ref|YP_003044174.1| hypothetical protein ECB_00956 [Escherichia coli B str. REL606]
 gi|85674798|dbj|BAA35710.2| conserved hypothetical protein [Escherichia coli str. K12 substr.
           W3110]
 gi|242376767|emb|CAQ31480.1| conserved protein [Escherichia coli BL21(DE3)]
 gi|253972967|gb|ACT38638.1| hypothetical protein ECB_00956 [Escherichia coli B str. REL606]
 gi|253977181|gb|ACT42851.1| hypothetical protein ECD_00956 [Escherichia coli BL21(DE3)]
          Length = 182

 Score = 38.0 bits (87), Expect = 0.69,   Method: Composition-based stats.
 Identities = 19/122 (15%), Positives = 39/122 (31%), Gaps = 3/122 (2%)

Query: 26  LSSCFFHNNPVNIYDLTEST--KYDESVQRHIQLIITEPITEKILNSEDIIVRSSPIEIQ 83
           L+ C       N Y L          + Q +  L + +      L    ++ ++S ++  
Sbjct: 8   LAGCSSGEINKNYYQLPVVQSGTQSTASQGNRLLWVEQVTVPDYLAGNGVVYQTSDVKYV 67

Query: 84  YLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFEINIDRHC 143
               + W+  L + ++  L+AN         V     G   D  +   +  F    D   
Sbjct: 68  IANNNLWASPLDQQLRNTLVANLSTQLPGWVVASQPLGSAQD-TLNVTVTEFNGRYDGKV 126

Query: 144 AI 145
            +
Sbjct: 127 IV 128


>gi|192361811|ref|YP_001982087.1| putative lipoprotein [Cellvibrio japonicus Ueda107]
 gi|190687976|gb|ACE85654.1| putative lipoprotein [Cellvibrio japonicus Ueda107]
          Length = 203

 Score = 38.0 bits (87), Expect = 0.71,   Method: Composition-based stats.
 Identities = 31/194 (15%), Positives = 69/194 (35%), Gaps = 4/194 (2%)

Query: 3   KKLNKIIKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIITEP 62
           ++++  ++   I   L +LLC+   +C       N Y L+         Q   Q+I   P
Sbjct: 6   RRMSNNMRNISIPLGL-ILLCSLFMACQHSPRQ-NYYLLSAPAVSTPDQQAIEQVIGIGP 63

Query: 63  ITEKILNSEDIIVRSSPIE-IQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQG 121
           +          +V   P + +Q      W++ L + I   L  N         V+     
Sbjct: 64  LEIADYLKRKHMVSVRPDQSLQIAANDFWAEPLDKGIIRVLALNLTQQNPSRMVLPFPWR 123

Query: 122 IYADYQIISAIRSFEINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFI 181
             +   +   ++   +N+D   A I ++ +I +    + + ++ F      E        
Sbjct: 124 SDSRPPLSVRLQVHSLNLDNEGASIHVTWEIFDNQARATLNRQHFIRRIPCE-RQAAAMA 182

Query: 182 QSLNRAFSRISSEI 195
           ++     + ++ EI
Sbjct: 183 KAYGDLLAALAQEI 196


>gi|168752842|ref|ZP_02777864.1| putative lipoprotein [Escherichia coli O157:H7 str. EC4113]
 gi|168758978|ref|ZP_02783985.1| putative lipoprotein [Escherichia coli O157:H7 str. EC4401]
 gi|168771733|ref|ZP_02796740.1| putative lipoprotein [Escherichia coli O157:H7 str. EC4486]
 gi|168776193|ref|ZP_02801200.1| putative lipoprotein [Escherichia coli O157:H7 str. EC4196]
 gi|168783955|ref|ZP_02808962.1| putative lipoprotein [Escherichia coli O157:H7 str. EC4076]
 gi|168787383|ref|ZP_02812390.1| putative lipoprotein [Escherichia coli O157:H7 str. EC869]
 gi|195940402|ref|ZP_03085784.1| hypothetical protein EscherichcoliO157_29085 [Escherichia coli
           O157:H7 str. EC4024]
 gi|208805647|ref|ZP_03247984.1| putative lipoprotein [Escherichia coli O157:H7 str. EC4206]
 gi|208816071|ref|ZP_03257250.1| putative lipoprotein [Escherichia coli O157:H7 str. EC4045]
 gi|208822014|ref|ZP_03262333.1| putative lipoprotein [Escherichia coli O157:H7 str. EC4042]
 gi|209399733|ref|YP_002269621.1| putative lipoprotein [Escherichia coli O157:H7 str. EC4115]
 gi|217324772|ref|ZP_03440856.1| putative lipoprotein [Escherichia coli O157:H7 str. TW14588]
 gi|254792152|ref|YP_003076989.1| hypothetical protein ECSP_1058 [Escherichia coli O157:H7 str.
           TW14359]
 gi|261227455|ref|ZP_05941736.1| hypothetical protein EscherichiacoliO157_23096 [Escherichia coli
           O157:H7 str. FRIK2000]
 gi|261256122|ref|ZP_05948655.1| hypothetical protein EscherichiacoliO157EcO_09869 [Escherichia coli
           O157:H7 str. FRIK966]
 gi|291281952|ref|YP_003498770.1| putative lipoprotein [Escherichia coli O55:H7 str. CB9615]
 gi|187768368|gb|EDU32212.1| putative lipoprotein [Escherichia coli O157:H7 str. EC4196]
 gi|188013502|gb|EDU51624.1| putative lipoprotein [Escherichia coli O157:H7 str. EC4113]
 gi|188998773|gb|EDU67759.1| putative lipoprotein [Escherichia coli O157:H7 str. EC4076]
 gi|189354321|gb|EDU72740.1| putative lipoprotein [Escherichia coli O157:H7 str. EC4401]
 gi|189359571|gb|EDU77990.1| putative lipoprotein [Escherichia coli O157:H7 str. EC4486]
 gi|189372733|gb|EDU91149.1| putative lipoprotein [Escherichia coli O157:H7 str. EC869]
 gi|208725448|gb|EDZ75049.1| putative lipoprotein [Escherichia coli O157:H7 str. EC4206]
 gi|208732719|gb|EDZ81407.1| putative lipoprotein [Escherichia coli O157:H7 str. EC4045]
 gi|208737499|gb|EDZ85182.1| putative lipoprotein [Escherichia coli O157:H7 str. EC4042]
 gi|209161133|gb|ACI38566.1| putative lipoprotein [Escherichia coli O157:H7 str. EC4115]
 gi|217320993|gb|EEC29417.1| putative lipoprotein [Escherichia coli O157:H7 str. TW14588]
 gi|254591552|gb|ACT70913.1| conserved protein [Escherichia coli O157:H7 str. TW14359]
 gi|290761825|gb|ADD55786.1| putative lipoprotein [Escherichia coli O55:H7 str. CB9615]
 gi|320192559|gb|EFW67200.1| hypothetical protein ECoD_00486 [Escherichia coli O157:H7 str.
           EC1212]
 gi|320637820|gb|EFX07612.1| putative lipoprotein [Escherichia coli O157:H7 str. G5101]
 gi|320642945|gb|EFX12146.1| putative lipoprotein [Escherichia coli O157:H- str. 493-89]
 gi|320648402|gb|EFX17057.1| putative lipoprotein [Escherichia coli O157:H- str. H 2687]
 gi|320653718|gb|EFX21792.1| putative lipoprotein [Escherichia coli O55:H7 str. 3256-97 TW
           07815]
 gi|320659561|gb|EFX27124.1| putative lipoprotein [Escherichia coli O55:H7 str. USDA 5905]
 gi|326338151|gb|EGD61980.1| hypothetical protein ECF_05102 [Escherichia coli O157:H7 str. 1125]
 gi|326346128|gb|EGD69866.1| putative lipoprotein [Escherichia coli O157:H7 str. 1044]
          Length = 187

