BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780145|ref|YP_003064558.1| 50S ribosomal protein L10
[Candidatus Liberibacter asiaticus str. psy62]
         (172 letters)

Database: nr 
           13,984,884 sequences; 4,792,584,752 total letters

Searching..................................................done


Results from round 1


>gi|254780145|ref|YP_003064558.1| 50S ribosomal protein L10 [Candidatus Liberibacter asiaticus str.
           psy62]
 gi|548737|sp|P36249|RL10_LIBAS RecName: Full=50S ribosomal protein L10
 gi|551768|gb|AAA23107.1| ribosomal protein L10 [Candidatus Liberibacter asiaticus]
 gi|157704382|gb|ABV68881.1| 50S ribosomal subunit protein L10 [Candidatus Liberibacter
           asiaticus]
 gi|254039822|gb|ACT56618.1| 50S ribosomal protein L10 [Candidatus Liberibacter asiaticus str.
           psy62]
          Length = 172

 Score =  337 bits (863), Expect = 5e-91,   Method: Compositional matrix adjust.
 Identities = 172/172 (100%), Positives = 172/172 (100%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI
Sbjct: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI
Sbjct: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQQG 172
           KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQQG
Sbjct: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQQG 172


>gi|739025|prf||2002224D ribosomal protein L10
          Length = 172

 Score =  335 bits (859), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 171/172 (99%), Positives = 172/172 (100%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           +NRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI
Sbjct: 1   LNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI
Sbjct: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQQG 172
           KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQQG
Sbjct: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQQG 172


>gi|113473651|gb|ABI35994.1| ribosomal protein L10 [Candidatus Liberibacter asiaticus]
          Length = 171

 Score =  334 bits (856), Expect = 3e-90,   Method: Compositional matrix adjust.
 Identities = 171/171 (100%), Positives = 171/171 (100%)

Query: 2   NRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIA 61
           NRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIA
Sbjct: 1   NRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIA 60

Query: 62  IRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSIK 121
           IRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSIK
Sbjct: 61  IRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSIK 120

Query: 122 QIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQQG 172
           QIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQQG
Sbjct: 121 QIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQQG 171


>gi|30351057|gb|AAP22421.1| ribosomal protein [Candidatus Liberibacter asiaticus]
 gi|73698033|gb|AAZ81562.1| ribosomal protein [Candidatus Liberibacter asiaticus]
 gi|73698035|gb|AAZ81563.1| ribosomal protein [Candidatus Liberibacter asiaticus]
 gi|83317197|gb|ABC02761.1| RplJ protein [Candidatus Liberibacter asiaticus]
 gi|211731634|gb|ACJ10071.1| 50S ribosomal subunit protein L10 [Candidatus Liberibacter
           asiaticus]
 gi|221048092|gb|ACL98153.1| ribosomal protein [Candidatus Liberibacter asiaticus]
 gi|260534039|gb|ACX45244.1| 50S ribosomal subunit protein L10 [Candidatus Liberibacter
           asiaticus]
 gi|260534042|gb|ACX45246.1| 50S ribosomal subunit protein L10 [Candidatus Liberibacter
           asiaticus]
 gi|262092704|gb|ACY25748.1| ribosomal protein [Candidatus Liberibacter asiaticus]
 gi|324983849|gb|ADY68765.1| ribosomal protein L10 [Candidatus Liberibacter asiaticus]
          Length = 166

 Score =  324 bits (830), Expect = 3e-87,   Method: Compositional matrix adjust.
 Identities = 166/166 (100%), Positives = 166/166 (100%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI
Sbjct: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI
Sbjct: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFV 166
           KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFV
Sbjct: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFV 166


>gi|73698037|gb|AAZ81564.1| ribosomal protein [Candidatus Liberibacter asiaticus]
          Length = 166

 Score =  322 bits (825), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 165/166 (99%), Positives = 165/166 (99%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI
Sbjct: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           AIRDTSIRGISDLFVGQSL VYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI
Sbjct: 61  AIRDTSIRGISDLFVGQSLTVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFV 166
           KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFV
Sbjct: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFV 166


>gi|206601310|gb|ACI16379.1| ribosomal protein [Candidatus Liberibacter asiaticus]
          Length = 166

 Score =  321 bits (822), Expect = 3e-86,   Method: Compositional matrix adjust.
 Identities = 165/166 (99%), Positives = 165/166 (99%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI
Sbjct: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQ SI
Sbjct: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQGSI 120

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFV 166
           KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFV
Sbjct: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFV 166


>gi|262093732|gb|ACY26056.1| ribosomal protein L10 [Candidatus Liberibacter asiaticus]
 gi|270057056|gb|ACZ59651.1| ribosomal protein L10 [Candidatus Liberibacter asiaticus]
 gi|270057058|gb|ACZ59652.1| ribosomal protein L10 [Candidatus Liberibacter asiaticus]
 gi|296785994|gb|ADH43579.1| ribosomal protein L10 [Candidatus Liberibacter asiaticus]
 gi|304269460|gb|ADM16671.1| ribosomal protein L10 [Candidatus Liberibacter asiaticus]
          Length = 164

 Score =  319 bits (818), Expect = 7e-86,   Method: Compositional matrix adjust.
 Identities = 164/164 (100%), Positives = 164/164 (100%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI
Sbjct: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI
Sbjct: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISA 164
           KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISA
Sbjct: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISA 164


>gi|162956935|gb|ABY25857.1| ribosomal protein L10 [Candidatus Liberibacter asiaticus]
          Length = 161

 Score =  315 bits (807), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 161/161 (100%), Positives = 161/161 (100%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI
Sbjct: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI
Sbjct: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRA 161
           KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRA
Sbjct: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRA 161


>gi|308523800|gb|ADO33740.1| 50S ribosomal subunit protein L10 [Candidatus Liberibacter
           asiaticus]
          Length = 150

 Score =  292 bits (747), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 150/150 (100%), Positives = 150/150 (100%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI
Sbjct: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI
Sbjct: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRL 150
           KQIASLPDLEGIRAGIISAIQSNATRLVRL
Sbjct: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRL 150


>gi|730520|sp|P41191|RL10_LIBAF RecName: Full=50S ribosomal protein L10
 gi|507767|gb|AAA19555.1| ribosomal protein L10 [Candidatus Liberibacter africanus]
          Length = 172

 Score =  278 bits (710), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 137/171 (80%), Positives = 159/171 (92%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           MNRQ KSVEISELSKIFSSSGS+VVAHYKGISVAQIKDLRKK+REAGGGVKVAKNRLVKI
Sbjct: 1   MNRQEKSVEISELSKIFSSSGSVVVAHYKGISVAQIKDLRKKVREAGGGVKVAKNRLVKI 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A+ DTS++G+SDLFVGQSLIVYS  P++APKISVSF+NDN +F VLGG++EK +L+QDSI
Sbjct: 61  AVSDTSLKGVSDLFVGQSLIVYSVDPIVAPKISVSFANDNKQFVVLGGILEKDILDQDSI 120

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQQ 171
           K+IASLP+++GIR+ IISAIQ N+TRLV LL  PQT++VRAISAFVDKNQQ
Sbjct: 121 KRIASLPNIDGIRSMIISAIQFNSTRLVNLLNAPQTKIVRAISAFVDKNQQ 171


>gi|264668448|gb|ACY71597.1| 50S ribosomal subunit protein L10 [Candidatus Liberibacter
           africanus]
 gi|264668451|gb|ACY71599.1| 50S ribosomal subunit protein L10 [Candidatus Liberibacter
           africanus]
 gi|264668454|gb|ACY71601.1| 50S ribosomal subunit protein L10 [Candidatus Liberibacter
           africanus]
 gi|264668463|gb|ACY71607.1| 50S ribosomal subunit protein L10 [Candidatus Liberibacter
           africanus]
 gi|264668466|gb|ACY71609.1| 50S ribosomal subunit protein L10 [Candidatus Liberibacter
           africanus]
 gi|264668469|gb|ACY71611.1| 50S ribosomal subunit protein L10 [Candidatus Liberibacter
           africanus]
 gi|264668472|gb|ACY71613.1| 50S ribosomal subunit protein L10 [Candidatus Liberibacter
           africanus]
 gi|264668475|gb|ACY71615.1| 50S ribosomal subunit protein L10 [Candidatus Liberibacter
           africanus]
 gi|264668481|gb|ACY71619.1| 50S ribosomal subunit protein L10 [Candidatus Liberibacter
           africanus]
          Length = 165

 Score =  265 bits (678), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 131/165 (79%), Positives = 153/165 (92%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           MNRQ KSVEISELSKIFSSSGS+VVAHYKGISVAQIKDLRKK+REAGGGVKVAKNRLVKI
Sbjct: 1   MNRQEKSVEISELSKIFSSSGSVVVAHYKGISVAQIKDLRKKVREAGGGVKVAKNRLVKI 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A+ DTS++G+SDLFVGQSLIVYS  P++APKISVSF+NDN +F VLGG++EK +L+QDSI
Sbjct: 61  AVSDTSLKGVSDLFVGQSLIVYSVDPIVAPKISVSFANDNKQFVVLGGILEKDILDQDSI 120

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAF 165
           K+IASLP+++GIR+ IISAIQ N+TRLV LL  PQT++VRAISAF
Sbjct: 121 KRIASLPNIDGIRSMIISAIQFNSTRLVNLLNAPQTKIVRAISAF 165


>gi|264668457|gb|ACY71603.1| 50S ribosomal subunit protein L10 [Candidatus Liberibacter
           africanus]
 gi|264668460|gb|ACY71605.1| 50S ribosomal subunit protein L10 [Candidatus Liberibacter
           africanus]
 gi|264668478|gb|ACY71617.1| 50S ribosomal subunit protein L10 [Candidatus Liberibacter
           africanus]
          Length = 165

 Score =  264 bits (675), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 130/165 (78%), Positives = 152/165 (92%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           MNRQ KSVEISELSKIFSSSGS+VVAHYKGISVAQIKDLRKK+REAGGGVKVAKNRLVKI
Sbjct: 1   MNRQEKSVEISELSKIFSSSGSVVVAHYKGISVAQIKDLRKKVREAGGGVKVAKNRLVKI 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A+ DTS++G+SDLFVGQSLIVYS  P++APKISVSF+NDN +F VLGG++EK +L+QDSI
Sbjct: 61  AVSDTSLKGVSDLFVGQSLIVYSVDPIVAPKISVSFANDNKQFVVLGGILEKDILDQDSI 120

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAF 165
           K+IASLP+++GIR+ IISAIQ N+TRLV LL  PQT++VRAIS F
Sbjct: 121 KRIASLPNIDGIRSMIISAIQFNSTRLVNLLNAPQTKIVRAISCF 165


>gi|264668484|gb|ACY71621.1| 50S ribosomal subunit protein L10 [Candidatus Liberibacter
           africanus]
          Length = 165

 Score =  263 bits (672), Expect = 7e-69,   Method: Compositional matrix adjust.
 Identities = 130/165 (78%), Positives = 152/165 (92%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           MNRQ KSVEISELSKIFSSSGS+VVAHYKGISVAQIKDLRKK+REAGGGVKVAKNRLVKI
Sbjct: 1   MNRQEKSVEISELSKIFSSSGSVVVAHYKGISVAQIKDLRKKVREAGGGVKVAKNRLVKI 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A+ DTS++G+SDLFVGQSLIVYS  P++APKISVSF+NDN +F VLGG++EK +L+QDSI
Sbjct: 61  AVSDTSLKGVSDLFVGQSLIVYSVDPIVAPKISVSFANDNKQFVVLGGILEKDILDQDSI 120

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAF 165
           K+IASLP+++GIR+ IISAIQ N+TRLV LL  PQT++VRAISA 
Sbjct: 121 KRIASLPNIDGIRSMIISAIQFNSTRLVNLLNAPQTKIVRAISAL 165


>gi|38195606|gb|AAR13469.1| 50S ribosomal subunit protein L10 [Candidatus Liberibacter
           asiaticus]
 gi|94548939|gb|ABF38966.1| 50S ribosomal subunit protein L10 [Candidatus Liberibacter
           asiaticus]
 gi|255957550|dbj|BAH96613.1| 50S ribosomal subunit protein L10 [Candidatus Liberibacter
           asiaticus]
 gi|255957846|dbj|BAH96820.1| 50S ribosomal subunit protein L10 [Candidatus Liberibacter
           asiaticus]
 gi|255957856|dbj|BAH96829.1| 50S ribosomal subunit protein L10 [Candidatus Liberibacter
           asiaticus]
 gi|255957866|dbj|BAH96838.1| 50S ribosomal subunit protein L10 [Candidatus Liberibacter
           asiaticus]
 gi|255957876|dbj|BAH96847.1| 50S ribosomal subunit protein L10 [Candidatus Liberibacter
           asiaticus]
 gi|255957886|dbj|BAH96856.1| 50S ribosomal subunit protein L10 [Candidatus Liberibacter
           asiaticus]
 gi|255957896|dbj|BAH96865.1| 50S ribosomal subunit protein L10 [Candidatus Liberibacter
           asiaticus]
 gi|255957906|dbj|BAH96874.1| 50S ribosomal subunit protein L10 [Candidatus Liberibacter
           asiaticus]
 gi|255957916|dbj|BAH96883.1| 50S ribosomal subunit protein L10 [Candidatus Liberibacter
           asiaticus]
 gi|255957926|dbj|BAH96892.1| 50S ribosomal subunit protein L10 [Candidatus Liberibacter
           asiaticus]
 gi|255957936|dbj|BAH96901.1| 50S ribosomal subunit protein L10 [Candidatus Liberibacter
           asiaticus]
 gi|255957946|dbj|BAH96910.1| 50S ribosomal subunit protein L10 [Candidatus Liberibacter
           asiaticus]
 gi|255957956|dbj|BAH96919.1| 50S ribosomal subunit protein L10 [Candidatus Liberibacter
           asiaticus]
 gi|255957966|dbj|BAH96928.1| 50S ribosomal subunit protein L10 [Candidatus Liberibacter
           asiaticus]
 gi|255957976|dbj|BAH96937.1| 50S ribosomal subunit protein L10 [Candidatus Liberibacter
           asiaticus]
 gi|255957986|dbj|BAH96946.1| 50S ribosomal subunit protein L10 [Candidatus Liberibacter
           asiaticus]
 gi|255957996|dbj|BAH96955.1| 50S ribosomal subunit protein L10 [Candidatus Liberibacter
           asiaticus]
 gi|255958006|dbj|BAH96964.1| 50S ribosomal subunit protein L10 [Candidatus Liberibacter
           asiaticus]
 gi|255958016|dbj|BAH96973.1| 50S ribosomal subunit protein L10 [Candidatus Liberibacter
           asiaticus]
 gi|255958026|dbj|BAH96982.1| 50S ribosomal subunit protein L10 [Candidatus Liberibacter
           asiaticus]
 gi|255958036|dbj|BAH96991.1| 50S ribosomal subunit protein L10 [Candidatus Liberibacter
           asiaticus]
 gi|255958046|dbj|BAH97000.1| 50S ribosomal subunit protein L10 [Candidatus Liberibacter
           asiaticus]
 gi|255958056|dbj|BAH97009.1| 50S ribosomal subunit protein L10 [Candidatus Liberibacter
           asiaticus]
 gi|255958066|dbj|BAH97018.1| 50S ribosomal subunit protein L10 [Candidatus Liberibacter
           asiaticus]
 gi|255958076|dbj|BAH97027.1| 50S ribosomal subunit protein L10 [Candidatus Liberibacter
           asiaticus]
 gi|255958086|dbj|BAH97036.1| 50S ribosomal subunit protein L10 [Candidatus Liberibacter
           asiaticus]
 gi|255958096|dbj|BAH97045.1| 50S ribosomal subunit protein L10 [Candidatus Liberibacter
           asiaticus]
 gi|255958106|dbj|BAH97054.1| 50S ribosomal subunit protein L10 [Candidatus Liberibacter
           asiaticus]
 gi|255958116|dbj|BAH97063.1| 50S ribosomal subunit protein L10 [Candidatus Liberibacter
           asiaticus]
 gi|255958126|dbj|BAH97072.1| 50S ribosomal subunit protein L10 [Candidatus Liberibacter
           asiaticus]
 gi|283362136|dbj|BAI65923.1| 50S ribosomal protein L10 [Candidatus Liberibacter asiaticus]
 gi|283362146|dbj|BAI65932.1| 50S ribosomal protein L10 [Candidatus Liberibacter asiaticus]
 gi|283362156|dbj|BAI65941.1| 50S ribosomal protein L10 [Candidatus Liberibacter asiaticus]
 gi|283362166|dbj|BAI65950.1| 50S ribosomal protein L10 [Candidatus Liberibacter asiaticus]
 gi|283362176|dbj|BAI65959.1| 50S ribosomal protein L10 [Candidatus Liberibacter asiaticus]
 gi|283362186|dbj|BAI65968.1| 50S ribosomal protein L10 [Candidatus Liberibacter asiaticus]
 gi|283362196|dbj|BAI65977.1| 50S ribosomal protein L10 [Candidatus Liberibacter asiaticus]
 gi|283362206|dbj|BAI65986.1| 50S ribosomal protein L10 [Candidatus Liberibacter asiaticus]
 gi|283362216|dbj|BAI65995.1| 50S ribosomal protein L10 [Candidatus Liberibacter asiaticus]
 gi|283362226|dbj|BAI66004.1| 50S ribosomal protein L10 [Candidatus Liberibacter asiaticus]
 gi|283362236|dbj|BAI66013.1| 50S ribosomal protein L10 [Candidatus Liberibacter asiaticus]
          Length = 130

 Score =  256 bits (654), Expect = 8e-67,   Method: Compositional matrix adjust.
 Identities = 130/130 (100%), Positives = 130/130 (100%)

Query: 43  MREAGGGVKVAKNRLVKIAIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNE 102
           MREAGGGVKVAKNRLVKIAIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNE
Sbjct: 1   MREAGGGVKVAKNRLVKIAIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNE 60

