>cd00379 Ribosomal_L10_P0 Ribosomal protein L10 family; composed of the large subunit ribosomal protein called L10 in bacteria, P0 in eukaryotes, and L10e in archaea, as well as uncharacterized P0-like eukaryotic proteins. In all three kingdoms, L10 forms a tight complex with multiple copies of the small acidic protein L12(e). This complex forms a stalk structure on the large subunit of the ribosome. The N-terminal domain (NTD) of L10 interacts with L11 protein and forms the base of the L7/L12 stalk, while the extended C-terminal helix binds to two or three dimers of the NTD of L7/L12 (L7 and L12 are identical except for an acetylated N-terminus). The L7/L12 stalk is known to contain the binding site for elongation factors G and Tu (EF-G and EF-Tu, respectively); however, there is disagreement as to whether or not L10 is involved in forming the binding site. The stalk is believed to be associated with GTPase activities in protein synthesis. In a neuroblastoma cell line, L10 has been sho

Probab=100.00 E-value=1.4e-35 Score=255.89 Aligned_cols=153 Identities=31% Similarity=0.550 Sum_probs=148.2 Q ss_pred HHHHHHHHHHHHHHHHCCEEEEEEECCCCHHHHHHHHHHHHHCCCEEEEECHHHHHHHHHHCCCCCCCCCCCCCEEEEEE Q ss_conf 89999999999999508979999827998899999999996569589986157999997313742120015784378762 Q gi|254780145|r 4 QGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRGISDLFVGQSLIVYS 83 (172) Q Consensus 4 ~~K~~~V~~l~~~l~~s~~~~v~~y~gltv~~~~~lR~~lr~~~~~~~VvKNtL~k~A~~~~~~~~l~~~l~G~~a~~f~ 83 (172) T Consensus 1 e~K~~~v~~l~~~~~~~~~v~v~~~~gl~~~~~~~lR~~l~~~~~~~~V~KNtL~k~Al~~~~~~~l~~~l~G~~a~~f~ 80 (155) T cd00379 1 EKKEELVEELKELLKKYKSVVVVDYRGLTVAQLTELRKELRESGAKLKVGKNTLMRRALKGTGFEELKPLLKGPTALAFT 80 (155) T ss_pred CCHHHHHHHHHHHHHHCCEEEEEECCCCCHHHHHHHHHHHHHCCCEEEEEECHHHHHHHHHCCCCCCCCCCCCCEEEEEE T ss_conf 94489999999999869989999779997899999999988579179998558899998605865443225477589982 Q ss_pred C-CCCHHHHHHHHHHHHCCHHHHHHHHCCCCCCCHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 2-342157887888641000122321024110798999998469998999999999999899999999977687 Q gi|254780145|r 84 D-SPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQT 156 (172) Q Consensus 84 ~-d~~~~aK~~~~f~k~~~~l~i~gg~~eg~~l~~~~i~~lakLPs~~el~a~lv~~l~~p~~~l~~~L~~~~~ 156 (172) T Consensus 81 ~~d~~~~aK~~~~f~k~~~~~~~k~G~~~~~~~~~~~~~~la~lPs~~~l~~~~v~~l~~p~~~l~~~L~~~~~ 154 (155) T cd00379 81 NEDPVEVAKVLKDFAKENKKLFAKGGVVAGKVLDPAGVTALAKLPSREELLAMLIGLLKAPIAKLARLLNALGI 154 (155) T ss_pred CCCCHHHHHHHHHHHHHCCCCEEEEEEECCEEECHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCC T ss_conf 78825899999999975678215788776845279999999849999999999999998899999999716899

HHsearch alignment for GI: 254780145 and conserved domain: cd00379