 Score = 38.0 bits (87), Expect = 0.71,   Method: Composition-based stats.
 Identities = 20/130 (15%), Positives = 41/130 (31%), Gaps = 3/130 (2%)

Query: 18  LAVLLCTSLSSCFFHNNPVNIYDLTEST--KYDESVQRHIQLIITEPITEKILNSEDIIV 75
           L  +    L+ C       N Y L          + Q +  L + +      L    ++ 
Sbjct: 5   LVTIAALWLAGCSSGEINKNYYQLPVVQSGTQSTASQGNRLLWVEQVAVPDYLAGNGVVY 64

Query: 76  RSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSF 135
           ++S ++      + W+  L + ++  L+AN         V     G   D  +   +  F
Sbjct: 65  QTSDVKYVIANNNLWASPLDQQLRNTLVANLSTQLPGWVVASQPLGSAQD-TLNVTVTEF 123

Query: 136 EINIDRHCAI 145
               D    +
Sbjct: 124 NGRYDGKVIV 133


>gi|256018789|ref|ZP_05432654.1| hypothetical protein ShiD9_07726 [Shigella sp. D9]
 gi|300824159|ref|ZP_07104278.1| conserved hypothetical protein [Escherichia coli MS 119-7]
 gi|331676742|ref|ZP_08377438.1| putative lipoprotein [Escherichia coli H591]
 gi|300523335|gb|EFK44404.1| conserved hypothetical protein [Escherichia coli MS 119-7]
 gi|331075431|gb|EGI46729.1| putative lipoprotein [Escherichia coli H591]
 gi|332102219|gb|EGJ05565.1| conserved hypothetical protein [Shigella sp. D9]
          Length = 187

 Score = 38.0 bits (87), Expect = 0.75,   Method: Composition-based stats.
 Identities = 20/130 (15%), Positives = 40/130 (30%), Gaps = 3/130 (2%)

Query: 18  LAVLLCTSLSSCFFHNNPVNIYDLTEST--KYDESVQRHIQLIITEPITEKILNSEDIIV 75
           L  +    L  C       N Y L          + Q +  L + +      L    ++ 
Sbjct: 5   LVTIAALWLVGCSSGEINKNYYQLPVVQSGTQSTASQGNRLLWVEQVTVPDYLAGNGVVY 64

Query: 76  RSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSF 135
           ++S ++      + W+  L + ++  L+AN         V     G   D  +   +  F
Sbjct: 65  QTSDVKYVIANNNLWASPLDQQLRNTLVANLSTQLPGWVVASQPLGSAQD-TLNVTVTEF 123

Query: 136 EINIDRHCAI 145
               D    +
Sbjct: 124 NGRYDGKVIV 133


>gi|161522829|ref|YP_001585758.1| hypothetical protein Bmul_5803 [Burkholderia multivorans ATCC
           17616]
 gi|189348332|ref|YP_001941528.1| putative lipoprotein [Burkholderia multivorans ATCC 17616]
 gi|160346382|gb|ABX19466.1| protein of unknown function DUF330 [Burkholderia multivorans ATCC
           17616]
 gi|189338470|dbj|BAG47538.1| putative lipoprotein [Burkholderia multivorans ATCC 17616]
          Length = 236

 Score = 38.0 bits (87), Expect = 0.75,   Method: Composition-based stats.
 Identities = 15/104 (14%), Positives = 37/104 (35%), Gaps = 6/104 (5%)

Query: 1   MDKKLNKIIKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKY--DESVQRHIQLI 58
           M+ +L + ++      + A L   S  +    + PV+ + L+       D +      + 
Sbjct: 1   MNARLFRRLRMTARIATCAALAVLSACA----SPPVHFHTLSAPAGAGGDRAAHPAWLID 56

Query: 59  ITEPITEKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKL 102
           +         +   ++V+  P     L   +W+  L   ++  L
Sbjct: 57  VQTLHVAAPADGNRLVVQRGPGLADILEQERWAAPLGDEMRDGL 100


>gi|331646211|ref|ZP_08347314.1| putative lipoprotein [Escherichia coli M605]
 gi|331044963|gb|EGI17090.1| putative lipoprotein [Escherichia coli M605]
          Length = 187

 Score = 38.0 bits (87), Expect = 0.77,   Method: Composition-based stats.
 Identities = 20/130 (15%), Positives = 41/130 (31%), Gaps = 3/130 (2%)

Query: 18  LAVLLCTSLSSCFFHNNPVNIYDLTEST--KYDESVQRHIQLIITEPITEKILNSEDIIV 75
           L  +    L+ C       N Y L          + Q +  L + +      L    ++ 
Sbjct: 5   LVTIAALWLAGCSSGEINKNYYQLPVVQSGTQSTASQGNRLLWVEQVAVPDNLAGNGVVY 64

Query: 76  RSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSF 135
           ++S ++      + W+  L + ++  L+AN         V     G   D  +   +  F
Sbjct: 65  QTSDVKYVIANNNLWASPLDQQLRNTLVANLSTQLPGWVVASQPLGSAQD-TLNVTVTEF 123

Query: 136 EINIDRHCAI 145
               D    +
Sbjct: 124 NGRYDGKVIV 133


>gi|71666215|ref|XP_820069.1| dispersed gene family protein 1 (DGF-1) [Trypanosoma cruzi strain CL
            Brener]
 gi|70885398|gb|EAN98218.1| dispersed gene family protein 1 (DGF-1), putative [Trypanosoma cruzi]
          Length = 3444

 Score = 38.0 bits (87), Expect = 0.86,   Method: Composition-based stats.
 Identities = 27/186 (14%), Positives = 72/186 (38%), Gaps = 14/186 (7%)

Query: 7    KIIKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIITEPITEK 66
             ++K  ++       L  ++S+    + PV +     S    E++   + L  T P    
Sbjct: 2498 SLLKGAVLYVMGGGALRGAVSAGSDESGPVEL-----SVCDVEALNGALVLTGTYPAGSV 2552

Query: 67   ILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQL--KLIAN-FENNG-KISTVVKPNQGI 122
            +  ++ ++V + P  + YL GSQ S   P ++    +L+ +    +G  + TV+   + +
Sbjct: 2553 LTVTDSLLVATRPTPLVYLPGSQSSPYAPVLVLSGLRLVRSVLVVSGVALVTVMTGGRTV 2612

Query: 123  YAD---YQIISAIRSFEINIDRHCAIITMSLKIINAHDN--SLVGQKVFHVEEKLEKDNK 177
              D    +++    + +  +      +  S +++ +      + G +V+     +     
Sbjct: 2613 AVDGAVLELVGGGVALDAAVLGGEYALYASARVVASWSAVLRVSGSQVYAAHGLVFGSGV 2672