Query: 103 FRVLGGVVEKGVLNQDSIKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAI 162
           FRVLGGVVEKGVLNQDSIKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAI
Sbjct: 61  FRVLGGVVEKGVLNQDSIKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAI 120

Query: 163 SAFVDKNQQG 172
           SAFVDKNQQG
Sbjct: 121 SAFVDKNQQG 130


>gi|13959490|sp|Q9L5W5|RL10_LIBAC RecName: Full=50S ribosomal protein L10
 gi|7716606|gb|AAF68452.1| RplJ [Candidatus Liberibacter africanus subsp. capensis]
          Length = 172

 Score =  254 bits (649), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 128/171 (74%), Positives = 150/171 (87%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           MNRQ KSVEISELSKI SSSGS+VVAHYKGISVAQI+  ++  REAGGGVKV  NRLVKI
Sbjct: 1   MNRQEKSVEISELSKILSSSGSVVVAHYKGISVAQIRTSKEGXREAGGGVKVXXNRLVKI 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A+RDTS++ +SDLFVGQSLIVYS  P++APKISV+F+NDN +F VLGGV+E  VL+Q SI
Sbjct: 61  AVRDTSVKEVSDLFVGQSLIVYSVDPIVAPKISVNFANDNKQFVVLGGVLENDVLDQCSI 120

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQQ 171
           KQIASLP+++GIRA IISAIQ NAT+L+RLL  PQ QVVRA+SAFVDKN+Q
Sbjct: 121 KQIASLPNIDGIRAIIISAIQFNATKLLRLLSAPQAQVVRALSAFVDKNKQ 171


>gi|194293714|gb|ACF39952.1| 50S ribosomal subunit protein L10 [Candidatus Liberibacter
           solanacearum]
          Length = 173

 Score =  228 bits (580), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 119/172 (69%), Positives = 146/172 (84%), Gaps = 1/172 (0%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           MN Q KSVEISELS IFSSS SIVVA YKG++VAQ+KDLR ++REAGGGV++AKN LVK+
Sbjct: 1   MNNQEKSVEISELSDIFSSSSSIVVADYKGLNVAQMKDLRDRLREAGGGVRIAKNTLVKV 60

Query: 61  AIRDTS-IRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
           AIRD   +   +DLFVGQSLIVYS  PVIA KISV F+NDN++F +LGG++EK +L QDS
Sbjct: 61  AIRDLGFVVDFADLFVGQSLIVYSVDPVIASKISVGFANDNSQFEILGGILEKDMLTQDS 120

Query: 120 IKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQQ 171
           IK+IASLP++E IR+GI+SAIQS+ATRLV LL TPQ Q+VR +SAF +KN+Q
Sbjct: 121 IKKIASLPNIEEIRSGILSAIQSSATRLVMLLETPQNQIVRVLSAFEEKNRQ 172


>gi|315122747|ref|YP_004063236.1| 50S ribosomal protein L10 [Candidatus Liberibacter solanacearum
           CLso-ZC1]
 gi|313496149|gb|ADR52748.1| 50S ribosomal protein L10 [Candidatus Liberibacter solanacearum
           CLso-ZC1]
          Length = 173

 Score =  227 bits (578), Expect = 5e-58,   Method: Compositional matrix adjust.
 Identities = 119/172 (69%), Positives = 144/172 (83%), Gaps = 1/172 (0%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           MN Q KSVEISELS IFSSS SIVVA YKG++VAQ+KDLR ++REAGGGV++AKN LVKI
Sbjct: 1   MNNQEKSVEISELSDIFSSSSSIVVADYKGLNVAQMKDLRARLREAGGGVRIAKNTLVKI 60

Query: 61  AIRDTS-IRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
           AIRD   +   +DLFVGQSLIVYS  PVIA KISV F+NDN++F +LGG++EK +L QDS
Sbjct: 61  AIRDLGFVVDFADLFVGQSLIVYSVDPVIASKISVGFANDNSQFEILGGILEKDMLTQDS 120

Query: 120 IKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQQ 171
           IK+IASLP++E IR+GI+SAIQS ATRLV LL TPQ  +VR +SAF +KN+Q
Sbjct: 121 IKKIASLPNIEEIRSGILSAIQSTATRLVMLLETPQNHIVRVLSAFEEKNRQ 172


>gi|133872298|gb|ABO40218.1| 50S ribosomal subunit protein L10 [Candidatus Liberibacter
           americanus]
          Length = 172

 Score =  204 bits (518), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 96/171 (56%), Positives = 132/171 (77%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M RQ K +E++EL KIFSS  S+VVAHYKGI+VAQI  LRKKM+EAGG  KV KNRLVK+
Sbjct: 1   MKRQEKILEVAELGKIFSSYNSVVVAHYKGINVAQIGSLRKKMKEAGGFAKVVKNRLVKV 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           AI+DT  +G+SD F GQSLIV S  PV AP+ISV F+ +N++F+++GG+++KG+L+ D+I
Sbjct: 61  AIKDTDFQGMSDFFSGQSLIVCSKDPVAAPQISVDFAKENDQFKIIGGILDKGILDNDAI 120

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQQ 171
           K+IASLP ++ +RA I+  IQ N+ RL+R L  P  +    ISA +++N+Q
Sbjct: 121 KEIASLPSIDVLRARILGCIQHNSVRLLRTLNAPHARFFHIISACMEENKQ 171


>gi|289546831|gb|ADD10124.1| 50S ribosomal subunit protein L10 [Candidatus Liberibacter
           solanacearum]
          Length = 138

 Score =  183 bits (464), Expect = 8e-45,   Method: Compositional matrix adjust.
 Identities = 91/137 (66%), Positives = 114/137 (83%), Gaps = 1/137 (0%)

Query: 36  IKDLRKKMREAGGGVKVAKNRLVKIAIRDTS-IRGISDLFVGQSLIVYSDSPVIAPKISV 94
           +KDLR ++REAGGGV++AKN LVKIAIRD   +   +DLFVGQSLIVYS  PVIA KISV
Sbjct: 1   MKDLRARLREAGGGVRIAKNTLVKIAIRDLGFVVDFADLFVGQSLIVYSVDPVIASKISV 60

Query: 95  SFSNDNNEFRVLGGVVEKGVLNQDSIKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTP 154
            F+NDN++F +LGG++EK +L QDSIK+IASLP++E IR+GI+SAIQS ATRLV LL TP
Sbjct: 61  GFANDNSQFEILGGILEKDMLTQDSIKKIASLPNIEEIRSGILSAIQSTATRLVMLLETP 120

Query: 155 QTQVVRAISAFVDKNQQ 171
           Q  +VR +SAF +KN+Q
Sbjct: 121 QNHIVRVLSAFEEKNRQ 137


>gi|222085666|ref|YP_002544196.1| 50S ribosomal protein L10 [Agrobacterium radiobacter K84]
 gi|254798352|sp|B9JDR9|RL10_AGRRK RecName: Full=50S ribosomal protein L10
 gi|221723114|gb|ACM26270.1| 50S ribosomal protein L10 [Agrobacterium radiobacter K84]
          Length = 172

 Score =  173 bits (438), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 81/170 (47%), Positives = 116/170 (68%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M R  K   ++EL+++F +SGS+VVAHY G +VAQ+ D R KMR AGG VKVAKNRL KI
Sbjct: 1   MERAEKREFVTELNEVFKASGSVVVAHYAGATVAQMNDFRSKMRAAGGTVKVAKNRLAKI 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A++ T   GIS+LF GQ+LI YS  P+ APK+ V F+  N++  VLGG +    LN D +
Sbjct: 61  ALQGTDAEGISNLFTGQTLIAYSTDPITAPKVVVDFAKGNDKIVVLGGAMGTTTLNADGV 120

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQ 170
           K +A+LP L+ +RA ++  IQ+ ATR+  ++  P +Q+ R  SA+  K++
Sbjct: 121 KSLATLPSLDELRAKLLGMIQTPATRIAGVVAAPASQLARVFSAYAKKDE 170


>gi|209548925|ref|YP_002280842.1| 50S ribosomal protein L10 [Rhizobium leguminosarum bv. trifolii
           WSM2304]
 gi|226699992|sp|B5ZYS5|RL10_RHILW RecName: Full=50S ribosomal protein L10
 gi|209534681|gb|ACI54616.1| ribosomal protein L10 [Rhizobium leguminosarum bv. trifolii
           WSM2304]
          Length = 172

 Score =  172 bits (437), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 79/170 (46%), Positives = 117/170 (68%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M R  K   ++EL+++F +SGS+VVAHY G +VAQ+ D R KMR AGG VKVAKNRL KI
Sbjct: 1   MERAEKREFVTELNEVFKASGSVVVAHYAGATVAQMNDFRSKMRAAGGTVKVAKNRLAKI 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A++ T   GI+DLF GQ+LI YS  P+ APK+ + F+  N++  VLGG +    LN D++
Sbjct: 61  ALQGTEAEGITDLFKGQTLIAYSTDPITAPKVVMDFAKTNDKIVVLGGAMGTTTLNADAV 120

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQ 170
           K +A+LP L+ +RA ++  IQ+ ATR+  ++  P +Q+ R  +A+  K++
Sbjct: 121 KSLATLPSLDELRAKLLGMIQTPATRIAGVVAAPASQLARVFAAYAKKDE 170


>gi|153009275|ref|YP_001370490.1| 50S ribosomal protein L10 [Ochrobactrum anthropi ATCC 49188]
 gi|166230041|sp|A6X0A7|RL10_OCHA4 RecName: Full=50S ribosomal protein L10
 gi|151561163|gb|ABS14661.1| ribosomal protein L10 [Ochrobactrum anthropi ATCC 49188]
          Length = 172

 Score =  171 bits (434), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 82/170 (48%), Positives = 114/170 (67%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M+R  K   +S L+  F  SGS+VVAHY G++VAQ+ DLR KMR+AGG VKVAKNRL KI
Sbjct: 1   MDRAEKREFVSWLNGAFKESGSVVVAHYTGLTVAQMSDLRSKMRDAGGSVKVAKNRLAKI 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A++ T   GISDLF GQ+++ Y++ P+ APK++V F+  N++  +LGG +    LN D +
Sbjct: 61  ALQGTESEGISDLFTGQTVVAYANDPIAAPKVAVEFAKANDKLVILGGAMGATTLNADGV 120

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQ 170
           K +ASLP L+ +RA ++  IQ+ A RL  L   P  Q+ R I A   KN+
Sbjct: 121 KSLASLPSLDELRAKLVGMIQTPAQRLAVLTSAPAGQIARVIGAHARKNE 170


>gi|23502123|ref|NP_698250.1| 50S ribosomal protein L10 [Brucella suis 1330]
 gi|29336739|sp|Q8G067|RL10_BRUSU RecName: Full=50S ribosomal protein L10
 gi|23348084|gb|AAN30165.1| ribosomal protein L10 [Brucella suis 1330]
          Length = 172

 Score =  171 bits (433), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 80/170 (47%), Positives = 115/170 (67%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M+R  K   ++ L+  F  SGS+VVAHY G++VAQ+ DLR KMR+AGG VKVAKNRL KI
Sbjct: 1   MDRAEKREFVAWLNGAFKESGSVVVAHYTGLTVAQMSDLRSKMRDAGGSVKVAKNRLAKI 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A++ T   GI+DLF GQ+++ Y++ P+ APK++V F+  N++  +LGG +    LN D +
Sbjct: 61  ALQGTESEGIADLFTGQTVVAYANDPITAPKVAVEFAKANDKLVILGGAMGATTLNADGV 120

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQ 170
           K +ASLP L+ +RA ++  IQ+ A RL  L   P +Q+ R I A   KN+
Sbjct: 121 KSLASLPSLDELRAKLVGMIQTPAQRLAVLTSAPASQIARVIGAHARKNE 170


>gi|218462358|ref|ZP_03502449.1| 50S ribosomal protein L10 [Rhizobium etli Kim 5]
          Length = 172

 Score =  170 bits (431), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 78/170 (45%), Positives = 117/170 (68%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M R  K   ++EL+++F +SGS+VVAHY G +VAQ+ D R KMR AGG VKVAKNRL KI
Sbjct: 1   MERAEKREFVTELNEVFKASGSVVVAHYAGATVAQMNDFRSKMRAAGGTVKVAKNRLAKI 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A++ T   G+S+LF GQ+LI YS  P+ APK+ + F+  N++  VLGG +    LN D++
Sbjct: 61  ALQGTEAEGMSNLFKGQTLIAYSTDPITAPKVVMDFAKTNDKIVVLGGAMGTTTLNADAV 120

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQ 170
           K +A+LP L+ +RA ++  IQ+ ATR+  ++  P +Q+ R  +A+  K++
Sbjct: 121 KSLATLPSLDELRAKLLGMIQTPATRIAGVVAAPASQLARVFAAYAKKDE 170


>gi|86357295|ref|YP_469187.1| 50S ribosomal protein L10 [Rhizobium etli CFN 42]
 gi|123512273|sp|Q2K9M6|RL10_RHIEC RecName: Full=50S ribosomal protein L10
 gi|86281397|gb|ABC90460.1| 50S ribosomal protein L10 [Rhizobium etli CFN 42]
          Length = 172

 Score =  170 bits (431), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 79/170 (46%), Positives = 117/170 (68%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M R  K   ++EL+++F +SGS+VVAHY G +VAQ+ D R KMR AGG VKVAKNRL KI
Sbjct: 1   MERAEKREFVTELNEVFKASGSVVVAHYAGATVAQMNDFRSKMRAAGGTVKVAKNRLAKI 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A++ T   GIS+LF GQ+LI YS+ P+ APK+ + F+  N++  VLGG +    LN + +
Sbjct: 61  ALQGTEAEGISNLFKGQTLIAYSNDPITAPKVVMDFAKTNDKIVVLGGAMGTTTLNAEGV 120

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQ 170
           K +A+LP L+ +RA ++  IQ+ ATR+  ++  P +Q+ R  SA+  K++
Sbjct: 121 KSLATLPSLDELRAKLLGMIQTPATRIAGVVAAPASQLARVFSAYAKKDE 170


>gi|190891345|ref|YP_001977887.1| 50S ribosomal protein L10 [Rhizobium etli CIAT 652]
 gi|226699991|sp|B3PW57|RL10_RHIE6 RecName: Full=50S ribosomal protein L10
 gi|190696624|gb|ACE90709.1| 50S ribosomal protein L10 [Rhizobium etli CIAT 652]
          Length = 172

 Score =  170 bits (431), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 78/170 (45%), Positives = 119/170 (70%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M R  K   ++EL+++F +SGS+VVAHY G +VAQ+ D R KMR AGG VKVAKNRL KI
Sbjct: 1   MERAEKREFVTELNEVFKASGSVVVAHYAGSTVAQMNDFRSKMRAAGGTVKVAKNRLAKI 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A++ T   G+S+LF GQ+LI YS+ P+ APK+ + F+  N++  VLGG +    LN +++
Sbjct: 61  ALQGTEAEGMSNLFKGQTLIAYSNDPITAPKVVMDFAKTNDKIVVLGGAMGTTTLNAEAV 120

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQ 170
           K +A+LP L+ +RA ++  IQ+ ATR+V ++  P +Q+ R  +A+  K++
Sbjct: 121 KSLATLPSLDELRAKLLGMIQTPATRIVGVVAAPASQLARVFAAYAKKDE 170


>gi|163843510|ref|YP_001627914.1| 50S ribosomal protein L10 [Brucella suis ATCC 23445]
 gi|256061324|ref|ZP_05451472.1| 50S ribosomal protein L10 [Brucella neotomae 5K33]
 gi|261325329|ref|ZP_05964526.1| 50S ribosomal protein L10 [Brucella neotomae 5K33]
 gi|189040907|sp|B0CH43|RL10_BRUSI RecName: Full=50S ribosomal protein L10
 gi|163674233|gb|ABY38344.1| 50S ribosomal protein L10 [Brucella suis ATCC 23445]
 gi|261301309|gb|EEY04806.1| 50S ribosomal protein L10 [Brucella neotomae 5K33]
          Length = 172

 Score =  170 bits (431), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 80/170 (47%), Positives = 114/170 (67%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M+R  K   ++ L+  F  SGS+VVAHY G++VAQ+ DLR KMR+AGG VKVAKNRL KI
Sbjct: 1   MDRAEKREFVAWLNGAFKESGSVVVAHYTGLTVAQMSDLRSKMRDAGGAVKVAKNRLAKI 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A++ T   GI+DLF GQ+++ Y++ P+ APK++V F+  N++  +LGG +    LN D +
Sbjct: 61  ALQGTESEGIADLFTGQTVVAYANDPITAPKVAVEFAKANDKLVILGGAMGATTLNADGV 120

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQ 170
           K +ASLP L+ +RA ++  IQ+ A RL  L   P  Q+ R I A   KN+
Sbjct: 121 KSLASLPSLDELRAKLVGMIQTPAQRLAVLTSAPAGQIARVIGAHARKNE 170


>gi|116251530|ref|YP_767368.1| 50S ribosomal protein L10 [Rhizobium leguminosarum bv. viciae 3841]
 gi|166230060|sp|Q1MIF1|RL10_RHIL3 RecName: Full=50S ribosomal protein L10
 gi|115256178|emb|CAK07259.1| putative 50S ribosomal protein L10 [Rhizobium leguminosarum bv.
           viciae 3841]
          Length = 172

 Score =  170 bits (431), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 78/170 (45%), Positives = 117/170 (68%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M R  K   ++EL+++F +SGS+VVAHY G +VAQ+ D R KMR AGG VKVAKNRL KI
Sbjct: 1   MERAEKREFVTELNEVFKASGSVVVAHYAGATVAQMNDFRSKMRAAGGTVKVAKNRLAKI 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A++ T   G+S+LF GQ+LI YS  P+ APK+ + F+  N++  VLGG +    LN D++
Sbjct: 61  ALQGTEAEGMSNLFKGQTLIAYSTDPITAPKVVMDFAKTNDKIIVLGGAMGTTTLNADAV 120

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQ 170
           K +A+LP L+ +RA ++  IQ+ ATR+  ++  P +Q+ R  +A+  K++
Sbjct: 121 KSLATLPSLDELRAKLLGMIQTPATRIAGVVAAPASQLARVFAAYAKKDE 170


