BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780144|ref|YP_003064557.1| 50S ribosomal protein L12P [Candidatus Liberibacter asiaticus str. psy62] (126 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780144|ref|YP_003064557.1| 50S ribosomal protein L12P [Candidatus Liberibacter asiaticus str. psy62] Length = 126 Score = 237 bits (605), Expect = 4e-65, Method: Compositional matrix adjust. Identities = 126/126 (100%), Positives = 126/126 (100%) Query: 1 MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60 MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV Sbjct: 1 MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60 Query: 61 VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120 VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG Sbjct: 61 VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120 Query: 121 ATVELR 126 ATVELR Sbjct: 121 ATVELR 126 >gi|254780634|ref|YP_003065047.1| NOL1/NOP2/SUN family signature protein [Candidatus Liberibacter asiaticus str. psy62] Length = 429 Score = 22.7 bits (47), Expect = 2.4, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 17/34 (50%) Query: 83 DLGLKEAKELVESAPKSLKTGLSKDEANEMKKKL 116 D LKEAK L AP L+T K ++ K L Sbjct: 140 DTWLKEAKSLSMRAPLDLRTNTLKVNRCKLFKNL 173 >gi|254781152|ref|YP_003065565.1| hypothetical protein CLIBASIA_05295 [Candidatus Liberibacter asiaticus str. psy62] Length = 155 Score = 22.3 bits (46), Expect = 2.9, Method: Compositional matrix adjust. Identities = 10/27 (37%), Positives = 17/27 (62%) Query: 3 NIESIVEKLSSLTLIEAAELSKRLEKE 29 NI +I+EK + + + E + R+EKE Sbjct: 31 NIRAILEKFNKIFIQEGNIYNVRVEKE 57 >gi|254780233|ref|YP_003064646.1| GTP-binding protein [Candidatus Liberibacter asiaticus str. psy62] Length = 624 Score = 21.9 bits (45), Expect = 4.2, Method: Compositional matrix adjust. Identities = 11/28 (39%), Positives = 16/28 (57%) Query: 88 EAKELVESAPKSLKTGLSKDEANEMKKK 115 + ELVE PKS++ + NE K+K Sbjct: 587 QNDELVEVTPKSIRLRKMYLDPNERKRK 614 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.304 0.122 0.305 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 64,604 Number of Sequences: 1233 Number of extensions: 2035 Number of successful extensions: 11 Number of sequences better than 100.0: 11 Number of HSP's better than 100.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of query: 126 length of database: 328,796 effective HSP length: 64 effective length of query: 62 effective length of database: 249,884 effective search space: 15492808 effective search space used: 15492808 T: 11 A: 40 X1: 16 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.5 bits) S2: 33 (17.3 bits)