Query: 178  LHFIQS 183
                 +
Sbjct: 2673 EASASA 2678


>gi|119478650|ref|XP_001259407.1| nonribosomal peptide synthase, putative [Neosartorya fischeri NRRL
           181]
 gi|119407561|gb|EAW17510.1| nonribosomal peptide synthase, putative [Neosartorya fischeri NRRL
           181]
          Length = 2179

 Score = 38.0 bits (87), Expect = 0.87,   Method: Composition-based stats.
 Identities = 24/160 (15%), Positives = 58/160 (36%), Gaps = 19/160 (11%)

Query: 55  IQLIITEPITEKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIAN---FE---N 108
            +L+I+ PI  +          + P +  ++   +W+ +     + +       F    +
Sbjct: 367 GELLISGPIVGRG-------YLNQPQQKSFVSSPRWATEFAIPAEERFYKTGDLFRYNVD 419

Query: 109 NGKISTVVKPNQGIYADYQIISAIRSFEINIDRHCAIITMSLKIINAHD---NSLVGQKV 165
           +G +  + + +  +    Q    ++  E +  R    I     +IN  +     L+   +
Sbjct: 420 DGTLRYIGRKDTQVKIHGQ-RVDLQEIEHHARRFQERIDAVADVINPSNTNGRKLLA--L 476

Query: 166 FHVEEKLEKDNKLHFIQSLNRAFSRISSEIIDWTLSSLPL 205
           F    + + D     +  ++ AF  +S  + DW    LP 
Sbjct: 477 FVTTAEADADQNEALLAPMDDAFCALSDSLQDWLREWLPA 516


>gi|330991857|ref|ZP_08315806.1| hypothetical protein SXCC_01762 [Gluconacetobacter sp. SXCC-1]
 gi|329760878|gb|EGG77373.1| hypothetical protein SXCC_01762 [Gluconacetobacter sp. SXCC-1]
          Length = 223

 Score = 38.0 bits (87), Expect = 0.88,   Method: Composition-based stats.
 Identities = 24/149 (16%), Positives = 52/149 (34%), Gaps = 19/149 (12%)

Query: 9   IKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQ--------LIIT 60
           +   + +    +L    LS+C   + PV  Y L        +              + + 
Sbjct: 12  LNPSLRAAGGLLLCAAMLSACS--SAPVRFYTLGAPAVAVGAQGTGTTAITDSTPVIEVE 69

Query: 61  EPITEKILNSEDIIVRSSPIEIQYLIGSQWSDK----LPRMIQLKLIANFENNGKISTVV 116
                  L+S+DI+VR +  EI+     +W+ +       +I  +L   + +      V 
Sbjct: 70  RTRLPDYLDSQDIMVR-NGHEIERSGLGRWASRLSVGATDLITARLAQKWPD----LFVT 124

Query: 117 KPNQGIYADYQIISAIRSFEINIDRHCAI 145
              Q     +++   I   +++ D   A+
Sbjct: 125 DQPQPDRPTWRLQLNISRLDVSRDGQSAL 153


>gi|218700529|ref|YP_002408158.1| hypothetical protein ECIAI39_2195 [Escherichia coli IAI39]
 gi|218370515|emb|CAR18322.1| conserved hypothetical protein [Escherichia coli IAI39]
          Length = 182

 Score = 38.0 bits (87), Expect = 0.89,   Method: Composition-based stats.
 Identities = 28/173 (16%), Positives = 61/173 (35%), Gaps = 7/173 (4%)

Query: 26  LSSCFFHNNPVNIYDLTESTKYDES--VQRHIQLIITEPITEKILNSEDIIVRSSPIEIQ 83
           L+ C       N Y L       +S   Q +  L + +      L    ++ ++S ++  
Sbjct: 8   LAGCSSGEINKNYYQLPVVQGGTQSTASQGNRLLWVEQVAVPDYLAGNGVVYQTSDVKYV 67

Query: 84  YLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFEINIDRHC 143
               + W+  L + ++  L+AN         V     G   D  +   +  F    D   
Sbjct: 68  IANNNLWASPLDQQLRNTLVANLSTQLPGWVVASQPLGSAQD-TLNVTVTEFNGRYDGK- 125

Query: 144 AIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEII 196
            +I     ++N     +  ++ F +E    +D     ++ L   +S+ ++ I 
Sbjct: 126 -VIVSGEWLLNHQGQLI--KRPFRLEGVQTQDGYDEMVKVLASVWSQEAASIA 175


>gi|294670871|ref|ZP_06735727.1| hypothetical protein NEIELOOT_02575 [Neisseria elongata subsp.
           glycolytica ATCC 29315]
 gi|291307358|gb|EFE48601.1| hypothetical protein NEIELOOT_02575 [Neisseria elongata subsp.
           glycolytica ATCC 29315]
          Length = 175

 Score = 37.6 bits (86), Expect = 0.92,   Method: Composition-based stats.
 Identities = 23/163 (14%), Positives = 54/163 (33%), Gaps = 20/163 (12%)

Query: 35  PVNIYDLTESTKYDESVQRHIQLIITEPITEKILNSEDIIVRSSPIEIQYLIGSQWSDKL 94
           P + + + E T      +    L +      + LN   +  RS    + Y     W+  L
Sbjct: 28  PDSTFQMPEHT----RGKTETALRVVP---AEPLNRGGLAYRSDAFRLDYARNHLWAQPL 80

Query: 95  PRMIQLKLIANFEN--NGKISTVVKPNQGIYADYQIISAIRSFEINIDRHCAIITMSLKI 152
            +    +    F     G+       ++   +       + +F+ +             +
Sbjct: 81  DQAAAARFANEFNRMDTGRYFVPAHQSKAAQSA---TIYLEAFQGSYLGST--------L 129

Query: 153 INAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEI 195
           +  +  S  G + F  E   + D     ++SL++  S  +++I
Sbjct: 130 VEGYIRSDSGSRRFRAETPQQGDGYEAMLESLSQGVSAAAAQI 172


>gi|291279795|ref|YP_003496630.1| hypothetical protein DEFDS_1413 [Deferribacter desulfuricans SSM1]
 gi|290754497|dbj|BAI80874.1| conserved hypothetical protein [Deferribacter desulfuricans SSM1]
          Length = 396

 Score = 37.6 bits (86), Expect = 0.99,   Method: Composition-based stats.
 Identities = 13/80 (16%), Positives = 27/80 (33%), Gaps = 7/80 (8%)

Query: 119 NQGIYADYQIISAIRSFEINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKD--- 175
           +    A+  +       E   +     + M++KII+     ++  K     E   K    
Sbjct: 208 SDNALANLALSI----LEATTEGWNVNVEMTVKIIDVATGRIIASKKVKGRELAGKQPNF 263

Query: 176 NKLHFIQSLNRAFSRISSEI 195
           N    I +  +A    + +I
Sbjct: 264 NPELIITAAKKAMGEAALDI 283


>gi|82544724|ref|YP_408671.1| hypothetical protein SBO_2279 [Shigella boydii Sb227]
 gi|81246135|gb|ABB66843.1| conserved hypothetical protein [Shigella boydii Sb227]
          Length = 182

 Score = 37.6 bits (86), Expect = 0.99,   Method: Composition-based stats.
 Identities = 20/122 (16%), Positives = 40/122 (32%), Gaps = 3/122 (2%)