>gi|82700078|ref|YP_414652.1| 50S ribosomal protein L10 [Brucella melitensis biovar Abortus 2308]
 gi|161511152|ref|NP_539664.2| 50S ribosomal protein L10 [Brucella melitensis bv. 1 str. 16M]
 gi|161619201|ref|YP_001593088.1| 50S ribosomal protein L10 [Brucella canis ATCC 23365]
 gi|189024392|ref|YP_001935160.1| 50S ribosomal protein L10 [Brucella abortus S19]
 gi|225852742|ref|YP_002732975.1| 50S ribosomal protein L10 [Brucella melitensis ATCC 23457]
 gi|254689462|ref|ZP_05152716.1| 50S ribosomal protein L10 [Brucella abortus bv. 6 str. 870]
 gi|254697599|ref|ZP_05159427.1| 50S ribosomal protein L10 [Brucella abortus bv. 2 str. 86/8/59]
 gi|254704527|ref|ZP_05166355.1| 50S ribosomal protein L10 [Brucella suis bv. 3 str. 686]
 gi|254719300|ref|ZP_05181111.1| 50S ribosomal protein L10 [Brucella sp. 83/13]
 gi|254730491|ref|ZP_05189069.1| 50S ribosomal protein L10 [Brucella abortus bv. 4 str. 292]
 gi|256044892|ref|ZP_05447796.1| 50S ribosomal protein L10 [Brucella melitensis bv. 1 str. Rev.1]
 gi|256113800|ref|ZP_05454600.1| 50S ribosomal protein L10 [Brucella melitensis bv. 3 str. Ether]
 gi|256263771|ref|ZP_05466303.1| 50S ribosomal protein L10 [Brucella melitensis bv. 2 str. 63/9]
 gi|256369668|ref|YP_003107178.1| 50S ribosomal protein L10 [Brucella microti CCM 4915]
 gi|260546701|ref|ZP_05822440.1| 50S ribosomal protein L10 [Brucella abortus NCTC 8038]
 gi|260565506|ref|ZP_05835990.1| 50S ribosomal protein L10 [Brucella melitensis bv. 1 str. 16M]
 gi|260566229|ref|ZP_05836699.1| 50S ribosomal protein L10 [Brucella suis bv. 4 str. 40]
 gi|260754986|ref|ZP_05867334.1| 50S ribosomal protein L10 [Brucella abortus bv. 6 str. 870]
 gi|260758202|ref|ZP_05870550.1| 50S ribosomal protein L10 [Brucella abortus bv. 4 str. 292]
 gi|260762029|ref|ZP_05874372.1| 50S ribosomal protein L10 [Brucella abortus bv. 2 str. 86/8/59]
 gi|261755211|ref|ZP_05998920.1| 50S ribosomal protein L10 [Brucella suis bv. 3 str. 686]
 gi|265984301|ref|ZP_06097036.1| 50S ribosomal protein L10 [Brucella sp. 83/13]
 gi|265991320|ref|ZP_06103877.1| 50S ribosomal protein L10 [Brucella melitensis bv. 1 str. Rev.1]
 gi|265995157|ref|ZP_06107714.1| 50S ribosomal protein L10 [Brucella melitensis bv. 3 str. Ether]
 gi|294852581|ref|ZP_06793254.1| large subunit ribosomal protein L10 [Brucella sp. NVSL 07-0026]
 gi|306838945|ref|ZP_07471770.1| 50S ribosomal protein L10 [Brucella sp. NF 2653]
 gi|306840288|ref|ZP_07473061.1| 50S ribosomal protein L10 [Brucella sp. BO2]
 gi|306844150|ref|ZP_07476744.1| 50S ribosomal protein L10 [Brucella sp. BO1]
 gi|20978587|sp|Q8YHP9|RL10_BRUME RecName: Full=50S ribosomal protein L10
 gi|97181500|sp|Q2YM13|RL10_BRUA2 RecName: Full=50S ribosomal protein L10
 gi|189040906|sp|A9M5R2|RL10_BRUC2 RecName: Full=50S ribosomal protein L10
 gi|226699917|sp|B2S689|RL10_BRUA1 RecName: Full=50S ribosomal protein L10
 gi|254798363|sp|C0RJL3|RL10_BRUMB RecName: Full=50S ribosomal protein L10
 gi|82616179|emb|CAJ11222.1| Ribosomal protein L10:Eubacterial ribosomal protein L10 [Brucella
           melitensis biovar Abortus 2308]
 gi|161336012|gb|ABX62317.1| 50S ribosomal protein L10 [Brucella canis ATCC 23365]
 gi|189019964|gb|ACD72686.1| 50S ribosomal protein L10 [Brucella abortus S19]
 gi|225641107|gb|ACO01021.1| 50S ribosomal protein L10 [Brucella melitensis ATCC 23457]
 gi|255999830|gb|ACU48229.1| 50S ribosomal protein L10 [Brucella microti CCM 4915]
 gi|260095751|gb|EEW79628.1| 50S ribosomal protein L10 [Brucella abortus NCTC 8038]
 gi|260151574|gb|EEW86668.1| 50S ribosomal protein L10 [Brucella melitensis bv. 1 str. 16M]
 gi|260155747|gb|EEW90827.1| 50S ribosomal protein L10 [Brucella suis bv. 4 str. 40]
 gi|260668520|gb|EEX55460.1| 50S ribosomal protein L10 [Brucella abortus bv. 4 str. 292]
 gi|260672461|gb|EEX59282.1| 50S ribosomal protein L10 [Brucella abortus bv. 2 str. 86/8/59]
 gi|260675094|gb|EEX61915.1| 50S ribosomal protein L10 [Brucella abortus bv. 6 str. 870]
 gi|261744964|gb|EEY32890.1| 50S ribosomal protein L10 [Brucella suis bv. 3 str. 686]
 gi|262766270|gb|EEZ12059.1| 50S ribosomal protein L10 [Brucella melitensis bv. 3 str. Ether]
 gi|263002104|gb|EEZ14679.1| 50S ribosomal protein L10 [Brucella melitensis bv. 1 str. Rev.1]
 gi|263093882|gb|EEZ17833.1| 50S ribosomal protein L10 [Brucella melitensis bv. 2 str. 63/9]
 gi|264662893|gb|EEZ33154.1| 50S ribosomal protein L10 [Brucella sp. 83/13]
 gi|294821170|gb|EFG38169.1| large subunit ribosomal protein L10 [Brucella sp. NVSL 07-0026]
 gi|306275593|gb|EFM57325.1| 50S ribosomal protein L10 [Brucella sp. BO1]
 gi|306289743|gb|EFM60929.1| 50S ribosomal protein L10 [Brucella sp. BO2]
 gi|306405978|gb|EFM62232.1| 50S ribosomal protein L10 [Brucella sp. NF 2653]
 gi|326409267|gb|ADZ66332.1| 50S ribosomal protein L10 [Brucella melitensis M28]
 gi|326538975|gb|ADZ87190.1| 50S ribosomal protein L10 [Brucella melitensis M5-90]
          Length = 172

 Score =  170 bits (430), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 80/170 (47%), Positives = 114/170 (67%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M+R  K   ++ L+  F  SGS+VVAHY G++VAQ+ DLR KMR+AGG VKVAKNRL KI
Sbjct: 1   MDRAEKREFVAWLNGAFKESGSVVVAHYTGLTVAQMSDLRSKMRDAGGSVKVAKNRLAKI 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A++ T   GI+DLF GQ+++ Y++ P+ APK++V F+  N++  +LGG +    LN D +
Sbjct: 61  ALQGTESEGIADLFTGQTVVAYANDPITAPKVAVEFAKANDKLVILGGAMGATTLNADGV 120

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQ 170
           K +ASLP L+ +RA ++  IQ+ A RL  L   P  Q+ R I A   KN+
Sbjct: 121 KSLASLPSLDELRAKLVGMIQTPAQRLAVLTSAPAGQIARVIGAHARKNE 170


>gi|148558917|ref|YP_001259164.1| 50S ribosomal protein L10 [Brucella ovis ATCC 25840]
 gi|148370174|gb|ABQ60153.1| ribosomal protein L10 [Brucella ovis ATCC 25840]
          Length = 194

 Score =  169 bits (427), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 79/170 (46%), Positives = 115/170 (67%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           ++R  K   ++ L+  F  SGS+VVAHY G++VAQ+ DLR KMR+AGG VKVAKNRL KI
Sbjct: 23  VDRAEKREFVAWLNGAFKESGSVVVAHYTGLTVAQMSDLRSKMRDAGGSVKVAKNRLAKI 82

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A++ T   GI+DLF GQ+++ Y++ P+ APK++V F+  N++  +LGG +    LN D +
Sbjct: 83  ALQGTESEGIADLFTGQTVVAYANDPITAPKVAVEFAKANDKLVILGGAMGATTLNADGV 142

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQ 170
           K +ASLP L+ +RA ++  IQ+ A RL  L   P  Q+ R I A+  KN+
Sbjct: 143 KSLASLPSLDELRAKLVGMIQTPAQRLAVLTSAPAGQIARVIGAYARKNE 192


>gi|239832132|ref|ZP_04680461.1| 50S ribosomal protein L10 [Ochrobactrum intermedium LMG 3301]
 gi|239824399|gb|EEQ95967.1| 50S ribosomal protein L10 [Ochrobactrum intermedium LMG 3301]
          Length = 172

 Score =  168 bits (426), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 79/170 (46%), Positives = 114/170 (67%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M+R  K   ++ L+  F  SGS+VVAHY G++V+Q+ DLR KMR+AGG VKVAKNRL KI
Sbjct: 1   MDRAEKREFVAWLNGAFKESGSVVVAHYTGLTVSQMSDLRSKMRDAGGSVKVAKNRLAKI 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A++ T   GI+DLF GQ+++ Y++ P+ APK++V F+  N++  +LGG +    LN D +
Sbjct: 61  ALQGTESEGIADLFTGQTVVAYANDPIAAPKVAVEFAKTNDKLVILGGAMGATTLNADGV 120

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQ 170
           K +ASLP L+ +RA ++  IQ+ A RL  L   P  Q+ R I A   KN+
Sbjct: 121 KSLASLPSLDELRAKLVGMIQTPAQRLAVLTSAPAGQIARVIGAHARKNE 170


>gi|62290156|ref|YP_221949.1| 50S ribosomal protein L10 [Brucella abortus bv. 1 str. 9-941]
 gi|68067641|sp|P41107|RL10_BRUAB RecName: Full=50S ribosomal protein L10
 gi|62196288|gb|AAX74588.1| RplJ, ribosomal protein L10 [Brucella abortus bv. 1 str. 9-941]
          Length = 172

 Score =  168 bits (426), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 80/170 (47%), Positives = 113/170 (66%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M+R  K   ++ L+  F  SGS+VVAHY G++VAQ+ DLR KMR+AGG VKVAKNRL KI
Sbjct: 1   MDRAEKREFVAWLNGAFKESGSVVVAHYTGLTVAQMSDLRSKMRDAGGSVKVAKNRLAKI 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A++ T   GI DLF GQ+++ Y++ P+ APK++V F+  N++  +LGG +    LN D +
Sbjct: 61  ALQGTESEGIVDLFTGQTVVAYANDPITAPKVAVEFAKANDKLVILGGAMGATTLNADGV 120

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQ 170
           K +ASLP L+ +RA ++  IQ+ A RL  L   P  Q+ R I A   KN+
Sbjct: 121 KSLASLPSLDELRAKLVGMIQTPAQRLAVLTSAPAGQIARVIGAHARKNE 170


>gi|254706577|ref|ZP_05168405.1| 50S ribosomal protein L10 [Brucella pinnipedialis M163/99/10]
 gi|254710313|ref|ZP_05172124.1| 50S ribosomal protein L10 [Brucella pinnipedialis B2/94]
 gi|254714310|ref|ZP_05176121.1| 50S ribosomal protein L10 [Brucella ceti M644/93/1]
 gi|254717747|ref|ZP_05179558.1| 50S ribosomal protein L10 [Brucella ceti M13/05/1]
 gi|256031807|ref|ZP_05445421.1| 50S ribosomal protein L10 [Brucella pinnipedialis M292/94/1]
 gi|256159980|ref|ZP_05457695.1| 50S ribosomal protein L10 [Brucella ceti M490/95/1]
 gi|256255208|ref|ZP_05460744.1| 50S ribosomal protein L10 [Brucella ceti B1/94]
 gi|260168941|ref|ZP_05755752.1| 50S ribosomal protein L10 [Brucella sp. F5/99]
 gi|261219591|ref|ZP_05933872.1| 50S ribosomal protein L10 [Brucella ceti M13/05/1]
 gi|261222404|ref|ZP_05936685.1| 50S ribosomal protein L10 [Brucella ceti B1/94]
 gi|261314036|ref|ZP_05953233.1| 50S ribosomal protein L10 [Brucella pinnipedialis M163/99/10]
 gi|261317877|ref|ZP_05957074.1| 50S ribosomal protein L10 [Brucella pinnipedialis B2/94]
 gi|261322086|ref|ZP_05961283.1| 50S ribosomal protein L10 [Brucella ceti M644/93/1]
 gi|261758434|ref|ZP_06002143.1| 50S ribosomal protein L10 [Brucella sp. F5/99]
 gi|265988906|ref|ZP_06101463.1| 50S ribosomal protein L10 [Brucella pinnipedialis M292/94/1]
 gi|265998370|ref|ZP_06110927.1| 50S ribosomal protein L10 [Brucella ceti M490/95/1]
 gi|260920988|gb|EEX87641.1| 50S ribosomal protein L10 [Brucella ceti B1/94]
 gi|260924680|gb|EEX91248.1| 50S ribosomal protein L10 [Brucella ceti M13/05/1]
 gi|261294776|gb|EEX98272.1| 50S ribosomal protein L10 [Brucella ceti M644/93/1]
 gi|261297100|gb|EEY00597.1| 50S ribosomal protein L10 [Brucella pinnipedialis B2/94]
 gi|261303062|gb|EEY06559.1| 50S ribosomal protein L10 [Brucella pinnipedialis M163/99/10]
 gi|261738418|gb|EEY26414.1| 50S ribosomal protein L10 [Brucella sp. F5/99]
 gi|262552838|gb|EEZ08828.1| 50S ribosomal protein L10 [Brucella ceti M490/95/1]
 gi|264661103|gb|EEZ31364.1| 50S ribosomal protein L10 [Brucella pinnipedialis M292/94/1]
          Length = 172

 Score =  168 bits (425), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 79/170 (46%), Positives = 113/170 (66%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M+R  K   ++ L+  F  SGS+VVAHY G++VAQ+ DLR KMR+AGG VKVAKNRL KI
Sbjct: 1   MDRAEKREFVAWLNGAFKESGSVVVAHYTGLTVAQMSDLRSKMRDAGGSVKVAKNRLAKI 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A++ T   GI+DLF GQ+++ Y++ P+  PK++V F+  N++  +LGG +    LN D +
Sbjct: 61  ALQGTESEGIADLFTGQTVVAYANDPITTPKVAVEFAKANDKLVILGGAMGATTLNADGV 120

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQ 170
           K +ASLP L+ +RA ++  IQ+ A RL  L   P  Q+ R I A   KN+
Sbjct: 121 KSLASLPSLDELRAKLVGMIQTPAQRLAVLTSAPAGQIARVIGAHARKNE 170


>gi|254693947|ref|ZP_05155775.1| 50S ribosomal protein L10 [Brucella abortus bv. 3 str. Tulya]
 gi|261214240|ref|ZP_05928521.1| 50S ribosomal protein L10 [Brucella abortus bv. 3 str. Tulya]
 gi|260915847|gb|EEX82708.1| 50S ribosomal protein L10 [Brucella abortus bv. 3 str. Tulya]
          Length = 172

 Score =  168 bits (425), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 79/170 (46%), Positives = 113/170 (66%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M+R  K   ++ L+  F  SGS+VVAHY G++VAQ+ DLR KMR+AGG VKVAKNRL KI
Sbjct: 1   MDRAEKREFVAWLNGAFKESGSVVVAHYTGLTVAQMSDLRSKMRDAGGSVKVAKNRLAKI 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A++ T   GI+DLF GQ+++ Y++ P+ APK++V F+  N++  +LGG +    LN D +
Sbjct: 61  ALQGTESEGIADLFTGQTVVAYANDPITAPKVAVEFAKANDKLVILGGAMGATTLNADGV 120

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQ 170
           K +ASLP L+ +RA ++  IQ+ A RL  L   P  Q+ R I     KN+
Sbjct: 121 KSLASLPSLDELRAKLVGMIQTPAQRLAVLTSAPAGQIARVIGTHARKNE 170


>gi|241204155|ref|YP_002975251.1| 50S ribosomal protein L10 [Rhizobium leguminosarum bv. trifolii
           WSM1325]
 gi|240858045|gb|ACS55712.1| ribosomal protein L10 [Rhizobium leguminosarum bv. trifolii
           WSM1325]
          Length = 172

 Score =  168 bits (425), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 76/170 (44%), Positives = 117/170 (68%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M R  K   ++EL+++F +SGS+VVAHY G +VAQ+ D R KMR AGG VKVAKNRL KI
Sbjct: 1   MERAEKREFVTELNEVFKASGSVVVAHYAGATVAQMNDFRSKMRAAGGTVKVAKNRLAKI 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A++ T   G+++LF GQ+LI YS  P+ APK+ + F+  N++  VLGG +    LN +++
Sbjct: 61  ALQGTEAEGMTNLFKGQTLIAYSTDPITAPKVVMDFAKTNDKIIVLGGAMGTTTLNAEAV 120

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQ 170
           K +A+LP L+ +RA ++  IQ+ ATR+  ++  P +Q+ R  +A+  K++
Sbjct: 121 KSLATLPSLDELRAKLLGMIQTPATRIAGVVAAPASQLARVFAAYAKKDE 170


