HHsearch alignment for GI: 254780145 and conserved domain: COG0244

>COG0244 RplJ Ribosomal protein L10 [Translation, ribosomal structure and biogenesis].
Probab=100.00  E-value=2.5e-36  Score=260.83  Aligned_cols=170  Identities=33%  Similarity=0.549  Sum_probs=165.1

Q ss_pred             CCHHHHHHHHHHHHHHHHHCCEEEEEEECCCCHHHHHHHHHHHHHCCCEEEEECHHHHHHHHHHCCCCCCCCCCCCCEEE
Q ss_conf             97489999999999999508979999827998899999999996569589986157999997313742120015784378
Q gi|254780145|r    1 MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRGISDLFVGQSLI   80 (172)
Q Consensus         1 m~r~~K~~~V~~l~~~l~~s~~~~v~~y~gltv~~~~~lR~~lr~~~~~~~VvKNtL~k~A~~~~~~~~l~~~l~G~~a~   80 (172)
T Consensus         3 ~~~e~K~~~v~el~e~~~~s~~~~i~dy~Gl~~~ql~~lR~~lr~~g~~lkV~KNtL~~rAl~~~~~e~l~~~l~Gp~ai   82 (175)
T COG0244           3 LAREWKKELVAELKELIKESPSVVIVDYRGLTVAQLTELRKKLREAGAKLKVVKNTLLRRALEEAGLEGLDDLLKGPTAI   82 (175)
T ss_pred             CCHHHHHHHHHHHHHHHHHCCEEEEEEECCCCHHHHHHHHHHHHHCCEEEEEEHHHHHHHHHHHCCHHHHHHHCCCCEEE
T ss_conf             40777899999999999629879999836972899999999998579189997538999999864715678756487699


Q ss_pred             EEE-CCCCHHHHHHHHHHHHC-CHHHHHHHHCCCCCCCHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             762-23421578878886410-0012232102411079899999846999899999999999989999999997768799
Q gi|254780145|r   81 VYS-DSPVIAPKISVSFSNDN-NEFRVLGGVVEKGVLNQDSIKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQV  158 (172)
Q Consensus        81 ~f~-~d~~~~aK~~~~f~k~~-~~l~i~gg~~eg~~l~~~~i~~lakLPs~~el~a~lv~~l~~p~~~l~~~L~~~~~~l  158 (172)
T Consensus        83 ~fs~~dp~~~~K~~~~f~k~~~~~~~~~~~~~eg~~l~~~~v~~~aklp~~~el~~~l~g~~~ap~~~~~~~L~a~~~~~  162 (175)
T COG0244          83 AFSNEDPVAAAKLLKDFAKEAGDKAPIKGGVPEGKVLGAAEVIALAKLPSKEELVVMLLGVLQAPATKLLRALKAVPDKV  162 (175)
T ss_pred             EEECCCHHHHHHHHHHHHHHCCCCCEEEEEEECCCCCCHHHHHHHCCCCCHHHHHHHHHCCHHHHHHHHHHHHCCCHHHH
T ss_conf             99578879999999998654154014889983586168889876505684888999985221524789999970446776


Q ss_pred             HHHHHHHHHHHH
Q ss_conf             999999999762
Q gi|254780145|r  159 VRAISAFVDKNQ  170 (172)
Q Consensus       159 ~~~L~~~~~k~e  170 (172)
T Consensus       163 ~~~~~a~~~~g~  174 (175)
T COG0244         163 GLKLLAAYEKGV  174 (175)
T ss_pred             HHHHHHHHCCCC
T ss_conf             446665303578