Query: 26  LSSCFFHNNPVNIYDLTESTKYDES--VQRHIQLIITEPITEKILNSEDIIVRSSPIEIQ 83
           L+ C       N Y L       +S   Q +  L + +      L    ++ ++S ++  
Sbjct: 8   LAGCSSGEINKNYYQLPVVQSGTQSTASQGNRLLWVEQVTVPDYLAGNGVVYQTSDVKYV 67

Query: 84  YLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFEINIDRHC 143
               + W+  L + ++  L+AN         V     G   D  +   +  F    D   
Sbjct: 68  IANNNLWASPLDQQLRNTLVANLSTQLPGWVVASQPLGSVQD-TLNVTVTEFNGRYDGKV 126

Query: 144 AI 145
            +
Sbjct: 127 IV 128


>gi|331662364|ref|ZP_08363287.1| putative lipoprotein [Escherichia coli TA143]
 gi|331060786|gb|EGI32750.1| putative lipoprotein [Escherichia coli TA143]
          Length = 187

 Score = 37.6 bits (86), Expect = 1.0,   Method: Composition-based stats.
 Identities = 28/181 (15%), Positives = 62/181 (34%), Gaps = 7/181 (3%)

Query: 18  LAVLLCTSLSSCFFHNNPVNIYDLTEST--KYDESVQRHIQLIITEPITEKILNSEDIIV 75
           L  +    L+ C       N Y L          + Q +  L + +      L    ++ 
Sbjct: 5   LVTIAALWLAGCSSGEINKNYYQLPVVQSGTQSTASQGNRLLWVVQVAVPDYLAGNGVVY 64

Query: 76  RSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSF 135
           ++S ++      + W+  L + ++  L+AN         V     G   D  +   +  F
Sbjct: 65  QTSDVKYVIANNNLWASPLDQQLRNTLVANLSTQLPGWVVASQPLGSAQD-TLNVTVTEF 123

Query: 136 EINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEI 195
               D    +I     ++N     +  ++ F +E    +D     ++ L   +S+ ++ I
Sbjct: 124 NGRYDGK--VIVSGEWLLNHQGQLI--KRPFRLEGVQTQDGYDEMVKVLASVWSQEAASI 179

Query: 196 I 196
            
Sbjct: 180 A 180


>gi|113970204|ref|YP_733997.1| hypothetical protein Shewmr4_1866 [Shewanella sp. MR-4]
 gi|113884888|gb|ABI38940.1| protein of unknown function DUF330 [Shewanella sp. MR-4]
          Length = 197

 Score = 37.6 bits (86), Expect = 1.0,   Method: Composition-based stats.
 Identities = 22/195 (11%), Positives = 68/195 (34%), Gaps = 29/195 (14%)

Query: 18  LAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHI------QLIITEPITEKILNSE 71
           L + +   ++ C     P   +   + T     +   +       L +        LN+ 
Sbjct: 4   LVLFIVFLMAGCSSQPAPKTYFIALQHTTDPGLISPDMGSGGLCSLAVNRVNLADYLNTN 63

Query: 72  DIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISA 131
            ++ ++SP E+       W+  L   IQ +L          + ++     + A + + + 
Sbjct: 64  GLLYQTSPQELVVARQHLWAGSLAEQIQFRL----------NNLLSQPCSVPATWTLSTD 113

Query: 132 -----------IRSFEINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHF 180
                      +  F  +     A++    ++++     ++ ++ F     L ++     
Sbjct: 114 EPTKLGQLDLTVTEFYGSYTG-EAVVGGQWRLMD-KMQQVLLEQPFQYRIALPEEGYTAL 171

Query: 181 IQSLNRAFSRISSEI 195
           + S+++   +++ +I
Sbjct: 172 VSSMDKGLIQLADDI 186


>gi|37525703|ref|NP_929047.1| hypothetical protein plu1768 [Photorhabdus luminescens subsp.
           laumondii TTO1]
 gi|36785132|emb|CAE14061.1| unnamed protein product [Photorhabdus luminescens subsp. laumondii
           TTO1]
          Length = 187

 Score = 37.3 bits (85), Expect = 1.3,   Method: Composition-based stats.
 Identities = 25/129 (19%), Positives = 45/129 (34%), Gaps = 5/129 (3%)

Query: 18  LAVLLCTSLSSCFFHNNPVNIYDLTE---STKYDESVQRHIQLIITEPITEKILNSEDII 74
           LA++L   +S+C         Y L     +++    VQ   QL +   +    L+S  ++
Sbjct: 5   LALILVIFISACSRQPE-KTYYQLPVVAIASQKSAIVQHDRQLWVQRVMLSDYLSSSGVV 63

Query: 75  VRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRS 134
            +SS +         W+  L + +Q  L+A          V         D  +   + S
Sbjct: 64  YQSSDVSYVSAANHLWASPLEQQLQQVLVAELTMALPQRLVSAQPLVNKPD-TLDVTVTS 122

Query: 135 FEINIDRHC 143
           F    D   
Sbjct: 123 FHGRYDGKV 131


>gi|323967199|gb|EGB62623.1| hypothetical protein ERJG_01482 [Escherichia coli M863]
 gi|327253744|gb|EGE65373.1| hypothetical protein ECSTEC7V_1169 [Escherichia coli STEC_7v]
          Length = 187

 Score = 37.3 bits (85), Expect = 1.3,   Method: Composition-based stats.
 Identities = 20/130 (15%), Positives = 41/130 (31%), Gaps = 3/130 (2%)

Query: 18  LAVLLCTSLSSCFFHNNPVNIYDLTEST--KYDESVQRHIQLIITEPITEKILNSEDIIV 75
           L  +    L+ C       N Y L          + Q +  L + +      L    ++ 
Sbjct: 5   LVTIAALWLAGCSSGEINKNYYQLPVVQSGTQSTASQGNHLLWVEQVAVPDYLAGNGVVY 64

Query: 76  RSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSF 135
           ++S ++      + W+  L + ++  L+AN         V     G   D  +   +  F
Sbjct: 65  QTSDVKYVIANNNLWASPLDQQLRNTLVANLSTQLPGWVVASQPLGSAQD-TLNVTVTEF 123

Query: 136 EINIDRHCAI 145
               D    +
Sbjct: 124 NGRYDGKVIV 133


>gi|91792029|ref|YP_561680.1| hypothetical protein Sden_0667 [Shewanella denitrificans OS217]
 gi|91714031|gb|ABE53957.1| protein of unknown function DUF330 [Shewanella denitrificans OS217]
          Length = 211

 Score = 37.3 bits (85), Expect = 1.4,   Method: Composition-based stats.
 Identities = 28/200 (14%), Positives = 68/200 (34%), Gaps = 17/200 (8%)

Query: 9   IKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIIT-EPITE-K 66
           I +      + +L    L+ C       N Y LT +     +    ++L I   PI+  +
Sbjct: 6   IMRLTAVLGIFILQAALLTGCQTSPQ-KNYYVLTSAAPPRLASNTSLELAIGIGPISIPE 64

Query: 67  ILNSEDIIVRSSPIEIQYLIGSQWSDKL----PRMIQLKLIANFENNGKISTVVKPNQGI 122
            L+   ++ ++    +     S W++ L     R++ L L     +   +    +     
Sbjct: 65  YLHFTQLVYQTQAGYLHRFDNSYWAEPLDQGINRILGLNLTQASPSRQLVQFPWRLEN-- 122