>gi|15965099|ref|NP_385452.1| 50S ribosomal protein L10 [Sinorhizobium meliloti 1021]
 gi|20978618|sp|Q92QH9|RL10_RHIME RecName: Full=50S ribosomal protein L10
 gi|15074279|emb|CAC45925.1| Probable 50S ribosomal protein L10 (L8) [Sinorhizobium meliloti
           1021]
          Length = 172

 Score =  168 bits (425), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 76/170 (44%), Positives = 117/170 (68%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M R  K   ++EL+++F +SGS+VVAHY G++VAQ+ D R KMR AGG V+VAKNRL KI
Sbjct: 1   MERAEKREFVTELNEVFKASGSVVVAHYAGVTVAQMNDFRSKMRAAGGTVRVAKNRLAKI 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A++ T   G++DLF GQ+LI +S+ PV APK+ + F+  N++  VLGG +    LN + +
Sbjct: 61  ALQGTESEGMTDLFKGQTLIAFSEDPVTAPKVVMDFAKTNDKLVVLGGAMGATTLNAEGV 120

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQ 170
           K +A+LP L+ +RA ++  I + ATR+  ++  P +Q+ R  SA+  K++
Sbjct: 121 KSLATLPSLDELRAKLLGLINAPATRVATVVAAPASQLARVFSAYAKKDE 170


>gi|325293348|ref|YP_004279212.1| 50S ribosomal protein L10 [Agrobacterium sp. H13-3]
 gi|325061201|gb|ADY64892.1| 50S ribosomal protein L10 [Agrobacterium sp. H13-3]
          Length = 172

 Score =  167 bits (424), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 77/170 (45%), Positives = 118/170 (69%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M R  K   ++EL+++F +SGS+VVAHY G++VAQ+ D R KMR AGG VKVAKNRL KI
Sbjct: 1   MERAEKREFVTELNEVFKASGSVVVAHYAGVTVAQMNDFRSKMRAAGGTVKVAKNRLAKI 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A++ T   G++DLF GQ+LI YS  P+IAPK+ + F+  N++  VLGG +    LN +++
Sbjct: 61  ALQGTESEGMTDLFKGQTLIAYSVDPMIAPKVVMDFAKTNDKVVVLGGSMGATTLNAEAV 120

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQ 170
           K +A+LP L+ +RA ++  + + ATR+  ++  P +Q+ R  SA+  K++
Sbjct: 121 KSLATLPSLDELRAKLLGLLNAPATRVATVVAAPASQLARVFSAYAKKDE 170


>gi|237815664|ref|ZP_04594661.1| 50S ribosomal protein L10 [Brucella abortus str. 2308 A]
 gi|237788962|gb|EEP63173.1| 50S ribosomal protein L10 [Brucella abortus str. 2308 A]
          Length = 215

 Score =  167 bits (423), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 79/170 (46%), Positives = 114/170 (67%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           ++R  K   ++ L+  F  SGS+VVAHY G++VAQ+ DLR KMR+AGG VKVAKNRL KI
Sbjct: 44  VDRAEKREFVAWLNGAFKESGSVVVAHYTGLTVAQMSDLRSKMRDAGGSVKVAKNRLAKI 103

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A++ T   GI+DLF GQ+++ Y++ P+ APK++V F+  N++  +LGG +    LN D +
Sbjct: 104 ALQGTESEGIADLFTGQTVVAYANDPITAPKVAVEFAKANDKLVILGGAMGATTLNADGV 163

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQ 170
           K +ASLP L+ +RA ++  IQ+ A RL  L   P  Q+ R I A   KN+
Sbjct: 164 KSLASLPSLDELRAKLVGMIQTPAQRLAVLTSAPAGQIARVIGAHARKNE 213


>gi|17982684|gb|AAL51928.1| lsu ribosomal protein l10p [Brucella melitensis bv. 1 str. 16M]
          Length = 208

 Score =  167 bits (422), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 79/170 (46%), Positives = 114/170 (67%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           ++R  K   ++ L+  F  SGS+VVAHY G++VAQ+ DLR KMR+AGG VKVAKNRL KI
Sbjct: 37  VDRAEKREFVAWLNGAFKESGSVVVAHYTGLTVAQMSDLRSKMRDAGGSVKVAKNRLAKI 96

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A++ T   GI+DLF GQ+++ Y++ P+ APK++V F+  N++  +LGG +    LN D +
Sbjct: 97  ALQGTESEGIADLFTGQTVVAYANDPITAPKVAVEFAKANDKLVILGGAMGATTLNADGV 156

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQ 170
           K +ASLP L+ +RA ++  IQ+ A RL  L   P  Q+ R I A   KN+
Sbjct: 157 KSLASLPSLDELRAKLVGMIQTPAQRLAVLTSAPAGQIARVIGAHARKNE 206


>gi|297248550|ref|ZP_06932268.1| large subunit ribosomal protein L10 [Brucella abortus bv. 5 str.
           B3196]
 gi|297175719|gb|EFH35066.1| large subunit ribosomal protein L10 [Brucella abortus bv. 5 str.
           B3196]
          Length = 194

 Score =  167 bits (422), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 79/170 (46%), Positives = 114/170 (67%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           ++R  K   ++ L+  F  SGS+VVAHY G++VAQ+ DLR KMR+AGG VKVAKNRL KI
Sbjct: 23  VDRAEKREFVAWLNGAFKESGSVVVAHYTGLTVAQMSDLRSKMRDAGGSVKVAKNRLAKI 82

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A++ T   GI+DLF GQ+++ Y++ P+ APK++V F+  N++  +LGG +    LN D +
Sbjct: 83  ALQGTESEGIADLFTGQTVVAYANDPITAPKVAVEFAKANDKLVILGGAMGATTLNADGV 142

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQ 170
           K +ASLP L+ +RA ++  IQ+ A RL  L   P  Q+ R I A   KN+
Sbjct: 143 KSLASLPSLDELRAKLVGMIQTPAQRLAVLTSAPAGQIARVIGAHARKNE 192


>gi|222148355|ref|YP_002549312.1| 50S ribosomal protein L10 [Agrobacterium vitis S4]
 gi|254798353|sp|B9JVM6|RL10_AGRVS RecName: Full=50S ribosomal protein L10
 gi|221735343|gb|ACM36306.1| 50S ribosomal Protein L10 [Agrobacterium vitis S4]
          Length = 172

 Score =  166 bits (421), Expect = 8e-40,   Method: Compositional matrix adjust.
 Identities = 77/170 (45%), Positives = 117/170 (68%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M R  K   ++EL+++F +SGS+VVAHY G++VAQ+ D R KMR AGG VKVAKNRL KI
Sbjct: 1   MERAEKREFVTELNEVFKASGSVVVAHYAGVTVAQMNDFRSKMRAAGGTVKVAKNRLAKI 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A++ T   G++DLF GQ+LI YS  P+ APK+ + F+  N++  VLGG +    L+ D++
Sbjct: 61  ALQGTESEGMTDLFKGQTLIAYSVDPITAPKVVMDFAKTNDKLVVLGGSMGTTTLSVDAV 120

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQ 170
           K +A+LP L+ +RA ++  IQ+ ATR+  ++  P  Q+ R  +A+  K++
Sbjct: 121 KSLATLPSLDELRAKLVGMIQTPATRIAGVVQAPAAQLARVFAAYAKKDE 170


>gi|15889252|ref|NP_354933.1| 50S ribosomal protein L10 [Agrobacterium tumefaciens str. C58]
 gi|22096071|sp|Q8UE06|RL10_AGRT5 RecName: Full=50S ribosomal protein L10
 gi|15157082|gb|AAK87718.1| 50S ribosomal Protein L10 [Agrobacterium tumefaciens str. C58]
          Length = 172

 Score =  166 bits (419), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 76/170 (44%), Positives = 118/170 (69%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M R  K   ++EL+++F +SGS+VVAHY G++VAQ+ D R KMR AGG VKVAKNRL KI
Sbjct: 1   MERAEKREFVTELNEVFKASGSVVVAHYAGVTVAQMNDFRSKMRAAGGTVKVAKNRLAKI 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A++ T   G+++LF GQ+LI YS  P+IAPK+ + F+  N++  VLGG +    LN +++
Sbjct: 61  ALQGTESEGMTNLFKGQTLIAYSVDPMIAPKVVMDFAKTNDKVVVLGGSMGATTLNAEAV 120

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQ 170
           K +A+LP L+ +RA ++  + + ATR+  ++  P +Q+ R  SA+  K++
Sbjct: 121 KSLATLPSLDELRAKLLGLLNAPATRVATVVAAPASQLARVFSAYAKKDE 170


>gi|225627714|ref|ZP_03785751.1| 50S ribosomal protein L10 [Brucella ceti str. Cudo]
 gi|225617719|gb|EEH14764.1| 50S ribosomal protein L10 [Brucella ceti str. Cudo]
          Length = 215

 Score =  165 bits (418), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 78/170 (45%), Positives = 113/170 (66%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           ++R  K   ++ L+  F  SGS+VVAHY G++VAQ+ DLR KMR+AGG VKVAKNRL KI
Sbjct: 44  VDRAEKREFVAWLNGAFKESGSVVVAHYTGLTVAQMSDLRSKMRDAGGSVKVAKNRLAKI 103

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A++ T   GI+DLF GQ+++ Y++ P+  PK++V F+  N++  +LGG +    LN D +
Sbjct: 104 ALQGTESEGIADLFTGQTVVAYANDPITTPKVAVEFAKANDKLVILGGAMGATTLNADGV 163

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQ 170
           K +ASLP L+ +RA ++  IQ+ A RL  L   P  Q+ R I A   KN+
Sbjct: 164 KSLASLPSLDELRAKLVGMIQTPAQRLAVLTSAPAGQIARVIGAHARKNE 213


>gi|307314834|ref|ZP_07594427.1| ribosomal protein L10 [Sinorhizobium meliloti BL225C]
 gi|307322133|ref|ZP_07601507.1| ribosomal protein L10 [Sinorhizobium meliloti AK83]
 gi|306892218|gb|EFN23030.1| ribosomal protein L10 [Sinorhizobium meliloti AK83]
 gi|306898948|gb|EFN29595.1| ribosomal protein L10 [Sinorhizobium meliloti BL225C]
          Length = 195

 Score =  165 bits (417), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 73/161 (45%), Positives = 114/161 (70%)

Query: 10  ISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRG 69
           ++EL+++F +SGS+VVAHY G++VAQ+ D R KMR AGG V+VAKNRL KIA++ T   G
Sbjct: 33  VTELNEVFKASGSVVVAHYAGVTVAQMNDFRSKMRAAGGTVRVAKNRLAKIALQGTESEG 92

Query: 70  ISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASLPDL 129
           ++DLF GQ+LI +S+ PV APK+ + F+  N++  VLGG +    LN + +K +A+LP L
Sbjct: 93  MTDLFKGQTLIAFSEDPVTAPKVVMDFAKTNDKLVVLGGAMGATTLNAEGVKSLATLPSL 152

Query: 130 EGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQ 170
           + +RA ++  I + ATR+  ++  P +Q+ R  SA+  K++
Sbjct: 153 DELRAKLLGLINAPATRVATVVAAPASQLARVFSAYAKKDE 193


>gi|49475396|ref|YP_033437.1| 50S ribosomal protein L10 [Bartonella henselae str. Houston-1]
 gi|61215008|sp|Q6G3X7|RL10_BARHE RecName: Full=50S ribosomal protein L10
 gi|49238202|emb|CAF27412.1| 50S ribosomal protein l10 [Bartonella henselae str. Houston-1]
          Length = 172

 Score =  164 bits (416), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 78/170 (45%), Positives = 116/170 (68%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           MNR  K   ++ L++ F  SGS++VAHY G++V+Q+ DLR KM EAGG +KVAKNRL KI
Sbjct: 1   MNRAEKREFVTWLNEAFRKSGSVIVAHYSGLTVSQMNDLRSKMSEAGGAIKVAKNRLAKI 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A++ T    I DLF GQ+LI YS+ P+ APK++V F+  N++F +LGG +    L+ D++
Sbjct: 61  ALQGTESESIVDLFSGQTLIAYSEDPITAPKVAVDFAKTNDKFVILGGSMGATSLSVDAV 120

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQ 170
           K +ASLP L  +RA ++  I + ATR+ +++  P  QVVR I A+  + +
Sbjct: 121 KSLASLPSLNELRAKLVGMISTPATRIAQVVNAPAGQVVRVIGAYAQEGK 170


>gi|227821746|ref|YP_002825716.1| 50S ribosomal protein L10 [Sinorhizobium fredii NGR234]
 gi|227340745|gb|ACP24963.1| 50S ribosomal protein L10 [Sinorhizobium fredii NGR234]
          Length = 195

 Score =  164 bits (415), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 72/161 (44%), Positives = 114/161 (70%)

Query: 10  ISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRG 69
           ++EL+++F +SGS+VVAHY G++VAQ+ D R KMR AGG VKVAKNRL KIA++ T   G
Sbjct: 33  VTELNEVFKASGSVVVAHYAGVTVAQMNDFRSKMRAAGGTVKVAKNRLAKIALQGTESEG 92

Query: 70  ISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASLPDL 129
           ++DLF GQ+LI +S  P+ APK+ + F+  N++  VLGG +    LN +++K +A+LP L
Sbjct: 93  MTDLFKGQTLIAFSADPITAPKVVMDFAKTNDKLVVLGGAMGTTTLNAEAVKSLATLPSL 152

Query: 130 EGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQ 170
           + +RA ++  + + ATR+  ++  P +Q+ R  SA+  K++
Sbjct: 153 DELRAKLLGLLNAPATRVATVVAAPASQLARVFSAYAKKDE 193


>gi|163868087|ref|YP_001609291.1| 50S ribosomal protein L10 [Bartonella tribocorum CIP 105476]
 gi|189040905|sp|A9ISF5|RL10_BART1 RecName: Full=50S ribosomal protein L10
 gi|161017738|emb|CAK01296.1| 50S ribosomal protein L10 [Bartonella tribocorum CIP 105476]
          Length = 172

 Score =  164 bits (415), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 78/170 (45%), Positives = 115/170 (67%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           MNR  K   ++ L++ F  SGS+VVAHY G++V+Q+ DLR KM EAGG VKVAKNRL KI
Sbjct: 1   MNRAEKREFVTWLNEAFQKSGSVVVAHYSGLTVSQMNDLRSKMGEAGGAVKVAKNRLAKI 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A++ T    I+ LF GQ+LI YS+ P+ APK++V F+  N++F +LGG +    L  D++
Sbjct: 61  ALQGTESESIAGLFTGQTLIAYSEDPITAPKVAVDFAKSNDKFVILGGSMGATSLTVDAV 120

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQ 170
           K +ASLP L  +RA ++  I + ATR+ +++  P  QV R I A+  +++
Sbjct: 121 KSLASLPSLNELRAKLVGMISTPATRIAQVVNAPAGQVARVIGAYAQEDK 170


>gi|319408381|emb|CBI82036.1| 50S ribosomal protein L10 [Bartonella schoenbuchensis R1]
          Length = 172

 Score =  164 bits (415), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 75/170 (44%), Positives = 115/170 (67%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M+R  K   ++ L++ F  SGS++VAHY G++V+Q+ DLR KM EAGG +KVAKNRL KI
Sbjct: 1   MDRAEKREFVTWLNEAFQKSGSVIVAHYSGLTVSQMNDLRSKMSEAGGAIKVAKNRLAKI 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A++ T    + DLF GQ+LI YS+ P+ APK++V F+  N +F +LGG +    L+ D++
Sbjct: 61  ALQGTDSESMRDLFTGQTLIAYSEDPITAPKVAVDFAKTNEQFVILGGSMGATSLSVDAV 120

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQ 170
           K +ASLP L  +RA ++  I + ATR+ +++  P +QV R + A+  + Q
Sbjct: 121 KSLASLPSLNELRAKLVGMISTPATRVAQVVNAPASQVARVVGAYAQEGQ 170


>gi|150396197|ref|YP_001326664.1| 50S ribosomal protein L10 [Sinorhizobium medicae WSM419]
 gi|150027712|gb|ABR59829.1| ribosomal protein L10 [Sinorhizobium medicae WSM419]
          Length = 195

 Score =  164 bits (415), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 72/161 (44%), Positives = 114/161 (70%)

Query: 10  ISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRG 69
           ++EL+++F +SGS+VVAHY G++VAQ+ D R KMR AGG V+VAKNRL KIA++ T   G
Sbjct: 33  VTELNEVFKASGSVVVAHYAGVTVAQMNDFRSKMRAAGGTVRVAKNRLAKIALQGTESEG 92

Query: 70  ISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASLPDL 129
           ++DLF GQ+LI +S+ PV APK+ + F+  N++  VLGG +    LN + +K +A+LP L
Sbjct: 93  MTDLFRGQTLIAFSEDPVTAPKVVMDFAKTNDKLVVLGGAMGATTLNAEGVKSLATLPSL 152

Query: 130 EGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQ 170
           + +RA ++  + + ATR+  ++  P +Q+ R  SA+  K++
Sbjct: 153 DELRAKLLGLLNAPATRVATVVAAPASQLARVFSAYAKKDE 193


>gi|319407385|emb|CBI81036.1| 50S ribosomal protein L10 [Bartonella sp. 1-1C]
          Length = 169

 Score =  163 bits (412), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 77/165 (46%), Positives = 114/165 (69%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           MN+  K   ++ L+K F  SGS+VVAHY G++V+Q+ DLR KM EAGG +KVAKNRL KI
Sbjct: 1   MNKAEKGKFVAWLNKTFQESGSVVVAHYSGLTVSQMNDLRSKMSEAGGAIKVAKNRLAKI 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A++ T    + DLF GQ+LI YS+ P+ A K++V F+  N++F +LGG + +  L+ D+I
Sbjct: 61  ALQGTKSEEMMDLFTGQTLIAYSEDPITASKVAVDFAKANDKFVILGGAMGETSLSVDAI 120

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAF 165
           K +ASLP L  +RA I+  + + ATR+V+++  P  QV R + A+
Sbjct: 121 KSLASLPSLNELRAKILGMVSTPATRIVQVINAPTGQVARVVGAY 165


