>cd00387 Ribosomal_L7_L12 Ribosomal protein L7/L12. Ribosomal protein L7/L12 refers to the large ribosomal subunit proteins L7 and L12, which are identical except that L7 is acetylated at the N terminus. It is a component of the L7/L12 stalk, which is located at the surface of the ribosome. The stalk base consists of a portion of the 23S rRNA and ribosomal proteins L11 and L10. An extended C-terminal helix of L10 provides the binding site for L7/L12. L7/L12 consists of two domains joined by a flexible hinge, with the helical N-terminal domain (NTD) forming pairs of homodimers that bind to the extended helix of L10. It is the only multimeric ribosomal component, with either four or six copies per ribosome that occur as two or three dimers bound to the L10 helix. L7/L12 is the only ribosomal protein that does not interact directly with rRNA, but instead has indirect interactions through L10. The globular C-terminal domains of L7/L12 are highly mobile. They are exposed to the cytoplasm and

Probab=100.00 E-value=1e-38 Score=254.16 Aligned_cols=123 Identities=66% Similarity=0.861 Sum_probs=107.3 Q ss_pred CCHHHHHHHHHHCCHHHHHHHHHHHHHHHCCCCCCCCCCCCCC----CCCCCCCCCCCCCCEEEEEECCCCCCCHHHHHH Q ss_conf 7189999999609999999999999999378710001223554----444322222224311577743775543357877 Q gi|254780144|r 2 SNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPV----AAEAGSAASEKTEFEVVLKGFDDPKKKIAVIKE 77 (126) Q Consensus 2 aki~~ive~i~~LTllE~~eLv~~leekfgv~~~~~~~~~~~~----~~~~~~~~~EKt~fdV~L~~~~~~~~Ki~vIK~ 77 (126) T Consensus 1 ~k~~~ive~i~~LtllE~~eLv~~le~~~gv~~~~~~~~~~~~a~~~~~~~~~~~~Ekt~FdV~L~~~~-~~~KI~vIK~ 79 (127) T cd00387 1 LKVEEIVEALKELTLLEAAELVKALEEKFGVSASAAAAAAAAAAPAAAAAAAAEAEEKTEFDVVLESFG-AAKKIAVIKE 79 (127) T ss_pred CCHHHHHHHHHHCCHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEEEEECC-CCCCCHHHHH T ss_conf 979999999972889999999999999969996532222345567776655432223765689972068-7664013457 Q ss_pred HHHHCCCCHHHHHHHHHHCCHHHHHCCCHHHHHHHHHHHHHCCCEEEE Q ss_conf 677659988999999863797766099989999999999974857993 Q gi|254780144|r 78 VRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVEL 125 (126) Q Consensus 78 vR~it~LgLkEAK~lVe~~P~~ike~v~keeAE~ik~~Le~aGa~Vei 125 (126) T Consensus 80 VR~it~LgLkEAK~lVe~~P~~ike~vsKeeAE~iK~kLe~aGa~Vel 127 (127) T cd00387 80 VREITGLGLKEAKDLVESAPKVLKEGVSKEEAEEIKKKLEEAGAKVEL 127 (127) T ss_pred HHHHCCCCHHHHHHHHHCCCHHHHCCCCHHHHHHHHHHHHHCCCEEEC T ss_conf 797738987999999870888887189999999999999983898869

HHsearch alignment for GI: 254780144 and conserved domain: cd00387