Query: 123 YADYQIISAIRSFEINIDRHCAIITMSLKIINAHDNSLVGQ-------KVFHVEEKLEKD 175
              Y I   I +  +   +       +LK +++   ++          + F      E+ 
Sbjct: 123 RPQYSISINILNLNLMEGQASLQAVWTLKDLSSTTKAIPASPQKDGQGQHFQASVPAEQS 182

Query: 176 NKLHFIQSLNRAFSRISSEI 195
                + + ++    +S +I
Sbjct: 183 AT-GLVMAYSQLLQLLSEQI 201


>gi|162146511|ref|YP_001600970.1| hypothetical protein GDI_0687 [Gluconacetobacter diazotrophicus PAl
           5]
 gi|161785086|emb|CAP54630.1| conserved hypothetical protein [Gluconacetobacter diazotrophicus
           PAl 5]
          Length = 218

 Score = 37.3 bits (85), Expect = 1.4,   Method: Composition-based stats.
 Identities = 17/90 (18%), Positives = 31/90 (34%), Gaps = 4/90 (4%)

Query: 19  AVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIITEPITEKILNSEDIIVRSS 78
            V     L +C         Y L       +     + + +  P     L+ + I+    
Sbjct: 27  TVAAAGPLGACSSDPA---FYALAPWPGAAQGGA-PMVIEVRTPNVAVSLDRDRIVRSDG 82

Query: 79  PIEIQYLIGSQWSDKLPRMIQLKLIANFEN 108
              ++   G+ WS+ LP MI   L A+ + 
Sbjct: 83  DYRVRLADGAAWSESLPGMIAHVLTADLQQ 112


>gi|320664332|gb|EFX31483.1| putative lipoprotein [Escherichia coli O157:H7 str. LSU-61]
          Length = 187

 Score = 37.3 bits (85), Expect = 1.4,   Method: Composition-based stats.
 Identities = 21/130 (16%), Positives = 42/130 (32%), Gaps = 3/130 (2%)

Query: 18  LAVLLCTSLSSCFFHNNPVNIYDLTESTKYDES--VQRHIQLIITEPITEKILNSEDIIV 75
           L  +    L+ C       N Y L       +S   Q +  L + +      L    ++ 
Sbjct: 5   LVTIAALWLAGCSSGEINKNYYQLPVVQSGTQSTASQGNRLLWVEQVAVPDYLAGNGVVY 64

Query: 76  RSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSF 135
           ++S ++      + W+  L + ++  L+AN         V     G   D  +   +  F
Sbjct: 65  QTSDVKYVIANNNLWASPLDQQLRNTLVANLSMQLPGWVVASQPLGSAQD-TLNVTVTEF 123

Query: 136 EINIDRHCAI 145
               D    +
Sbjct: 124 NGRYDGKVIV 133


>gi|209543490|ref|YP_002275719.1| hypothetical protein Gdia_1322 [Gluconacetobacter diazotrophicus
           PAl 5]
 gi|209531167|gb|ACI51104.1| protein of unknown function DUF330 [Gluconacetobacter
           diazotrophicus PAl 5]
          Length = 217

 Score = 37.3 bits (85), Expect = 1.5,   Method: Composition-based stats.
 Identities = 17/90 (18%), Positives = 31/90 (34%), Gaps = 4/90 (4%)

Query: 19  AVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIITEPITEKILNSEDIIVRSS 78
            V     L +C         Y L       +     + + +  P     L+ + I+    
Sbjct: 26  TVAAAGPLGACSSDPA---FYALAPWPGAAQGGA-PMVIEVRTPNVAVSLDRDRIVRSDG 81

Query: 79  PIEIQYLIGSQWSDKLPRMIQLKLIANFEN 108
              ++   G+ WS+ LP MI   L A+ + 
Sbjct: 82  DYRVRLADGAAWSESLPGMIAHVLTADLQQ 111


>gi|186477284|ref|YP_001858754.1| hypothetical protein Bphy_2536 [Burkholderia phymatum STM815]
 gi|184193743|gb|ACC71708.1| protein of unknown function DUF330 [Burkholderia phymatum STM815]
          Length = 233

 Score = 36.9 bits (84), Expect = 1.5,   Method: Composition-based stats.
 Identities = 31/170 (18%), Positives = 63/170 (37%), Gaps = 10/170 (5%)

Query: 32  HNNPVNIYDLT---ESTKYDESVQRHIQLI-ITEPITEKILNSEDIIVRSSPIEIQYLIG 87
            + P + Y L+    S     S      LI +        +    ++V++ P ++Q L  
Sbjct: 30  SSPPSHFYTLSAGDASPDAVRSASNPAFLIEVPPVDVPPQVAKSQLVVQTGPTQVQVLEQ 89

Query: 88  SQWSDKLPRMIQLKLIANF-ENNGKISTVVKPNQGIYADYQIISAIRSFEINIDRHCAII 146
            +W+      I+  L ++  +  G I     P       Y+I   ++ FE        I 
Sbjct: 90  ERWASLPGDEIRRALSSSLTQQLGTIDVYGSPYPERVPVYRISVNVQRFESWPGSRTLID 149

Query: 147 TM-SLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEI 195
            + S++ +     +++  +   V E +   +         RA  +IS+EI
Sbjct: 150 AVWSVRAV--RTQAVLTCRSV-VSEPVSG-SYDAIADGHRRAVQQISTEI 195


>gi|317011596|gb|ADU85343.1| hypothetical protein HPSA_06935 [Helicobacter pylori SouthAfrica7]
          Length = 225

 Score = 36.9 bits (84), Expect = 1.6,   Method: Composition-based stats.
 Identities = 19/102 (18%), Positives = 41/102 (40%), Gaps = 4/102 (3%)

Query: 36  VNIYDLTESTKYDESVQRHIQ-LIITEPITEKILNSEDIIVRSSPIEIQYLIGSQWSDKL 94
           +  YDL  S+       + +  + +   ++  + N+++I+ ++   +I +    +W D  
Sbjct: 34  IRTYDLNASSFEIAQCVKPLTEVRLISILSADLFNTKEIVFKAKDGQITHGKHQKWIDLP 93

Query: 95  PRMIQLKLIANFENNGKISTVVKPNQGIYAD-YQIISAIRSF 135
             M++   +   E       V  P  G  A  Y +   I SF
Sbjct: 94  RNMLKTMFMQ--EAQKACLGVALPPYGAGAPTYAVRFTILSF 133


>gi|294054791|ref|YP_003548449.1| protein of unknown function DUF330 [Coraliomargarita akajimensis
           DSM 45221]
 gi|293614124|gb|ADE54279.1| protein of unknown function DUF330 [Coraliomargarita akajimensis
           DSM 45221]
          Length = 196

 Score = 36.9 bits (84), Expect = 1.6,   Method: Composition-based stats.
 Identities = 29/200 (14%), Positives = 69/200 (34%), Gaps = 16/200 (8%)

Query: 6   NKIIKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYD---ESVQRHIQLIITEP 62
            K+    I   S  +  C +L       + + +Y L +    +    +        I  P
Sbjct: 3   MKMYAIGIAGLSFLLSACVNL---KPVEDNLKLYVLGDPKGVEVVETASSVEECFYIASP 59