>gi|319404384|emb|CBI77987.1| 50S ribosomal protein L10 [Bartonella rochalimae ATCC BAA-1498]
          Length = 169

 Score =  162 bits (410), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 78/165 (47%), Positives = 114/165 (69%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           MN+  K   ++ L+K F  SGS+VVAHY G++V+Q+ DLR KM EAGG +KVAKNRL KI
Sbjct: 1   MNKAEKGKFVAWLNKTFQESGSVVVAHYSGLTVSQMSDLRSKMSEAGGAIKVAKNRLAKI 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A++ T    + DLF GQ+LI YS+ P+ A K++V F+  N++F +LGG + +  L+ D+I
Sbjct: 61  ALQGTKSEEMMDLFTGQTLIAYSEDPITASKVAVDFAKANDKFVILGGSMGETSLSVDAI 120

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAF 165
           K +ASLP L  +RA I+  + + ATR+V+++  P  QV R I A+
Sbjct: 121 KSLASLPSLNELRAKILGMVSTPATRIVQVINAPAGQVARVIGAY 165


>gi|240850290|ref|YP_002971683.1| 50S ribosomal protein L10 [Bartonella grahamii as4aup]
 gi|240267413|gb|ACS51001.1| 50S ribosomal protein L10 [Bartonella grahamii as4aup]
          Length = 172

 Score =  162 bits (410), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 78/170 (45%), Positives = 114/170 (67%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           MNR  K   ++ L++ F  SGS+VVAHY G++V+Q+ DLR KM EAGG VKVAKNRL KI
Sbjct: 1   MNRAEKREFVTWLNEAFRKSGSVVVAHYSGLTVSQMNDLRSKMGEAGGAVKVAKNRLAKI 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A++ T    I  LF GQ+LI YS+ P+ APK++V F+  N++F +LGG +    L  D++
Sbjct: 61  ALQGTESESIVGLFTGQTLIAYSEDPITAPKVAVDFAKSNDKFVILGGSMGATSLTVDAV 120

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQ 170
           K +ASLP L  +RA ++  I + ATR+ +++  P  QV R I A+  +++
Sbjct: 121 KSLASLPSLNELRAKLVGMISTPATRIAQVVNAPAGQVARVIGAYAQEDK 170


>gi|110634171|ref|YP_674379.1| 50S ribosomal protein L10 [Mesorhizobium sp. BNC1]
 gi|122965926|sp|Q11HB1|RL10_MESSB RecName: Full=50S ribosomal protein L10
 gi|110285155|gb|ABG63214.1| LSU ribosomal protein L10P [Chelativorans sp. BNC1]
          Length = 172

 Score =  162 bits (409), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 78/170 (45%), Positives = 114/170 (67%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M R  K   ++ L+++F ++GS+VVA Y G++VAQ+ DLR KMR AGG VKVAKNRL KI
Sbjct: 1   MERAEKREFVASLNQVFQNTGSVVVATYAGLTVAQMNDLRSKMRAAGGSVKVAKNRLAKI 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A++ T   GI  LF GQ+LI YSD PV APKI+  F+  N+   +LGG +    L+ + +
Sbjct: 61  ALQGTPSEGIQALFQGQTLIAYSDDPVAAPKIASEFAKGNDNLVILGGAMGATALDAEGV 120

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQ 170
           K +ASLP L+ +RA I+  IQ+ ATR+ +++  P  Q+ R + A+  K++
Sbjct: 121 KALASLPSLDELRAKIVGMIQTPATRIAQIVNAPAGQLARVVGAYARKDE 170


>gi|49474309|ref|YP_032351.1| 50S ribosomal protein L10 [Bartonella quintana str. Toulouse]
 gi|61215000|sp|Q6FZL7|RL10_BARQU RecName: Full=50S ribosomal protein L10
 gi|49239813|emb|CAF26204.1| 50s ribosomal protein l10 [Bartonella quintana str. Toulouse]
          Length = 172

 Score =  162 bits (409), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 78/170 (45%), Positives = 114/170 (67%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           MNR  K   ++ L++ F  SGS+VVAHY G++V Q+  LR KM EAGG VKVAKNRL KI
Sbjct: 1   MNRAEKREFVTWLNEAFRKSGSVVVAHYSGLTVLQMNSLRSKMGEAGGAVKVAKNRLAKI 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A++ T    I DLF GQ+LI YS+ P+ APK++V F+ +N++F +LGG +    L+ D++
Sbjct: 61  ALQGTESESIVDLFTGQTLIAYSEDPITAPKVAVDFAKNNDKFVILGGSMGATSLSVDAV 120

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQ 170
           K +ASLP L  +RA ++  I + ATR+ +++  P  QV R I A+  + +
Sbjct: 121 KSLASLPSLNELRAKLVGMISTPATRIAQIVNAPAGQVARVIGAYAQEGK 170


>gi|328543347|ref|YP_004303456.1| 50S ribosomal protein L10 [Polymorphum gilvum SL003B-26A1]
 gi|326413092|gb|ADZ70155.1| 50S ribosomal protein L10 [Polymorphum gilvum SL003B-26A1]
          Length = 172

 Score =  161 bits (407), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 76/170 (44%), Positives = 114/170 (67%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M R  K   ++ L+++  S+G +VVAHY G+SVAQ+  LR K+REAGG VKVAKNRLVK+
Sbjct: 1   MERAEKHEFVTSLNEVLGSTGVVVVAHYAGLSVAQMTALRSKVREAGGSVKVAKNRLVKL 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A++ T +  I+DLF G +LI YSD PV APK  V F+   ++F +LGG +    LN D +
Sbjct: 61  ALQGTELEHIADLFKGPTLIAYSDDPVAAPKAVVDFAKTTDKFVILGGALGSTNLNADGV 120

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQ 170
           K +A++P L+ +RA ++  IQ+ ATR+ +++  P  Q+ R   A+  K++
Sbjct: 121 KSLATMPSLDELRAKLVGMIQTPATRIAQVVNAPAGQLARVFGAYAKKDE 170


>gi|121602049|ref|YP_988879.1| 50S ribosomal protein L10 [Bartonella bacilliformis KC583]
 gi|166229706|sp|A1USC6|RL10_BARBK RecName: Full=50S ribosomal protein L10
 gi|120614226|gb|ABM44827.1| ribosomal protein L10 [Bartonella bacilliformis KC583]
          Length = 172

 Score =  160 bits (406), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 77/170 (45%), Positives = 116/170 (68%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           MNR  K   ++ L+KIF  SGS+VVAHY G++V+Q+ DLR K+ EAGG VKVAKN L KI
Sbjct: 1   MNRAEKREFVTWLNKIFQESGSVVVAHYSGLTVSQMSDLRSKIGEAGGAVKVAKNTLAKI 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A++ T    +++LF GQ+LI YS+ P++APK++V F+  N++  +LGG +    L+ D++
Sbjct: 61  ALQGTKSESMANLFTGQTLIAYSEDPIVAPKVAVDFAKANDKLVILGGSMGAVSLSVDAV 120

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQ 170
           K +ASLP L  +RA ++  I + ATR+ +++  P  QV R I A+  K +
Sbjct: 121 KSLASLPSLNELRAKLVGMISTPATRVAQVIKAPAGQVARVIGAYAQKGE 170


>gi|163759404|ref|ZP_02166490.1| 50S ribosomal protein L10 [Hoeflea phototrophica DFL-43]
 gi|162283808|gb|EDQ34093.1| 50S ribosomal protein L10 [Hoeflea phototrophica DFL-43]
          Length = 172

 Score =  160 bits (406), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 75/170 (44%), Positives = 116/170 (68%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M+R  K   ++EL+ +F+++GS+VVAHY G++VAQ+ DLR +MR AGG VKVAKNRL KI
Sbjct: 1   MDRAEKREFVAELNGVFTNAGSVVVAHYAGLTVAQMNDLRSRMRTAGGTVKVAKNRLAKI 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A++ T   G + LF GQ+LI Y + PV APKI+V F+  +++  +LGG +    L+ D +
Sbjct: 61  ALQGTESEGAASLFEGQTLIAYCEDPVTAPKIAVEFAKVSDKLVILGGAMGATTLDADGV 120

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQ 170
           K +A++P ++ +RA I+  IQ+ ATR+ +++  P   V R I A   K++
Sbjct: 121 KALATMPSIDELRAKIVGMIQTPATRIAQIVNAPAGAVARVIGAHARKDE 170


>gi|13470540|ref|NP_102108.1| 50S ribosomal protein L10 [Mesorhizobium loti MAFF303099]
 gi|20978643|sp|Q98N68|RL10_RHILO RecName: Full=50S ribosomal protein L10
 gi|14021281|dbj|BAB47894.1| 50S ribosomal protein L10 [Mesorhizobium loti MAFF303099]
          Length = 172

 Score =  160 bits (405), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 77/170 (45%), Positives = 114/170 (67%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M+R  K   ++ L++ F ++GS+VVAHY GI+VAQ+ DLR KMR AGG VKVAKNRL KI
Sbjct: 1   MDRAEKRELVTGLNEAFGNAGSVVVAHYAGITVAQMNDLRSKMRAAGGTVKVAKNRLAKI 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A++ T    I DLF GQ+LI YS+ P+ APK++  F+  N++  +LGG +    LN D +
Sbjct: 61  ALQGTDSASIIDLFKGQTLIAYSEDPIAAPKVASDFAKGNDKLVILGGAMGTTSLNADGV 120

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQ 170
           K +A+LP L+ +RA ++  I + ATR+ +++  P   V R I A+  K++
Sbjct: 121 KALATLPSLDELRAKLVGMIATPATRIAQIVNAPAASVARVIGAYARKDE 170


>gi|319899058|ref|YP_004159151.1| 50S ribosomal protein L10 [Bartonella clarridgeiae 73]
 gi|319403022|emb|CBI76577.1| 50S ribosomal protein L10 [Bartonella clarridgeiae 73]
          Length = 205

 Score =  160 bits (404), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 75/165 (45%), Positives = 114/165 (69%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           +N+  KS  ++ L+K F  SGS+VVAHY G++V+Q+ DLR KM EAGG +KVAKNRL KI
Sbjct: 37  VNKAEKSKFVAWLNKTFQESGSVVVAHYSGLTVSQMNDLRSKMNEAGGAIKVAKNRLAKI 96

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A++ T    + DLF GQ+LIVYS+ P+ A +++V F+  N++F +LGG +    L+ D++
Sbjct: 97  ALQGTESEAMMDLFTGQTLIVYSEDPITASRVAVDFAKTNDKFVILGGSMGATSLSVDAM 156

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAF 165
           K +ASLP L  +RA I+  + + ATR+ +++  P  QV R + A+
Sbjct: 157 KSLASLPSLNELRAKILGMVSTPATRIAQIVNAPAGQVARVVGAY 201


>gi|260469684|ref|ZP_05813846.1| ribosomal protein L10 [Mesorhizobium opportunistum WSM2075]
 gi|259028543|gb|EEW29857.1| ribosomal protein L10 [Mesorhizobium opportunistum WSM2075]
          Length = 172

 Score =  160 bits (404), Expect = 8e-38,   Method: Compositional matrix adjust.
 Identities = 77/170 (45%), Positives = 114/170 (67%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M+R  K   ++ L+  F+S+GS+VVAHY GI+VAQ+ DLR KMR AGG VKVAKNRL KI
Sbjct: 1   MDRAEKRELVTGLNDAFASAGSVVVAHYAGITVAQMNDLRSKMRAAGGTVKVAKNRLAKI 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A++ T    I +LF GQ+LI YS+ P+ APK++  F+  N++  +LGG +    LN D +
Sbjct: 61  ALQGTDSASIIELFKGQTLIAYSEDPIAAPKVASDFAKGNDKLVILGGAMGTTSLNADGV 120

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQ 170
           K +A+LP L+ +RA ++  I + ATR+ +++  P   V R I A+  K++
Sbjct: 121 KALATLPSLDELRARLVGMIATPATRIAQIVNAPAASVARVIGAYARKDE 170


>gi|319783306|ref|YP_004142782.1| ribosomal protein L10 [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
 gi|317169194|gb|ADV12732.1| ribosomal protein L10 [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
          Length = 172

 Score =  159 bits (401), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 77/170 (45%), Positives = 114/170 (67%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M+R  K   ++ L+  FS++GS+VVAHY GI+VAQ+ DLR KMR AGG VKVAKNRL KI
Sbjct: 1   MDRAEKRELVTGLNGAFSNAGSVVVAHYAGITVAQMNDLRSKMRAAGGTVKVAKNRLAKI 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A++ T    I +LF GQ+LI YS+ P+ APK++  F+  N++  +LGG +    LN D +
Sbjct: 61  ALQGTDSASIIELFKGQTLIAYSEDPIAAPKVASDFAKGNDKLVILGGAMGTTSLNADGV 120

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQ 170
           K +A+LP L+ +RA ++  I + ATR+ +++  P   V R I A+  K++
Sbjct: 121 KALATLPSLDELRARLVGMIATPATRIAQIVNAPAASVARVIGAYARKDE 170


>gi|319405858|emb|CBI79490.1| 50S ribosomal protein L10 [Bartonella sp. AR 15-3]
          Length = 169

 Score =  158 bits (400), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 76/165 (46%), Positives = 111/165 (67%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           MN+  K   ++ L+K F  SGS+VVAHY G++V+Q+ DLR KM EAGG +KVAKNRL KI
Sbjct: 1   MNKAEKGKFVTWLNKTFQESGSVVVAHYSGLTVSQMNDLRSKMSEAGGAIKVAKNRLAKI 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A++ T    +  LF GQ+LI YS+ P+ A K++V F+  N++F +LGG +    L+ D+I
Sbjct: 61  ALQGTKSEAMMGLFTGQTLIAYSEDPITASKVTVDFAKANDQFVILGGSMGATTLSVDAI 120

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAF 165
           K +ASLP L  +RA I+S + + A R+V+++  P  QV R I  +
Sbjct: 121 KSLASLPSLNELRAKILSMVSTPAIRIVQVVNAPAGQVARVIGVY 165


>gi|323137107|ref|ZP_08072186.1| ribosomal protein L10 [Methylocystis sp. ATCC 49242]
 gi|322397465|gb|EFX99987.1| ribosomal protein L10 [Methylocystis sp. ATCC 49242]
          Length = 171

 Score =  157 bits (398), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 69/169 (40%), Positives = 116/169 (68%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M+R  K   ++ L ++F+ +G +VVAHY G++VAQ+++LRK+ R+AG  V+VAKNRL KI
Sbjct: 1   MDRAEKKEAVAALREVFTKTGVVVVAHYSGLTVAQLQNLRKQARDAGATVQVAKNRLAKI 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A+    +  I+ L  G +LI YSD PV APK++V+F+ D+++F +LGG + K  LN DS+
Sbjct: 61  ALDGADVASIAPLLKGPTLIAYSDDPVAAPKVAVAFAKDHDKFVILGGAMGKTALNPDSV 120

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKN 169
           K +A++P L+ +RA ++  +Q+ AT++ +L   P  ++ R   A+  ++
Sbjct: 121 KSLATMPSLDELRAKLVGLVQAPATKIAQLSTAPAAKLARVFGAYAKQD 169


>gi|118591196|ref|ZP_01548595.1| 50S ribosomal protein L10 [Stappia aggregata IAM 12614]
 gi|118436272|gb|EAV42914.1| 50S ribosomal protein L10 [Stappia aggregata IAM 12614]
          Length = 172

 Score =  157 bits (396), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 75/170 (44%), Positives = 114/170 (67%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M R  K   +S L+    ++G +VVAHY G+SVAQ+  LR  +REAGG VKVAKNRLVK+
Sbjct: 1   MERAEKHEFVSALNAELGNTGVVVVAHYAGLSVAQMTALRASVREAGGTVKVAKNRLVKL 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A++ T +  ISDLF G ++IV+SD PV APK +V F+  N++F +LGG +    LN D +
Sbjct: 61  ALQGTDLEHISDLFQGPTVIVHSDDPVAAPKAAVDFAKANDKFEILGGALGSTNLNPDGV 120

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQ 170
           K +A++P L+ +RA ++  IQ+ A+R+ +++  P  Q+ R   A+  K++
Sbjct: 121 KSLATMPSLDELRAKLVGMIQTPASRIAQVVNAPAGQLARVFGAYAKKDE 170


>gi|146340044|ref|YP_001205092.1| 50S ribosomal protein L10 [Bradyrhizobium sp. ORS278]
 gi|148256404|ref|YP_001240989.1| 50S ribosomal protein L10 [Bradyrhizobium sp. BTAi1]
 gi|166229709|sp|A5ELN9|RL10_BRASB RecName: Full=50S ribosomal protein L10
 gi|166229710|sp|A4YSH9|RL10_BRASO RecName: Full=50S ribosomal protein L10
 gi|146192850|emb|CAL76855.1| 50S ribosomal subunit protein L10 [Bradyrhizobium sp. ORS278]
 gi|146408577|gb|ABQ37083.1| LSU ribosomal protein L10P [Bradyrhizobium sp. BTAi1]
          Length = 172

 Score =  154 bits (390), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 73/170 (42%), Positives = 111/170 (65%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M R  K   + +L ++F ++G  VVAHY G++VAQ+++LRK+M++AG  VKV+KNRL KI
Sbjct: 1   MERAAKKEAVEQLHEVFKTTGVAVVAHYSGLTVAQMQNLRKQMKQAGASVKVSKNRLAKI 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A+  T + GI  L  G ++I  S+ PV APK+++ F+  N +F +LGG +   VLN DS+
Sbjct: 61  ALEGTDVVGIGPLLKGPTVIATSNDPVAAPKVAIEFAKANEKFVILGGSMGSTVLNVDSV 120

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQ 170
           K +ASLP L+ +R  ++  IQ+ AT+L +L   P  +V R I A   K +
Sbjct: 121 KALASLPSLDELRGKLVGLIQAPATKLAQLANAPAAKVARVIQAHASKGE 170


