>cd05796 Ribosomal_P0_like Ribosomal protein L10 family, P0-like protein subfamily; composed of uncharacterized eukaryotic proteins with similarity to the 60S ribosomal protein P0, including the Saccharomyces cerevisiae protein called mRNA turnover protein 4 (MRT4). MRT4 may be involved in mRNA decay. P0 forms a tight complex with multiple copies of the small acidic protein L12(e). This complex forms a stalk structure on the large subunit of the ribosome. It occupies the L7/L12 stalk of the ribosome. The stalk is known to contain the binding site for elongation factors EF-G and EF-Tu; however, there is disagreement as to whether or not P0 is involved in forming the binding site. The stalk is believed to be associated with GTPase activities in protein synthesis. In a neuroblastoma cell line, P0 has been shown to interact with the SH3 domain of Src and to activate the binding of the Nck1 adaptor protein with skeletal proteins such as the Wiskott-Aldrich Syndrome Protein (WASP) and the WAS

Probab=99.19 E-value=1.5e-10 Score=90.35 Aligned_cols=83 Identities=17% Similarity=0.322 Sum_probs=73.9 Q ss_pred HHHHHHHHHHHHHHHHCCEEEEEEECCCCHHHHHHHHHHHHHCCCEEEEECHHHHHHHHHHC-------CCCCCCCCCCC Q ss_conf 89999999999999508979999827998899999999996569589986157999997313-------74212001578 Q gi|254780145|r 4 QGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDT-------SIRGISDLFVG 76 (172) Q Consensus 4 ~~K~~~V~~l~~~l~~s~~~~v~~y~gltv~~~~~lR~~lr~~~~~~~VvKNtL~k~A~~~~-------~~~~l~~~l~G 76 (172) T Consensus 1 E~K~~~v~~l~e~l~~y~~v~iv~~~nv~s~qlq~iR~~lr~--~~i~~gKnkl~~~AL~~~~~~e~~~~l~~l~~~l~G 78 (163) T cd05796 1 ELKQKLVENIREAVDKYKYIYVFSVDNMRNNKLKDIRQEWKD--SRFFFGKNKVMQVALGRTPEDEYKPNLHKLSKYLKG 78 (163) T ss_pred CCHHHHHHHHHHHHHHCCEEEEEEECCCCCHHHHHHHHHHCC--CEEEEEHHHHHHHHHHHCHHHHCCCCHHHHHHHHCC T ss_conf 937999999999997699899999458866999999998167--819984579999997216443125569999998559 Q ss_pred CEEEEEECCCCH Q ss_conf 437876223421 Q gi|254780145|r 77 QSLIVYSDSPVI 88 (172) Q Consensus 77 ~~a~~f~~d~~~ 88 (172) T Consensus 79 ~~gliFTn~~~~ 90 (163) T cd05796 79 QVGLLFTNEPPE 90 (163) T ss_pred CEEEEEECCCHH T ss_conf 868999789999

HHsearch alignment for GI: 254780145 and conserved domain: cd05796