Query: 63  ITEKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGI 122
                L+++  +VR+   E+      +W++ L   I   L       G      +   G 
Sbjct: 60  DLPSHLSNDRFMVRTLNGELIEKSDVRWAEPLEEGICRALSEYISREG-----GRWVTGY 114

Query: 123 YADYQIISAIRSFEINIDRHCAIITMSLKI-----INAHDNSLVGQKVFHVEEKLEKDNK 177
           Y   ++ + I    +  +    +   S++I     +    + L G      +   + ++ 
Sbjct: 115 YPWPKLEANIPQLRVRFNELAFVDDGSVRISVFWVVRNRSDVLSGGVYNTYDLSWDPESP 174

Query: 178 LHFIQSLNRAFSRISSEIID 197
              +++LN A   +++ +I 
Sbjct: 175 ESLVKALNAALEGLATAVIA 194


>gi|257092748|ref|YP_003166389.1| glycosyl transferase family 51 [Candidatus Accumulibacter
           phosphatis clade IIA str. UW-1]
 gi|257045272|gb|ACV34460.1| glycosyl transferase family 51 [Candidatus Accumulibacter
           phosphatis clade IIA str. UW-1]
          Length = 800

 Score = 36.9 bits (84), Expect = 1.6,   Method: Composition-based stats.
 Identities = 17/119 (14%), Positives = 42/119 (35%), Gaps = 6/119 (5%)

Query: 57  LIITEPITEKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANF--ENNGKIST 114
           L++   I  ++  + +  V      +Q +  + W  +        L+  F  E+    + 
Sbjct: 321 LVVRTTIDSRLQAAANQAVTRQGNSLQNIANAAWGKRSAWGTDSSLVQAFIRESPEYAAA 380

Query: 115 VVKPNQGIYADYQIISAIRSFEINIDRHCAIITMSLKIINAHDNSL---VGQKVFHVEE 170
           + K      A  ++ +  + F   + +    I +    I+  +  +   VG + F  E 
Sbjct: 381 IAKDRTPAQAMLELQAD-KDFMRALRQQKTQIQIGFLAIDPRNGHIKAWVGSRDFEQEA 438


>gi|82776243|ref|YP_402592.1| hypothetical protein SDY_0925 [Shigella dysenteriae Sd197]
 gi|218557850|ref|YP_002390763.1| hypothetical protein ECS88_0973 [Escherichia coli S88]
 gi|218688788|ref|YP_002397000.1| hypothetical protein ECED1_0975 [Escherichia coli ED1a]
 gi|218704375|ref|YP_002411894.1| hypothetical protein ECUMN_1141 [Escherichia coli UMN026]
 gi|309786684|ref|ZP_07681304.1| conserved hypothetical protein [Shigella dysenteriae 1617]
 gi|81240391|gb|ABB61101.1| conserved hypothetical protein [Shigella dysenteriae Sd197]
 gi|218364619|emb|CAR02305.1| conserved hypothetical protein [Escherichia coli S88]
 gi|218426352|emb|CAR07177.1| conserved hypothetical protein [Escherichia coli ED1a]
 gi|218431472|emb|CAR12350.1| conserved hypothetical protein [Escherichia coli UMN026]
 gi|308925377|gb|EFP70864.1| conserved hypothetical protein [Shigella dysenteriae 1617]
          Length = 182

 Score = 36.9 bits (84), Expect = 1.6,   Method: Composition-based stats.
 Identities = 27/173 (15%), Positives = 60/173 (34%), Gaps = 7/173 (4%)

Query: 26  LSSCFFHNNPVNIYDLTEST--KYDESVQRHIQLIITEPITEKILNSEDIIVRSSPIEIQ 83
           L+ C       N Y L          + Q +  L + +      L    ++ ++S ++  
Sbjct: 8   LAGCSSGEINKNYYQLPVVQSGTQSTASQGNRLLWVEQVAVPDYLAGNGVVYQTSDVKYV 67

Query: 84  YLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFEINIDRHC 143
               + W+  L + ++  L+AN         V     G   D  +   +  F    D   
Sbjct: 68  IANNNLWASPLDQQLRNTLVANLSTQLPGWVVASQPLGSAQD-TLNVTVTEFNGRYDGK- 125

Query: 144 AIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEII 196
            +I     ++N     +  ++ F +E    +D     ++ L   +S+ ++ I 
Sbjct: 126 -VIVSGEWLLNHQGQLI--KRPFRLEGVQTQDGYDEMVKVLASVWSQEAASIA 175


>gi|218553539|ref|YP_002386452.1| hypothetical protein ECIAI1_0993 [Escherichia coli IAI1]
 gi|218360307|emb|CAQ97857.1| conserved hypothetical protein [Escherichia coli IAI1]
          Length = 182

 Score = 36.9 bits (84), Expect = 1.7,   Method: Composition-based stats.
 Identities = 27/173 (15%), Positives = 59/173 (34%), Gaps = 7/173 (4%)

Query: 26  LSSCFFHNNPVNIYDLTEST--KYDESVQRHIQLIITEPITEKILNSEDIIVRSSPIEIQ 83
           L  C       N Y L          + Q +  L + +      L    ++ ++S ++  
Sbjct: 8   LVGCSSGEINKNYYQLPVVQSGTQSTASQGNRLLWVEQVTVPDYLAGNGVVYQTSDVKYV 67

Query: 84  YLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFEINIDRHC 143
               + W+  L + ++  L+AN         V     G   D  +   +  F    D   
Sbjct: 68  IANNNLWASPLDQQLRNTLVANLSTQLPGWVVASQPLGSAQD-TLNVTVTEFNGRYDGK- 125

Query: 144 AIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEII 196
            +I     ++N     +  ++ F +E    +D     ++ L   +S+ ++ I 
Sbjct: 126 -VIVSGEWLLNHQGQLI--KRPFRLEGVQTQDGYDEMVKVLASVWSQEAASIA 175


>gi|241206107|ref|YP_002977203.1| adenylate/guanylate cyclase [Rhizobium leguminosarum bv. trifolii
           WSM1325]
 gi|240859997|gb|ACS57664.1| adenylate/guanylate cyclase with TPR repeats [Rhizobium
           leguminosarum bv. trifolii WSM1325]
          Length = 595

 Score = 36.9 bits (84), Expect = 1.7,   Method: Composition-based stats.
 Identities = 22/167 (13%), Positives = 56/167 (33%), Gaps = 23/167 (13%)

Query: 33  NNPVNIYDLTESTKYDESVQRHIQLIITEPITEKILNSEDIIV-----RSSPIEIQYLIG 87
             P+ +Y L   T    S  R ++  I  P    + +   I +      S   E +Y   
Sbjct: 161 AEPMQVYSLQIGTPEPNS-ARQVRPAIEMPSAPAVPDKPSIAILAFNNMSGDAEQEYFSD 219

Query: 88  SQWSDKLPRMIQLKLIANFENNGKI------STVVKPNQGIYADYQIISAIRSFEINIDR 141
               D +  + +L  +     N         ++V    + +   Y +  ++R       +
Sbjct: 220 GISEDIITDLSKLSELHVIARNSSFVYKNVTASVPAMAKALGVRYVLEGSVR-------K 272

Query: 142 HCAIITMSLKIINAHDNSLVGQKVFHVEE----KLEKDNKLHFIQSL 184
               + ++ ++I+A +   +    F  +      ++ +     + +L
Sbjct: 273 AGNRVRVTAQLIDASNGGHIWASRFDRDLTDIFAVQDELTQEIVAAL 319