>gi|182678328|ref|YP_001832474.1| 50S ribosomal protein L10 [Beijerinckia indica subsp. indica ATCC
           9039]
 gi|226699910|sp|B2IK53|RL10_BEII9 RecName: Full=50S ribosomal protein L10
 gi|182634211|gb|ACB94985.1| ribosomal protein L10 [Beijerinckia indica subsp. indica ATCC 9039]
          Length = 172

 Score =  154 bits (388), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 70/169 (41%), Positives = 112/169 (66%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M+R  K   ++ L+ +F  +  +VVAHY G++VAQ+++LRK+MR +G  V+VAKNRLVKI
Sbjct: 1   MDRAEKKESVAALADVFQKTSVVVVAHYSGLTVAQMQNLRKQMRASGATVQVAKNRLVKI 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A+  T +  IS L  G +LI YSD PV APK++V F+ D+++F +LGG +    LN D +
Sbjct: 61  ALDGTPVSSISPLLKGPTLIAYSDDPVAAPKVAVGFAKDHDKFVILGGAMGTTALNVDGV 120

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKN 169
           + +A++P L+ +R  ++  IQ+ AT+L +L   P  ++ R   A+  K+
Sbjct: 121 RSLATMPSLDELRGKLVGLIQAPATKLAQLTTAPAAKLARVFGAYAAKD 169


>gi|134285133|gb|ABO69611.1| ribosomal subunit protein L10 [Candidatus Liberibacter asiaticus]
          Length = 77

 Score =  153 bits (386), Expect = 9e-36,   Method: Compositional matrix adjust.
 Identities = 77/77 (100%), Positives = 77/77 (100%)

Query: 43  MREAGGGVKVAKNRLVKIAIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNE 102
           MREAGGGVKVAKNRLVKIAIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNE
Sbjct: 1   MREAGGGVKVAKNRLVKIAIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNE 60

Query: 103 FRVLGGVVEKGVLNQDS 119
           FRVLGGVVEKGVLNQDS
Sbjct: 61  FRVLGGVVEKGVLNQDS 77


>gi|90417772|ref|ZP_01225684.1| ribosomal protein L10 [Aurantimonas manganoxydans SI85-9A1]
 gi|90337444|gb|EAS51095.1| ribosomal protein L10 [Aurantimonas manganoxydans SI85-9A1]
          Length = 172

 Score =  153 bits (386), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 73/170 (42%), Positives = 110/170 (64%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M+R  K   ++ L + F +SG++VVAHY G++VAQ+ D R KMR AGG V+VAKNRL KI
Sbjct: 1   MDRAEKREFVTSLHETFQASGTVVVAHYAGLTVAQMNDYRSKMRVAGGTVRVAKNRLAKI 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A+  T   GIS+LF GQ+LI YS  PV A K++  F+  N++  +LGG +    L+ D +
Sbjct: 61  ALEGTDAAGISNLFEGQTLIAYSSDPVAAAKVTNDFAKGNDKLVILGGSMGATTLDADGV 120

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQ 170
           K +A++P L+ +RA ++  I + ATR+  +L  P  Q+ R   A+  K++
Sbjct: 121 KALATMPSLDELRAKLVGMINTPATRIAGVLQAPAGQLARVFGAYAKKDE 170


>gi|114704474|ref|ZP_01437382.1| 50S ribosomal protein L10 [Fulvimarina pelagi HTCC2506]
 gi|114539259|gb|EAU42379.1| 50S ribosomal protein L10 [Fulvimarina pelagi HTCC2506]
          Length = 172

 Score =  153 bits (386), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 74/170 (43%), Positives = 111/170 (65%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M R  K   +++L++ F  +G +VVAHY G++VA + DLR +MR AGG VKVAKNRL KI
Sbjct: 1   MERAEKREFVTQLNQSFQDAGVVVVAHYAGLTVANMNDLRSQMRAAGGTVKVAKNRLAKI 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A++ T   GIS+LF GQ+LI YS  PV A K+S  FS  N++  +LGG +    L+ D +
Sbjct: 61  ALQGTDAEGISNLFEGQTLIAYSSDPVAAAKVSNDFSKKNDKLVILGGALGATTLDADGV 120

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQ 170
           K +A LP L+ +R  ++  IQ+ ATR+  ++  P  Q+ R ++A+  K++
Sbjct: 121 KALADLPSLDELRGKLVGMIQTPATRIAGVVQAPAGQLARVLNAYATKDE 170


>gi|307946275|ref|ZP_07661610.1| 50S ribosomal protein L10 [Roseibium sp. TrichSKD4]
 gi|307769939|gb|EFO29165.1| 50S ribosomal protein L10 [Roseibium sp. TrichSKD4]
          Length = 172

 Score =  152 bits (384), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 70/170 (41%), Positives = 114/170 (67%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M R  K   ++ L+   + +G +VVAHY G+SV+Q+  LR  +REAGG VKVAKNRLVK+
Sbjct: 1   MERAEKHEFVTSLNAELADTGVVVVAHYAGLSVSQMTALRSSVREAGGTVKVAKNRLVKL 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A++ T +  I+DLF G + +VYS+ PV APK +V+F+  N +F +LGG +    LN D +
Sbjct: 61  ALQGTELEHIADLFQGPTALVYSEDPVAAPKAAVNFAKANEKFEILGGALGSTNLNADGV 120

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQ 170
           K +A++P L+ +R  ++  IQ+ A+R+ +++  P  Q+ R  +A+ +K++
Sbjct: 121 KSLATMPSLDELRGKLVGLIQTPASRIAQVVNAPAGQLARVFNAYAEKDK 170


>gi|154253168|ref|YP_001413992.1| 50S ribosomal protein L10 [Parvibaculum lavamentivorans DS-1]
 gi|189040924|sp|A7HWQ2|RL10_PARL1 RecName: Full=50S ribosomal protein L10
 gi|154157118|gb|ABS64335.1| ribosomal protein L10 [Parvibaculum lavamentivorans DS-1]
          Length = 172

 Score =  152 bits (383), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 70/170 (41%), Positives = 113/170 (66%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M+R  KS  ++ L+ +F+++G +VVAHY G++V Q+ DLR +M +AG   KV KNRL K+
Sbjct: 1   MDRAEKSELVTHLNGVFANAGVVVVAHYSGLTVNQMSDLRSRMAKAGASFKVTKNRLAKL 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A+  T +  I DLF G + I YS  PV APK+++ F+ +N +  +LGG + + VL+  ++
Sbjct: 61  ALDGTPMTEIGDLFAGPTAIAYSQDPVAAPKVAIEFAKENQKLVILGGAMGQTVLDAKAV 120

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQ 170
           KQ+A LP L+ +RA I+  IQ+ ATR+  +L  P  Q+ R ++A+  K++
Sbjct: 121 KQLADLPSLDELRAKIVGMIQTPATRIAGVLQAPGGQLARVLNAYATKSE 170


>gi|254501403|ref|ZP_05113554.1| ribosomal protein L10, putative [Labrenzia alexandrii DFL-11]
 gi|222437474|gb|EEE44153.1| ribosomal protein L10, putative [Labrenzia alexandrii DFL-11]
          Length = 172

 Score =  150 bits (379), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 70/170 (41%), Positives = 109/170 (64%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M R  K   ++  +   + +G +VVAHY G+SVAQ+  LR  +REAGG VKVAKNRLVK+
Sbjct: 1   MERAEKQEFVTSFNAELADTGVVVVAHYAGLSVAQMTALRSSVREAGGSVKVAKNRLVKL 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A++ T +  ISDL  G +++VYSD PV APK +V F+  N +  +LGG +    LN + +
Sbjct: 61  ALKGTDLEHISDLLQGPTVLVYSDDPVAAPKAAVDFAKANTQLEILGGALGTTNLNPEGV 120

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQ 170
           K +A++P L+ +RA ++  IQ+  TR+ +++  P  Q+ R   A+  K++
Sbjct: 121 KSLATMPSLDELRAKLVGMIQTPGTRIAQVVNAPAGQLARVFGAYAKKDE 170


>gi|158422509|ref|YP_001523801.1| 50S ribosomal protein L10 [Azorhizobium caulinodans ORS 571]
 gi|189040903|sp|A8HTY1|RL10_AZOC5 RecName: Full=50S ribosomal protein L10
 gi|158329398|dbj|BAF86883.1| ribosomal protein L10 [Azorhizobium caulinodans ORS 571]
          Length = 172

 Score =  149 bits (377), Expect = 9e-35,   Method: Compositional matrix adjust.
 Identities = 67/170 (39%), Positives = 111/170 (65%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M+R  K   ++ LS++F S+  +VVAHY G++VAQ+  LR++M+  G  VKVAKNRL KI
Sbjct: 1   MDRAEKQELVTTLSEVFKSTSVVVVAHYSGLTVAQMSKLRRQMKAEGATVKVAKNRLAKI 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A+  + +  ++ L  G ++I YS  PV APK++V F+  N++F +LGG + K  LN D +
Sbjct: 61  ALEGSDVAHVATLLKGPTIIAYSSDPVAAPKVAVEFAKANDKFVILGGAMGKTALNADGV 120

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQ 170
           K +A++P L+ +RA ++  IQ+ AT++ +L   P  ++ R   A+  +N+
Sbjct: 121 KALATMPSLDELRAKLVGLIQAPATKIAQLSTAPAAKLARVFGAYAKQNE 170


>gi|209884797|ref|YP_002288654.1| ribosomal protein L10 [Oligotropha carboxidovorans OM5]
 gi|226699980|sp|B6JER7|RL10_OLICO RecName: Full=50S ribosomal protein L10
 gi|209872993|gb|ACI92789.1| ribosomal protein L10 [Oligotropha carboxidovorans OM5]
          Length = 172

 Score =  149 bits (375), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 71/170 (41%), Positives = 106/170 (62%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M R  K   +  L   F S+G  +VAHY G++VAQ++ LR +M++AG  VKV+KNRL KI
Sbjct: 1   MERAAKKEAVDALKGTFQSTGVAIVAHYSGLTVAQMQTLRTQMKQAGASVKVSKNRLAKI 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A+  T +  I  L  G ++I  S+ PV APKI+V F+  N +F +LGG +   VLN D++
Sbjct: 61  ALEGTDVASIGSLLKGPTVIATSNDPVAAPKIAVEFAKTNEQFVILGGAMGTTVLNPDAV 120

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQ 170
           K +ASLP L+ +RA II  + + AT++ +L   P  +V R + A+  K +
Sbjct: 121 KALASLPSLDELRAKIIGLLVAPATKIAQLTNAPAAKVARVVQAYASKGE 170


>gi|298291425|ref|YP_003693364.1| ribosomal protein L10 [Starkeya novella DSM 506]
 gi|296927936|gb|ADH88745.1| ribosomal protein L10 [Starkeya novella DSM 506]
          Length = 172

 Score =  147 bits (371), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 66/170 (38%), Positives = 113/170 (66%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M+R  K   ++ L+++F+++  +VVAHY G++VAQ+ +LR++M+ +G  VKVAKNRL KI
Sbjct: 1   MDRAQKEELVTSLTEVFNTTSVVVVAHYSGLTVAQMSNLRRQMKASGATVKVAKNRLAKI 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A+  + +  ++ L  G ++I YS  PV APK++V F+  N++F +LGG   K  LN D +
Sbjct: 61  ALEGSEVAHVASLLKGPTIIAYSSDPVAAPKVAVDFAKANDKFVILGGAFGKTALNPDGV 120

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQ 170
           K +A++P L+ +RA +I  IQ+ AT++ +L   P  ++ R   A+  +N+
Sbjct: 121 KALATMPSLDELRAKLIGLIQAPATKIAQLSTAPAAKLARVFGAYGRENE 170


>gi|154247290|ref|YP_001418248.1| 50S ribosomal protein L10 [Xanthobacter autotrophicus Py2]
 gi|226700025|sp|A7IKP8|RL10_XANP2 RecName: Full=50S ribosomal protein L10
 gi|154161375|gb|ABS68591.1| ribosomal protein L10 [Xanthobacter autotrophicus Py2]
          Length = 172

 Score =  145 bits (367), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 66/170 (38%), Positives = 110/170 (64%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M+R  K   ++ L+ +F S+  +VVAHY G++VAQ+  LR++M+ +G  VKVAKNRL KI
Sbjct: 1   MDRAQKQELVTTLTDVFKSTSVVVVAHYSGLTVAQLSRLRRQMKASGATVKVAKNRLAKI 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A+  + +  +S L  G +LI YS  PV APK++V F+  N++F +LGG +    LN D +
Sbjct: 61  ALEGSDVAHVSSLLKGPTLIAYSSDPVAAPKVAVDFAKTNDKFVILGGAMGTTALNVDGV 120

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQ 170
           K +A+LP L+ +RA ++  IQ+ AT++ ++   P  ++ R   A+  +++
Sbjct: 121 KALATLPSLDELRAKLVGLIQAPATKIAQVTTAPAAKLARVFGAYAKQDE 170


>gi|92117082|ref|YP_576811.1| 50S ribosomal protein L10 [Nitrobacter hamburgensis X14]
 gi|122418100|sp|Q1QN46|RL10_NITHX RecName: Full=50S ribosomal protein L10
 gi|91799976|gb|ABE62351.1| LSU ribosomal protein L10P [Nitrobacter hamburgensis X14]
          Length = 172

 Score =  145 bits (367), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 68/170 (40%), Positives = 109/170 (64%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M R  K   +  L+++F ++G  VVAHY G++VAQ++ LR +M++AG  VKV+KNRL KI
Sbjct: 1   MERAAKKEAVEALNEVFKTTGVAVVAHYSGLTVAQMQKLRMQMKQAGASVKVSKNRLAKI 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A+  T +  I  L  G ++I  S+ PV APK++V F+  N  F +LGG + K VLN DS+
Sbjct: 61  ALEGTDVVAIGSLLKGPTVIATSNDPVAAPKVAVEFAKTNESFVILGGSMGKTVLNVDSV 120

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQ 170
           K +ASLP L+ +R  ++  + + AT++ +L   P  ++ R + A+  K++
Sbjct: 121 KALASLPSLDELRGKLVGLLVAPATKIAQLSTAPAAKLARVVQAYASKSE 170


>gi|170738712|ref|YP_001767367.1| 50S ribosomal protein L10 [Methylobacterium sp. 4-46]
 gi|226699977|sp|B0UHX8|RL10_METS4 RecName: Full=50S ribosomal protein L10
 gi|168192986|gb|ACA14933.1| ribosomal protein L10 [Methylobacterium sp. 4-46]
          Length = 175

 Score =  145 bits (365), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 65/167 (38%), Positives = 111/167 (66%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M+R  K+  ++ L+++FS++  +VVAHYKG++VA ++ LR++M++AG  VKVAKNRL  I
Sbjct: 1   MDRAAKADLVASLNEVFSTTSLVVVAHYKGLTVADMQKLRRQMKQAGATVKVAKNRLANI 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A+  T++  I  L  G +L+ YS  PV A K++V F+  N++  +LGG +    LN D +
Sbjct: 61  ALDGTNVASIKPLLKGPTLLAYSSDPVAAAKVAVDFAKGNDKLVILGGAMGATALNPDGV 120

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVD 167
           K +A+LP L+ +RA I+  +Q+ AT++ +++  P  ++ R   A+ D
Sbjct: 121 KALATLPSLDELRAKIVGLVQAPATKIAQVVNAPAAKLARVFGAYAD 167


>gi|299135270|ref|ZP_07028461.1| ribosomal protein L10 [Afipia sp. 1NLS2]
 gi|298590247|gb|EFI50451.1| ribosomal protein L10 [Afipia sp. 1NLS2]
          Length = 172

 Score =  145 bits (365), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 70/170 (41%), Positives = 105/170 (61%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M R  K   +  L   F S+G  VVAHY G++VAQ++ LR +M++AG  VKV+KNRL KI
Sbjct: 1   MERAAKKEAVDALKGTFKSTGVAVVAHYSGLTVAQMQILRTQMKQAGASVKVSKNRLAKI 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A+  T +  I  L  G ++I  S+ PV APKI+V F+  N +F +LGG +   VLN D++
Sbjct: 61  ALEGTDVASIGSLLKGPTVIATSNDPVAAPKIAVEFAKTNEKFVILGGAMGTTVLNTDAV 120

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQ 170
           K +ASLP L+ +R  I+  + + AT++ +L   P  +V R + A+  K +
Sbjct: 121 KALASLPSLDELRGKIVGLLVAPATKIAQLANAPAAKVARVVQAYASKGE 170


>gi|316933510|ref|YP_004108492.1| 50S ribosomal protein L10 [Rhodopseudomonas palustris DX-1]
 gi|315601224|gb|ADU43759.1| ribosomal protein L10 [Rhodopseudomonas palustris DX-1]
          Length = 172

 Score =  145 bits (365), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 66/170 (38%), Positives = 109/170 (64%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M R  K   +  L+ +F ++   +VAHY G++VAQ++ LR++M++AG  VKV+KNRL KI
Sbjct: 1   MERAAKKEAVESLNGLFQTTSVAIVAHYSGLTVAQMQKLRQQMKQAGASVKVSKNRLAKI 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A+  T +  I  L  G ++I  S  PV APK++V F+  N +F +LGG + K VLN D +
Sbjct: 61  ALEGTDVAAIGSLLKGPTVIATSSDPVAAPKVAVEFAKANEKFVILGGSMGKTVLNVDGV 120

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQ 170
           K +ASLP L+ +RA ++  +Q+ AT++ ++   P  ++ R + A+  K++
Sbjct: 121 KALASLPSLDELRAKLVGLVQAPATKIAQVTTAPAAKLARVVQAYASKSE 170


>gi|188583686|ref|YP_001927131.1| 50S ribosomal protein L10 [Methylobacterium populi BJ001]
 gi|226699975|sp|B1ZGR8|RL10_METPB RecName: Full=50S ribosomal protein L10
 gi|179347184|gb|ACB82596.1| ribosomal protein L10 [Methylobacterium populi BJ001]
          Length = 172