>gi|218548461|ref|YP_002382252.1| hypothetical protein EFER_1089 [Escherichia fergusonii ATCC 35469]
 gi|218356002|emb|CAQ88618.1| conserved hypothetical protein [Escherichia fergusonii ATCC 35469]
          Length = 182

 Score = 36.9 bits (84), Expect = 1.7,   Method: Composition-based stats.
 Identities = 19/122 (15%), Positives = 39/122 (31%), Gaps = 3/122 (2%)

Query: 26  LSSCFFHNNPVNIYDLTEST--KYDESVQRHIQLIITEPITEKILNSEDIIVRSSPIEIQ 83
           L+ C       N Y L          + Q +  L + +      L    ++ ++S ++  
Sbjct: 8   LAGCSSGEINKNYYQLPVVQSGTQSTASQGNRLLWVEQVAVPDYLAGNGVVYQTSDVKYV 67

Query: 84  YLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFEINIDRHC 143
               + W+  L + ++  L+AN         V     G   D  +   +  F    D   
Sbjct: 68  IANNNLWASPLDQQLRNTLVANLSTQLPGWVVASQPLGSAQD-TLNVTVTEFNGRYDGKV 126

Query: 144 AI 145
            +
Sbjct: 127 IV 128


>gi|15800811|ref|NP_286827.1| hypothetical protein Z1302 [Escherichia coli O157:H7 EDL933]
 gi|15830290|ref|NP_309063.1| hypothetical protein ECs1036 [Escherichia coli O157:H7 str. Sakai]
 gi|12514134|gb|AAG55438.1|AE005285_5 orf, hypothetical protein [Escherichia coli O157:H7 str. EDL933]
 gi|13360496|dbj|BAB34459.1| hypothetical protein [Escherichia coli O157:H7 str. Sakai]
 gi|209774488|gb|ACI85556.1| hypothetical protein ECs1036 [Escherichia coli]
 gi|209774490|gb|ACI85557.1| hypothetical protein ECs1036 [Escherichia coli]
 gi|209774492|gb|ACI85558.1| hypothetical protein ECs1036 [Escherichia coli]
 gi|209774494|gb|ACI85559.1| hypothetical protein ECs1036 [Escherichia coli]
 gi|209774496|gb|ACI85560.1| hypothetical protein ECs1036 [Escherichia coli]
          Length = 182

 Score = 36.9 bits (84), Expect = 1.7,   Method: Composition-based stats.
 Identities = 19/122 (15%), Positives = 39/122 (31%), Gaps = 3/122 (2%)

Query: 26  LSSCFFHNNPVNIYDLTEST--KYDESVQRHIQLIITEPITEKILNSEDIIVRSSPIEIQ 83
           L+ C       N Y L          + Q +  L + +      L    ++ ++S ++  
Sbjct: 8   LAGCSSGEINKNYYQLPVVQSGTQSTASQGNRLLWVEQVAVPDYLAGNGVVYQTSDVKYV 67

Query: 84  YLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFEINIDRHC 143
               + W+  L + ++  L+AN         V     G   D  +   +  F    D   
Sbjct: 68  IANNNLWASPLDQQLRNTLVANLSTQLPGWVVASQPLGSAQD-TLNVTVTEFNGRYDGKV 126

Query: 144 AI 145
            +
Sbjct: 127 IV 128


>gi|15842988|ref|NP_338025.1| hypothetical protein MT3502 [Mycobacterium tuberculosis CDC1551]
 gi|13883328|gb|AAK47839.1| hypothetical protein MT3502 [Mycobacterium tuberculosis CDC1551]
          Length = 227

 Score = 36.9 bits (84), Expect = 1.8,   Method: Composition-based stats.
 Identities = 18/119 (15%), Positives = 42/119 (35%), Gaps = 18/119 (15%)

Query: 44  STKYDESVQRHIQLIITEPITEKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLI 103
           S K      R   L+   P            V   P  +  L G++       ++   + 
Sbjct: 52  SEKVSGGPSRSGDLVPAGP------------VSLPPGTVGVLSGAR------SLLLSMVA 93

Query: 104 ANFENNGKISTVVKPNQGIYADYQIISAIRSFEINIDRHCAIITMSLKIINAHDNSLVG 162
           +     G  + V +P+ G+ A  ++ + +    +  D     + ++  +I+  D  ++G
Sbjct: 94  SVTAAGGNAAIVGQPDIGLLAAVEMGADLSRLAVIPDPGTDPVEVAAVLIDGMDLVVLG 152


>gi|260428120|ref|ZP_05782099.1| conserved hypothetical protein [Citreicella sp. SE45]
 gi|260422612|gb|EEX15863.1| conserved hypothetical protein [Citreicella sp. SE45]
          Length = 186

 Score = 36.9 bits (84), Expect = 1.9,   Method: Composition-based stats.
 Identities = 21/180 (11%), Positives = 60/180 (33%), Gaps = 8/180 (4%)

Query: 20  VLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIITEPITEKILNSEDIIVRSSP 79
           +     L++C         Y +    +   S  +   L + +        + +I++    
Sbjct: 9   LPFALILAACGAEPR----YLIDPPVQSGTSRLQVATLEVMDVSLPAYAEASEILLEGED 64

Query: 80  IEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFEINI 139
             +  +  + W+D   R + L +          + V      +  D Q    +      +
Sbjct: 65  GALTQVDNALWADDSRRAVTLAIAEQIGRASS-AAVAPEPWPLEEDAQAQVHVSV-SRMV 122

Query: 140 DRHCAIITMSLKIINAHDNSLVGQKV--FHVEEKLEKDNKLHFIQSLNRAFSRISSEIID 197
            R    +++  +   +  + +V +++  F +   +   +     Q+   A + +SS+I  
Sbjct: 123 ARANGTLSLDGQFAVSSYDRVVRERIQRFAITVPMASADPAGIAQATGAAIAELSSQITA 182


>gi|289810598|ref|ZP_06541227.1| putative lipoprotein [Salmonella enterica subsp. enterica serovar
           Typhi str. AG3]
          Length = 148

 Score = 36.9 bits (84), Expect = 1.9,   Method: Composition-based stats.
 Identities = 26/151 (17%), Positives = 63/151 (41%), Gaps = 9/151 (5%)

Query: 47  YDESVQRHIQLIITEPITEKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANF 106
              + Q +  L + +      L    ++ ++S ++      + W+  L + ++  L+AN 
Sbjct: 5   QSTASQGNRLLWVEQVSVPDYLAGNGVVYQTSDVQYVIANNNLWASPLDQQLRNTLVANL 64

Query: 107 ENNGKIST--VVKPNQGIYADYQIISAIRSFEINIDRHCAIITMSLKIINAHDNSLVGQK 164
             + ++    V     G   D  +   +  F    D     + +S + +  H+  L+ ++
Sbjct: 65  --SARLPGWVVASQPLGTTQD-TLNVTVTGFHGRYDGK---VIVSGEWLLNHNGQLI-KR 117

Query: 165 VFHVEEKLEKDNKLHFIQSLNRAFSRISSEI 195
            FH+E   +KD     ++ L  A+S+ ++ I
Sbjct: 118 PFHIEASQQKDGYDEMVKVLASAWSQEAAAI 148


>gi|227115413|ref|ZP_03829069.1| putative lipoprotein [Pectobacterium carotovorum subsp.
           brasiliensis PBR1692]
          Length = 214

 Score = 36.9 bits (84), Expect = 2.0,   Method: Composition-based stats.
 Identities = 27/197 (13%), Positives = 66/197 (33%), Gaps = 19/197 (9%)

Query: 14  ISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDE-------SVQRHIQLIITEPITEK 66
           ++  L++ +   LS+C       +   LT ++           +      + +       
Sbjct: 4   VALLLSITVIALLSACSSPPVRYHT-LLTPASPVATLSFMANTTHAAPFFIDVLPVGVPA 62

Query: 67  ILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFE---NNGKISTVVKPNQGIY 123
            L++  I++R        L   +W   L   I+  L A+     N   +S +V+      
Sbjct: 63  QLDTSQIVIRQGDSGAVVLDNERWLSPLSEEIRTALSADLTQRLNTQDVSGLVRSADTPV 122

Query: 124 ADYQIISAIRSFEINIDRH---CAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHF 180
              +I   +R F+    +     A  ++S          L+ +  F  +           
Sbjct: 123 --VRIHLQVRRFDSWPGQSVMFEADWSLSAVGEEDERARLLCRSQFTEQAANSDT---AM 177

Query: 181 IQSLNRAFSRISSEIID 197
           +++  +  +R++ +I  
Sbjct: 178 LRAQQQVITRLAEQIAA 194


>gi|254366008|ref|ZP_04982053.1| conserved hypothetical protein [Mycobacterium tuberculosis str.
           Haarlem]
 gi|134151521|gb|EBA43566.1| conserved hypothetical protein [Mycobacterium tuberculosis str.
           Haarlem]
          Length = 205

 Score = 36.5 bits (83), Expect = 2.1,   Method: Composition-based stats.
 Identities = 18/119 (15%), Positives = 42/119 (35%), Gaps = 18/119 (15%)

Query: 44  STKYDESVQRHIQLIITEPITEKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLI 103
           S K      R   L+   P            V   P  +  L G++       ++   + 
Sbjct: 29  SEKVSGGPSRSGDLVPAGP------------VSLPPGTVGVLSGAR------SLLLSMVA 70

Query: 104 ANFENNGKISTVVKPNQGIYADYQIISAIRSFEINIDRHCAIITMSLKIINAHDNSLVG 162
           +     G  + V +P+ G+ A  ++ + +    +  D     + ++  +I+  D  ++G
Sbjct: 71  SVTAAGGNAAIVGQPDIGLLAAVEMGADLSRLAVIPDPGTDPVEVAAVLIDGMDLVVLG 129


>gi|270261230|ref|ZP_06189503.1| putative lipoprotein [Serratia odorifera 4Rx13]
 gi|270044714|gb|EFA17805.1| putative lipoprotein [Serratia odorifera 4Rx13]
          Length = 185

 Score = 36.5 bits (83), Expect = 2.1,   Method: Composition-based stats.
 Identities = 30/185 (16%), Positives = 67/185 (36%), Gaps = 14/185 (7%)

Query: 18  LAVLLCTSLSSCFFHNNPVNIY-DLTESTKYDE--SVQRHIQLIITEPITEKILNSEDII 74
           + V L   LS+C   + P   Y  L    +     +     QL +        L    ++
Sbjct: 5   IPVALALLLSACS--STPQKTYYQLPALGEAAPVSTGAATRQLWLEHVSVADYLAQNGVV 62

Query: 75  VRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKIST--VVKPNQGIYADYQIISAI 132
            +++ ++      + W+  L + +Q  L+ N   +G +    V         D  +   +
Sbjct: 63  YQTNDVQYVIAQNNLWASPLDQQLQQTLVTNL--SGALPGWVVSSQPMSSEQDV-LNVTV 119

Query: 133 RSFEINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRIS 192
             F    D   AII     + +  +   + ++ F +E K  +D     +++L + + + +
Sbjct: 120 SGFHGRFDGK-AIIRGEWVLNHQGN---LTKRPFSLELKQGEDGYDALVRTLAQGWQQEA 175

Query: 193 SEIID 197
             I  
Sbjct: 176 QAIAS 180


>gi|253990226|ref|YP_003041582.1| hypothetical protein PAU_02749 [Photorhabdus asymbiotica subsp.
           asymbiotica ATCC 43949]
 gi|253781676|emb|CAQ84839.1| conserved hypothetical protein [Photorhabdus asymbiotica]
          Length = 187

 Score = 36.5 bits (83), Expect = 2.2,   Method: Composition-based stats.
 Identities = 24/129 (18%), Positives = 45/129 (34%), Gaps = 5/129 (3%)

Query: 18  LAVLLCTSLSSCFFHNNPVNIYDLTE---STKYDESVQRHIQLIITEPITEKILNSEDII 74
           LA++L   +S+C         Y L     +++   ++Q   QL +   +    L+S  ++
Sbjct: 5   LALILVIFISACSNQPE-KTYYQLPTVKIASQNSAAIQHDRQLWVQRIMLSDYLSSSGVV 63

Query: 75  VRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRS 134
            +SS +         W+  L + +Q  L+A          V         D  +   I  
Sbjct: 64  YQSSDVSYISAANHLWAGPLEQQLQQVLVAELTMALPQRLVSAQPLVNKPD-TLDVTITG 122

Query: 135 FEINIDRHC 143
           F    D   
Sbjct: 123 FHGRYDGKV 131


>gi|220934669|ref|YP_002513568.1| protein of unknown function DUF330 [Thioalkalivibrio sp. HL-EbGR7]
 gi|219995979|gb|ACL72581.1| protein of unknown function DUF330 [Thioalkalivibrio sp. HL-EbGR7]
          Length = 218

 Score = 36.5 bits (83), Expect = 2.2,   Method: Composition-based stats.
 Identities = 21/155 (13%), Positives = 47/155 (30%), Gaps = 4/155 (2%)

Query: 2   DKKLNKIIKKKIISCSLAVLLCTSLSSCFFHNNPV-NIYDLTESTKYDESVQRHIQLIIT 60
              L ++++  +    LA L   S+        PV   + +        +      L+I 
Sbjct: 4   RSLLTRLVQTMLTMALLAGLSACSVGVDLQRPAPVKQTFLIELQRDNILAPATAPSLVIA 63

Query: 61  EPITEKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQ 120
                       ++ R      +    +QW       +   +          + V+ P  
Sbjct: 64  PVRMASAYEGRALVYRMQDDRFESDYYNQWFTAPRDQLGEAVAYWMRRGSVFADVLPPTL 123

Query: 121 GIYADYQIISAIRSFEI---NIDRHCAIITMSLKI 152
              ADY++   +  F +   +   H A +T+   +
Sbjct: 124 AGEADYRLDLVVTDFYVDMRDAADHRARVTLQAYL 158


>gi|153949869|ref|YP_001401513.1| lipoprotein [Yersinia pseudotuberculosis IP 31758]
 gi|170024862|ref|YP_001721367.1| hypothetical protein YPK_2637 [Yersinia pseudotuberculosis YPIII]
 gi|152961364|gb|ABS48825.1| putative lipoprotein [Yersinia pseudotuberculosis IP 31758]
 gi|169751396|