 Score =  143 bits (360), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 65/170 (38%), Positives = 110/170 (64%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M+R  K+  +S L+ +F+++  +VVAHYKG++VA ++ LR +M++AG  VKVAKNRL  I
Sbjct: 1   MDRTAKADLVSTLNGVFTTNAVVVVAHYKGLTVADMQKLRSQMKQAGATVKVAKNRLASI 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A+  T +  I  L  G +L+ YS  PV A K++V F+  N++  +LGG +    LN D +
Sbjct: 61  ALDGTDVASIKPLLKGPTLLAYSSDPVAAAKVAVDFAKTNDKLVILGGAMGTTALNPDGV 120

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQ 170
           K +A+LP L+ +RA ++  IQ+ AT++ +++  P  ++ R   A+  K++
Sbjct: 121 KALATLPSLDELRAKLVGLIQAPATKVAQVVNAPAAKLARVFGAYAKKDE 170


>gi|170750239|ref|YP_001756499.1| ribosomal protein L10 [Methylobacterium radiotolerans JCM 2831]
 gi|226699976|sp|B1LY45|RL10_METRJ RecName: Full=50S ribosomal protein L10
 gi|170656761|gb|ACB25816.1| ribosomal protein L10 [Methylobacterium radiotolerans JCM 2831]
          Length = 172

 Score =  142 bits (359), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 67/170 (39%), Positives = 110/170 (64%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M+R  K+  +S L+ +F+ S  +VVAHYKG++VA ++ LR +M++AG  VKVAKN L  I
Sbjct: 1   MDRTAKADLVSTLNGVFNESAVVVVAHYKGLTVADMQKLRAQMKQAGATVKVAKNSLAGI 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A+  T +  I  L  G +L+ YS  PV A K++V F+  N++  +LGG + K  LN D +
Sbjct: 61  ALDGTDVASIKPLLKGPTLLAYSGDPVAAAKVAVDFAKANDKLVILGGAMGKTALNPDGV 120

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQ 170
           K +ASLP L+ +RA I+  +Q+ AT++ +++  P +++ R   A+  K++
Sbjct: 121 KALASLPSLDELRAKIVGLVQAPATKIAQVVNAPASKLARVFGAYAKKDE 170


>gi|86749403|ref|YP_485899.1| 50S ribosomal protein L10 [Rhodopseudomonas palustris HaA2]
 gi|123408227|sp|Q2IXS2|RL10_RHOP2 RecName: Full=50S ribosomal protein L10
 gi|86572431|gb|ABD06988.1| LSU ribosomal protein L10P [Rhodopseudomonas palustris HaA2]
          Length = 172

 Score =  142 bits (359), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 68/170 (40%), Positives = 106/170 (62%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M R  K   +  L+ +F ++   VVAHY G++VAQ++ LR +M+ AG  VKV+KNRL KI
Sbjct: 1   MERAAKKEAVESLNGLFQTTSVAVVAHYSGLTVAQMQKLRSQMKAAGASVKVSKNRLAKI 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A+  T +  I  L  G ++I  SD PV APK++V F+  N +F +LGG + K VLN D +
Sbjct: 61  ALEGTDVVAIGSLLKGPTVIATSDDPVAAPKVAVEFAKANEKFVILGGSMGKTVLNVDGV 120

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQ 170
           K +ASLP L+ +R  ++  + + AT++ +L   P  +V R + A+  K++
Sbjct: 121 KALASLPSLDELRGKLVGLLVAPATKIAQLTTAPAAKVARVVQAYASKSE 170


>gi|220921889|ref|YP_002497190.1| 50S ribosomal protein L10 [Methylobacterium nodulans ORS 2060]
 gi|254798388|sp|B8IS75|RL10_METNO RecName: Full=50S ribosomal protein L10
 gi|219946495|gb|ACL56887.1| ribosomal protein L10 [Methylobacterium nodulans ORS 2060]
          Length = 175

 Score =  142 bits (359), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 65/167 (38%), Positives = 108/167 (64%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M+R  K+  ++ L+ +FS++  +VVAHYKG++VA ++ LR +M++AG  VKVAKNRL  I
Sbjct: 1   MDRAAKADLVATLNGVFSTTSLVVVAHYKGLTVADMQKLRSQMKQAGATVKVAKNRLANI 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A+  T +  I  L  G +L+ YS  PV A K++V F+  N++  +LGG +    LN D +
Sbjct: 61  ALDGTDVASIKPLLKGPTLLAYSSDPVAAAKVAVDFAKANDKLVILGGAMGATALNPDGV 120

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVD 167
           K +A+LP L+ +RA I+  +Q+ AT++ +++  P  ++ R   A+ D
Sbjct: 121 KALATLPSLDELRAKIVGLVQAPATKIAQVVNAPAAKLARVFGAYAD 167


>gi|161610770|ref|NP_948609.2| 50S ribosomal protein L10 [Rhodopseudomonas palustris CGA009]
 gi|192292059|ref|YP_001992664.1| 50S ribosomal protein L10 [Rhodopseudomonas palustris TIE-1]
 gi|226699994|sp|B3QC02|RL10_RHOPT RecName: Full=50S ribosomal protein L10
 gi|192285808|gb|ACF02189.1| ribosomal protein L10 [Rhodopseudomonas palustris TIE-1]
          Length = 172

 Score =  142 bits (359), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 65/170 (38%), Positives = 108/170 (63%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M R  K   +  L+ +F ++   +VAHY G++VAQ++ LR++M++AG  VKV+KNRL KI
Sbjct: 1   MERAAKKEAVESLNGLFQTTSVAIVAHYSGLTVAQMQKLRQQMKQAGASVKVSKNRLAKI 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A+  T +  I  L  G ++I  S  PV APK++V F+  N +F +LGG +   VLN D +
Sbjct: 61  ALEGTDVAAIGPLLKGPTVIATSSDPVAAPKVAVEFAKANEKFVILGGSMGTTVLNVDGV 120

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQ 170
           K +ASLP L+ +RA ++  +Q+ AT++ ++   P  ++ R + A+  K++
Sbjct: 121 KALASLPSLDELRAKLVGLVQAPATKIAQVTTAPAAKLARVVQAYASKSE 170


>gi|217979963|ref|YP_002364110.1| ribosomal protein L10 [Methylocella silvestris BL2]
 gi|254798390|sp|B8EMR9|RL10_METSB RecName: Full=50S ribosomal protein L10
 gi|217505339|gb|ACK52748.1| ribosomal protein L10 [Methylocella silvestris BL2]
          Length = 171

 Score =  142 bits (357), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 75/169 (44%), Positives = 118/169 (69%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M+R  K   +  LS++F S+  +VVAHY G++VAQ+++LRK+MR AG  V+VAKNRLVKI
Sbjct: 1   MDRAEKKECVESLSEVFKSTSVVVVAHYSGLTVAQMQNLRKQMRAAGAAVQVAKNRLVKI 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A+  + +  I+DL  G +LI YS  PV A K +V+F+ DN++  +LGG + K  LN D++
Sbjct: 61  ALEGSEVASIADLMRGPTLIAYSADPVAAAKAAVAFAKDNDKLVILGGAMGKTALNADAV 120

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKN 169
           K +A++P L+ +RA ++  IQ+ AT+L +L+  P  ++ R ISA+ +K+
Sbjct: 121 KSLATMPSLDELRAKLVGLIQAPATKLAQLVNAPAGKLARVISAYAEKD 169


>gi|91977665|ref|YP_570324.1| 50S ribosomal protein L10 [Rhodopseudomonas palustris BisB5]
 gi|123721724|sp|Q134R6|RL10_RHOPS RecName: Full=50S ribosomal protein L10
 gi|91684121|gb|ABE40423.1| LSU ribosomal protein L10P [Rhodopseudomonas palustris BisB5]
          Length = 172

 Score =  141 bits (355), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 67/170 (39%), Positives = 106/170 (62%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M R  K   +  L+ +F ++   VVAHY G++VAQ++ LR +M++AG  VKV+KNRL KI
Sbjct: 1   MERAAKKEAVESLNGLFQTTSVAVVAHYSGLTVAQMQKLRSQMKQAGASVKVSKNRLAKI 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A+  T +  I  L  G ++I  S  PV APK++V F+  N +F +LGG + K VLN D +
Sbjct: 61  ALEGTDVVAIGSLLKGPTVIATSSDPVAAPKVAVEFAKANEKFVILGGSMGKTVLNVDGV 120

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQ 170
           K +ASLP L+ +R  ++  + + AT++ +L   P  +V R + A+  K++
Sbjct: 121 KALASLPSLDELRGKLVGLLVAPATKIAQLTTAPAAKVARVVQAYASKSE 170


>gi|162139847|ref|YP_317961.2| 50S ribosomal protein L10 [Nitrobacter winogradskyi Nb-255]
 gi|97181798|sp|Q3SSY2|RL10_NITWN RecName: Full=50S ribosomal protein L10
          Length = 172

 Score =  140 bits (354), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 66/170 (38%), Positives = 108/170 (63%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M R  K   + +L++ F ++G  +VAHY G++VAQ++ LRK+M++AG  VKV+KNRL KI
Sbjct: 1   MERAAKKEAVEQLNETFRTTGVAIVAHYSGLTVAQMQTLRKQMKQAGASVKVSKNRLAKI 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A+  T +  I  L  G ++I  S  PV APK++V F+  N  F VLGG + K VL+ + +
Sbjct: 61  ALEGTDVVAIGSLLKGPTVIATSSDPVAAPKVAVEFAKTNENFVVLGGSMGKTVLDVNGV 120

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQ 170
           K +ASLP L+ +R  ++  + + AT++ +L   P  ++ R + A+  K++
Sbjct: 121 KALASLPSLDELRGKLVGLLVAPATKIAQLSTAPAAKLARVVQAYASKDE 170


>gi|61215041|sp|Q6N4R7|RL10_RHOPA RecName: Full=50S ribosomal protein L10; AltName: Full=RRP-L10
 gi|39650188|emb|CAE28711.1| 50S ribosomal protein L10 [Rhodopseudomonas palustris CGA009]
          Length = 186

 Score =  140 bits (353), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 64/170 (37%), Positives = 108/170 (63%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           + R  K   +  L+ +F ++   +VAHY G++VAQ++ LR++M++AG  VKV+KNRL KI
Sbjct: 15  VERAAKKEAVESLNGLFQTTSVAIVAHYSGLTVAQMQKLRQQMKQAGASVKVSKNRLAKI 74

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A+  T +  I  L  G ++I  S  PV APK++V F+  N +F +LGG +   VLN D +
Sbjct: 75  ALEGTDVAAIGPLLKGPTVIATSSDPVAAPKVAVEFAKANEKFVILGGSMGTTVLNVDGV 134

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQ 170
           K +ASLP L+ +RA ++  +Q+ AT++ ++   P  ++ R + A+  K++
Sbjct: 135 KALASLPSLDELRAKLVGLVQAPATKIAQVTTAPAAKLARVVQAYASKSE 184


>gi|161598430|ref|YP_168705.2| 50S ribosomal protein L10 [Ruegeria pomeroyi DSS-3]
 gi|97181979|sp|Q5LMQ3|RL10_SILPO RecName: Full=50S ribosomal protein L10
          Length = 172

 Score =  140 bits (352), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 64/170 (37%), Positives = 108/170 (63%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M+R  K   + EL +IF SSG +VVAHY G++VA+++DLR + REAGG V+VAKNRL KI
Sbjct: 1   MDRAQKEKVVEELGQIFESSGVVVVAHYAGLTVAEMQDLRARAREAGGSVRVAKNRLAKI 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A+       ++DL  G +++ YS+ PV A K++  F+ DN +F +LGG + +  L++  +
Sbjct: 61  ALEGKPCASMADLLTGMTVLTYSEDPVAAAKVAEGFAKDNKKFEILGGAMGENALDRAGV 120

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQ 170
           + ++ +P  E + A I+S I + A+ +   +G P + +   +S  ++K +
Sbjct: 121 EAVSKMPSREELIAQIVSCIGAPASNIAGAIGAPASNIAGILSTIIEKAE 170


>gi|83594029|ref|YP_427781.1| 50S ribosomal protein L10P [Rhodospirillum rubrum ATCC 11170]
 gi|97181901|sp|Q2RQV1|RL10_RHORT RecName: Full=50S ribosomal protein L10
 gi|83576943|gb|ABC23494.1| LSU ribosomal protein L10P [Rhodospirillum rubrum ATCC 11170]
          Length = 172

 Score =  139 bits (351), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 64/170 (37%), Positives = 103/170 (60%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           MNR+ K   +SEL+ +F  + + VV HYKG++VA+++ LRK MR AG   +V KNR+ ++
Sbjct: 1   MNREEKKELVSELNSLFGEASACVVTHYKGMTVAELEQLRKGMRAAGASFRVTKNRITRL 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A+ DT   G++DLF G + I  S  PV   K+ V F+  N +  +LGG ++  VL++  I
Sbjct: 61  ALADTPFEGLADLFTGPTAIAISKDPVAPAKVCVEFAKKNEKLVILGGAMQGNVLDKQGI 120

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQ 170
           + +A LP L+ +R  +I  I + ATR+  +   P  Q+ R  +A+  K +
Sbjct: 121 EALAKLPSLDELRGRLIGMITTPATRIAGVTQAPAAQLARVFNAYATKEE 170


>gi|74420410|gb|ABA04609.1| LSU ribosomal protein L10P [Nitrobacter winogradskyi Nb-255]
          Length = 230

 Score =  138 bits (348), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 65/170 (38%), Positives = 108/170 (63%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           + R  K   + +L++ F ++G  +VAHY G++VAQ++ LRK+M++AG  VKV+KNRL KI
Sbjct: 59  VERAAKKEAVEQLNETFRTTGVAIVAHYSGLTVAQMQTLRKQMKQAGASVKVSKNRLAKI 118

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A+  T +  I  L  G ++I  S  PV APK++V F+  N  F VLGG + K VL+ + +
Sbjct: 119 ALEGTDVVAIGSLLKGPTVIATSSDPVAAPKVAVEFAKTNENFVVLGGSMGKTVLDVNGV 178

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQ 170
           K +ASLP L+ +R  ++  + + AT++ +L   P  ++ R + A+  K++
Sbjct: 179 KALASLPSLDELRGKLVGLLVAPATKIAQLSTAPAAKLARVVQAYASKDE 228


>gi|115525598|ref|YP_782509.1| 50S ribosomal protein L10 [Rhodopseudomonas palustris BisA53]
 gi|122295397|sp|Q07KK5|RL10_RHOP5 RecName: Full=50S ribosomal protein L10
 gi|115519545|gb|ABJ07529.1| LSU ribosomal protein L10P [Rhodopseudomonas palustris BisA53]
          Length = 172

 Score =  138 bits (347), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 65/170 (38%), Positives = 107/170 (62%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M +  K   +  L+ +F ++   VVAHY G++VAQ++ LR +M+ AG  VKV+KNRL KI
Sbjct: 1   MEKAAKKEAVESLNGLFKTTSVAVVAHYSGLTVAQMQKLRSQMKLAGASVKVSKNRLAKI 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A+  T +  I  L  G ++I  S+ PV APK++V F+  N +F +LGG +   VLN D +
Sbjct: 61  ALEGTDVVAIGSLLKGPTVIATSNDPVAAPKVAVEFAKANEKFVILGGSMGTTVLNVDGV 120

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQ 170
           K +ASLP L+ +RA ++  + + AT++ +L   P +++ R + A+  K++
Sbjct: 121 KALASLPSLDELRAKLVGLLVAPATKIAQLTTAPASKLARVVQAYASKDE 170


>gi|162136027|ref|YP_533319.2| 50S ribosomal protein L10 [Rhodopseudomonas palustris BisB18]
          Length = 172

 Score =  137 bits (346), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 65/170 (38%), Positives = 106/170 (62%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M +  K   +  L+ +F ++   VVAHY G++VAQ++ LR +M+ AG  VKV+KNRL KI
Sbjct: 1   MEKAAKKEAVESLNGLFKTTSVAVVAHYSGLTVAQMQKLRTQMKLAGASVKVSKNRLAKI 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A+  T +  I  L  G ++I  SD PV APK++V F+  N +F +LGG +   VLN DS+
Sbjct: 61  ALEGTDVVAIGSLLKGPTVIATSDDPVAAPKVAVEFAKANEKFVILGGSMGTTVLNVDSV 120

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQ 170
           K +A+LP L+ +R  ++  + + AT++ +L   P  ++ R + A+  K++
Sbjct: 121 KALAALPSLDELRGKLVGLLVAPATKIAQLSTAPAAKLARVVQAYASKSE 170


>gi|56680069|gb|AAV96735.1| ribosomal protein L10 [Ruegeria pomeroyi DSS-3]
          Length = 182

 Score =  137 bits (344), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 63/170 (37%), Positives = 108/170 (63%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           ++R  K   + EL +IF SSG +VVAHY G++VA+++DLR + REAGG V+VAKNRL KI
Sbjct: 11  VDRAQKEKVVEELGQIFESSGVVVVAHYAGLTVAEMQDLRARAREAGGSVRVAKNRLAKI 70

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A+       ++DL  G +++ YS+ PV A K++  F+ DN +F +LGG + +  L++  +
Sbjct: 71  ALEGKPCASMADLLTGMTVLTYSEDPVAAAKVAEGFAKDNKKFEILGGAMGENALDRAGV 130

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQ 170
           + ++ +P  E + A I+S I + A+ +   +G P + +   +S  ++K +
Sbjct: 131 EAVSKMPSREELIAQIVSCIGAPASNIAGAIGAPASNIAGILSTIIEKAE 180


>gi|304391365|ref|ZP_07373307.1| 50S ribosomal protein L10 [Ahrensia sp. R2A130]
 gi|303295594|gb|EFL89952.1| 50S ribosomal protein L10 [Ahrensia sp. R2A130]
          Length = 171

 Score =  136 bits (343), Expect = 9e-31,   Method: Compositional matrix adjust.
 Identities = 67/169 (39%), Positives = 104/169 (61%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M+R  K   +SE+  + S +GS+VVA Y G++VA++ +LR   REAGG V+VAKNRLVK+
Sbjct: 1   MDRAEKRDFVSEMKDVLSGAGSVVVAQYTGLTVAEMTELRASAREAGGTVRVAKNRLVKL 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A+  +    + +   G +++VY++ PV APK +  F+  N++  VLGG +    L+ + +
Sbjct: 61  ALEGSDAAHMGEYLQGPTVLVYAEDPVAAPKAASDFAKKNDKLVVLGGAMGSTALDANGV 120

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKN 169
           K +ASLP L+ +R  +I  I + A R+  L   P TQV R I A+  K 
Sbjct: 121 KALASLPSLDELRGKLIGMITTPAQRIAVLTAAPATQVARVIGAYSSKE 169


>gi|161511094|ref|NP_772052.2| 50S ribosomal protein L10 [Bradyrhizobium japonicum USDA 110]
          Length = 172

 Score =  136 bits (342), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 66/170 (38%), Positives = 106/170 (62%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M R  K   + +L+ +F ++   VVA Y G++VAQ++ LR++M++AG  VKV+KNRL KI
Sbjct: 1   MERAAKKEAVEQLNGVFKTTSVAVVAQYSGLTVAQMQKLRQQMKQAGASVKVSKNRLAKI 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A+  T +  I  +  G ++I  S+ PV APK+++ F+  N +F ++GG + K VLN D +
Sbjct: 61  ALEGTDVVAIGPMLKGPTVIATSNDPVAAPKVAIEFAKANEKFVIVGGSMGKTVLNVDGV 120

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQ 170
           K +ASLP L+ +R  I+  I + AT+L +L   P  ++ R I A   K +
Sbjct: 121 KALASLPSLDELRGKIVGLIVAPATKLAQLANAPAGKLARVIQAHASKGE 170


>gi|260432418|ref|ZP_05786389.1| 50S ribosomal protein L10 [Silicibacter lacuscaerulensis ITI-1157]
 gi|260416246|gb|EEX09505.1| 50S ribosomal protein L10 [Silicibacter lacuscaerulensis ITI-1157]
          Length = 172

 Score =  135 bits (340), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 62/170 (36%), Positives = 106/170 (62%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M+R  K   + EL +IF SSG +VVAHY G++VA+++DLR + R+AGG V+VAKNRL KI
Sbjct: 1   MDRAQKEKVVEELGQIFESSGVVVVAHYAGLTVAEMQDLRARARDAGGSVRVAKNRLAKI 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A+       I+DL  G +++ YS+ PV A K++  F+ +N +F +LGG + +  L++  +
Sbjct: 61  ALEGKPCASIADLLTGMTVLTYSEDPVAAAKVAEDFAKENKKFEILGGAMGENALDRKGV 120

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQ 170
           + ++ +P  E + A I+  I + A+ +   +G P + +   +S   +K +
Sbjct: 121 EAVSKMPSREELIASIVGCIGAPASNIAGAIGAPASNIASILSTIEEKAE 170


>gi|90106963|gb|ABD89000.1| LSU ribosomal protein L10P [Rhodopseudomonas palustris BisB18]
          Length = 192

 Score =  135 bits (339), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 64/170 (37%), Positives = 106/170 (62%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           + +  K   +  L+ +F ++   VVAHY G++VAQ++ LR +M+ AG  VKV+KNRL KI
Sbjct: 21  VEKAAKKEAVESLNGLFKTTSVAVVAHYSGLTVAQMQKLRTQMKLAGASVKVSKNRLAKI 80

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A+  T +  I  L  G ++I  SD PV APK++V F+  N +F +LGG +   VLN DS+
Sbjct: 81  ALEGTDVVAIGSLLKGPTVIATSDDPVAAPKVAVEFAKANEKFVILGGSMGTTVLNVDSV 140

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQ 170
           K +A+LP L+ +R  ++  + + AT++ +L   P  ++ R + A+  K++
Sbjct: 141 KALAALPSLDELRGKLVGLLVAPATKIAQLSTAPAAKLARVVQAYASKSE 190


>gi|259416746|ref|ZP_05740666.1| 50S ribosomal protein L10 [Silicibacter sp. TrichCH4B]
 gi|259348185|gb|EEW59962.1| 50S ribosomal protein L10 [Silicibacter sp. TrichCH4B]
          Length = 172

 Score =  134 bits (338), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 61/170 (35%), Positives = 106/170 (62%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M+R  K   + EL +IF SSG +VVAHY G++VA+++DLR + R+AGG V+VAKNRL KI
Sbjct: 1   MDRAQKEKVVEELGQIFESSGVVVVAHYTGLTVAEMQDLRARARDAGGSVRVAKNRLAKI 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A+       ++DL  G +++ YS+ PV A K++  F+ +N +F +LGG + +  L++  +
Sbjct: 61  ALEGKPCENMADLLTGMTVLTYSEDPVAAAKVAEDFAKENKKFEILGGAMGENALDRAGV 120

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQ 170
           + ++ +P  E + A I+  I + A+ +   +G P + +   +S   +K +
Sbjct: 121 EAVSKMPSREELIASIVGCIGAPASNIAGAIGAPASNIASILSTIEEKAE 170


>gi|85715146|ref|ZP_01046130.1| Ribosomal protein L10 [Nitrobacter sp. Nb-311A]
 gi|85698061|gb|EAQ35934.1| Ribosomal protein L10 [Nitrobacter sp. Nb-311A]
          Length = 212

 Score =  134 bits (338), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 64/170 (37%), Positives = 106/170 (62%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           + R  K   + +L++ F ++   +VAHY G++VAQ++ LRK+M++AG  VKV+KNRL KI
Sbjct: 41  VERAAKKEAVEQLNETFRTTSVAIVAHYSGLTVAQMQTLRKQMKQAGASVKVSKNRLAKI 100

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A+  T +  I  L  G ++I  S  PV APK++V F+  N  F VLGG + K VL+ D +
Sbjct: 101 ALEGTDVVAIGSLLRGPTVIATSGDPVAAPKVAVEFAKTNENFVVLGGSMGKTVLDIDGV 160

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQ 170
           K +A+LP L+ +R  ++  + + AT++ +L   P  ++ R + A+  K +
Sbjct: 161 KALAALPSLDELRGKLVGLLVAPATKIAQLSTAPAAKLARVVQAYASKGE 210


>gi|99080073|ref|YP_612227.1| 50S ribosomal protein L10 [Ruegeria sp. TM1040]
 gi|122398438|sp|Q1GK51|RL10_SILST RecName: Full=50S ribosomal protein L10
 gi|99036353|gb|ABF62965.1| LSU ribosomal protein L10P [Ruegeria sp. TM1040]
          Length = 172

 Score =  134 bits (337), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 61/170 (35%), Positives = 106/170 (62%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M+R  K   + EL +IF SSG +VVAHY G++V++++DLR + R+AGG V+VAKNRL KI
Sbjct: 1   MDRAQKEKVVEELGQIFESSGVVVVAHYTGLTVSEMQDLRARARDAGGSVRVAKNRLAKI 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A+       +SDL  G +++ YS+ PV A K++  F+ +N +F +LGG + +  L++  +
Sbjct: 61  ALEGKPCESMSDLLTGMTVLTYSEDPVAAAKVAEDFAKENKKFEILGGAMGENALDRAGV 120

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQ 170
           + ++ +P  E + A I+  I + A+ +   +G P + +   +S   +K +
Sbjct: 121 EAVSKMPSREELIASIVGCIGAPASNIAGAIGAPASNIASILSTIEEKAE 170


>gi|61215285|sp|Q89J72|RL10_BRAJA RecName: Full=50S ribosomal protein L10
 gi|27353687|dbj|BAC50677.1| 50S ribosomal Protein L10 [Bradyrhizobium japonicum USDA 110]
          Length = 181

 Score =  134 bits (336), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 65/170 (38%), Positives = 106/170 (62%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           + R  K   + +L+ +F ++   VVA Y G++VAQ++ LR++M++AG  VKV+KNRL KI
Sbjct: 10  VERAAKKEAVEQLNGVFKTTSVAVVAQYSGLTVAQMQKLRQQMKQAGASVKVSKNRLAKI 69

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A+  T +  I  +  G ++I  S+ PV APK+++ F+  N +F ++GG + K VLN D +
Sbjct: 70  ALEGTDVVAIGPMLKGPTVIATSNDPVAAPKVAIEFAKANEKFVIVGGSMGKTVLNVDGV 129

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQ 170
           K +ASLP L+ +R  I+  I + AT+L +L   P  ++ R I A   K +
Sbjct: 130 KALASLPSLDELRGKIVGLIVAPATKLAQLANAPAGKLARVIQAHASKGE 179


>gi|126737162|ref|ZP_01752897.1| ribosomal protein L10 [Roseobacter sp. SK209-2-6]
 gi|126721747|gb|EBA18450.1| ribosomal protein L10 [Roseobacter sp. SK209-2-6]
          Length = 172

 Score =  133 bits (335), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 63/170 (37%), Positives = 105/170 (61%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M+R  K   + EL +IF SSG +VVAHY G++VA+++DLR + REAGG V+VAKNRL KI
Sbjct: 1   MDRAQKEKVVEELGQIFESSGVVVVAHYVGLTVAEMQDLRARAREAGGSVRVAKNRLAKI 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A+       +SDL  G +++ YS+ PV A K++  F+ +N +F +LGG + +  L++  +
Sbjct: 61  ALEGKPCESMSDLLTGMTVLTYSEDPVAAAKVAEDFAKENKKFEILGGAMGENALDRAGV 120

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQ 170
             ++ +P  + + A I S I + A+ +   +G P + +   +S   +K +
Sbjct: 121 TAVSKMPSRDELIAQIASCIGAPASNIAGAIGAPASNIASILSTIEEKAE 170


>gi|296533978|ref|ZP_06896495.1| 50S ribosomal protein L10 [Roseomonas cervicalis ATCC 49957]
 gi|296265691|gb|EFH11799.1| 50S ribosomal protein L10 [Roseomonas cervicalis ATCC 49957]
          Length = 190

 Score =  132 bits (333), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 64/170 (37%), Positives = 107/170 (62%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           ++R  K   ++ L+ +F+ +  ++VA  KG++VA + +LR++MR AG   KVAKNRL  +
Sbjct: 19  LDRTEKRAFVASLATVFAETNFVLVAQNKGMTVADVSNLRRQMRAAGATYKVAKNRLATL 78

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A+  T  +GIS L  G + + +S  PV   K +V F+  N++F +LGG +   +L+ D +
Sbjct: 79  ALDGTRFQGISPLLKGPTALAWSTDPVAVAKTAVEFAKGNDKFVILGGALGTQMLDADGV 138

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQ 170
           K +ASLP LE +RA ++  IQ+ ATR+  +L  P  QV R ++A+  K++
Sbjct: 139 KSLASLPSLEILRAKLLGLIQTPATRIAGVLQAPGGQVARVLAAYAKKDE 188


>gi|254512259|ref|ZP_05124326.1| ribosomal protein L10 [Rhodobacteraceae bacterium KLH11]
 gi|221535970|gb|EEE38958.1| ribosomal protein L10 [Rhodobacteraceae bacterium KLH11]
          Length = 172

 Score =  132 bits (333), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 61/170 (35%), Positives = 105/170 (61%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M+R  K   + EL +IF SSG +VV+HY G++VA+++DLR + REAGG V+VAKNRL KI
Sbjct: 1   MDRAQKEKVVEELGQIFESSGVVVVSHYAGLTVAEMQDLRARAREAGGSVRVAKNRLAKI 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A+       ++DL  G +++ YS+ PV A K++  F+ DN++F +LGG + +  L++  +
Sbjct: 61  ALEGKPCASMADLLTGMTVLTYSEDPVAAAKVAEGFAKDNDKFEILGGAMGENALDRAGV 120

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQ 170
             ++ +P  E + A I   + + A+ +   +G P + +   +S   +K +
Sbjct: 121 AAVSKMPSREELIATIAGMLGAPASNIAGAIGAPASNIASILSTIEEKAE 170


>gi|296444414|ref|ZP_06886379.1| ribosomal protein L10 [Methylosinus trichosporium OB3b]
 gi|296258061|gb|EFH05123.1| ribosomal protein L10 [Methylosinus trichosporium OB3b]
          Length = 173

 Score =  132 bits (332), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 70/169 (41%), Positives = 114/169 (67%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M+R  K   ++ L+++FS +  +VVAHY G++VAQ++ LRK+ RE+G  V+VAKNRL KI
Sbjct: 1   MDRAEKKQAVAALNEVFSKTPVVVVAHYSGLTVAQMQKLRKQARESGASVQVAKNRLAKI 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A+  TS+  I  L  G +LI YSD PV APK++ +F+ D+++F +LGG +    L+ D +
Sbjct: 61  ALDGTSVASIGSLMKGPTLIAYSDDPVAAPKVAAAFAKDHDKFVILGGALGATALDVDGV 120

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKN 169
           K +A+LP L+ +R  ++  IQ+ AT+L +L   P  ++ R + A+ D++
Sbjct: 121 KSLATLPSLDELRGKLVGLIQAPATKLAQLTTAPAGKLARVVQAYADRD 169


>gi|254470137|ref|ZP_05083541.1| ribosomal protein L10 [Pseudovibrio sp. JE062]
 gi|211960448|gb|EEA95644.1| ribosomal protein L10 [Pseudovibrio sp. JE062]
          Length = 182

 Score =  132 bits (331), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 70/170 (41%), Positives = 112/170 (65%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           + R  K   +S+ +++ S++G  VVAHY G+SV+Q+  LR   REAGG VKVAKNRLVK+
Sbjct: 11  VERADKQKFVSDFNEVLSNTGVAVVAHYAGLSVSQMTQLRADAREAGGTVKVAKNRLVKL 70

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A++ T +  ISDLF G ++IVYSD PV APK + +F+  N +F +LGG +    L+   +
Sbjct: 71  ALQGTELEHISDLFKGPTVIVYSDDPVAAPKAAANFAKANEDFVILGGALGSTNLDTAGV 130

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQ 170
             +A++P L+ +R  ++  IQ+ A+R+ ++   P  Q+ R  +A+ +K+Q
Sbjct: 131 NALATMPSLDELRGKLVGMIQTPASRIAQVTSAPAGQLARVFNAYAEKDQ 180


>gi|89071239|ref|ZP_01158418.1| ribosomal protein L10 [Oceanicola granulosus HTCC2516]
 gi|89043225|gb|EAR49455.1| ribosomal protein L10 [Oceanicola granulosus HTCC2516]
          Length = 164

 Score =  132 bits (331), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 60/161 (37%), Positives = 102/161 (63%)

Query: 10  ISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRG 69
           + EL +IF SSG +VVAHY+G++VA+++DLR +MR+AGG V+VAKNRL KIA+       
Sbjct: 2   VEELGQIFESSGVVVVAHYEGLTVAEMQDLRARMRDAGGSVRVAKNRLAKIALDGKPCEN 61

Query: 70  ISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASLPDL 129
           I+D   G +++ YS+ PV A K+ V ++ DN++  +LGG + +  L+   +K ++ +P  
Sbjct: 62  IADFLTGMTVLSYSEDPVAAAKVVVQYAKDNDKLVILGGAMGETALDPAGVKAVSEMPSR 121

Query: 130 EGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQ 170
           E + A I+  I + A+ +   +G P + +   +S   +K +
Sbjct: 122 EELIASIVGCIGAPASNIAGAIGAPASNIASILSTIEEKAE 162


>gi|312115367|ref|YP_004012963.1| ribosomal protein L10 [Rhodomicrobium vannielii ATCC 17100]
 gi|311220496|gb|ADP71864.1| ribosomal protein L10 [Rhodomicrobium vannielii ATCC 17100]
          Length = 175

 Score =  131 bits (330), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 64/171 (37%), Positives = 111/171 (64%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M+R  K   +  L+ IF++SGS+VVA YKG++VAQ+ +LR++M  AG   KV KNRL KI
Sbjct: 1   MDRAEKKEMVETLNDIFTTSGSVVVARYKGLTVAQMTELRRRMGGAGAQFKVIKNRLAKI 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A+ +T+    +DLF+  + I ++  PV A K++  F+   ++F ++GG++ K  L+ DS+
Sbjct: 61  ALANTADGAGADLFLEPTGIAFAKDPVTAAKVAADFAKTTDKFVIVGGLLGKQALDADSV 120

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQQ 171
           K +A++P +E +R+ ++S   +  T LVR L  P   +V  ++A+ +K ++
Sbjct: 121 KALAAIPSMEELRSKLLSVFLAPGTNLVRQLNAPAQNLVGVLAAYKEKQEK 171


>gi|254461454|ref|ZP_05074870.1| ribosomal protein L10 [Rhodobacterales bacterium HTCC2083]
 gi|206678043|gb|EDZ42530.1| ribosomal protein L10 [Rhodobacteraceae bacterium HTCC2083]
          Length = 171

 Score =  131 bits (329), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 62/168 (36%), Positives = 101/168 (60%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M+R  K   + EL +IF SSG +VVAHY G++VA ++DLR +  EAGG V+VAKNRL KI
Sbjct: 1   MDRAQKEKLVDELGQIFESSGVVVVAHYAGLTVANMQDLRARASEAGGAVRVAKNRLAKI 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A+       I+D   G +++ YS+ PV A K++  F+ +NN+F +LGG + +  L++  +
Sbjct: 61  ALEGKPCESIADYLSGMTVLTYSEDPVAAAKVAEDFAKENNKFEILGGAMGENALDRAGV 120

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDK 168
             ++ +P  + + A I   I + A+ +   +G P + +   +S   DK
Sbjct: 121 TAVSKMPSRDELIASIAGCIGAPASNIAGAIGAPASNIAGVLSTIEDK 168


>gi|157964204|ref|YP_001499028.1| 50S ribosomal protein L10 [Rickettsia massiliae MTU5]
 gi|166981705|sp|A8F0P5|RL10_RICM5 RecName: Full=50S ribosomal protein L10
 gi|157843980|gb|ABV84481.1| 50S ribosomal protein L10 [Rickettsia massiliae MTU5]
          Length = 169

 Score =  130 bits (328), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 63/169 (37%), Positives = 103/169 (60%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M R  K V + ++  I+  S SI++ HY G++V+Q+  LR+ ++    G KV KN L KI
Sbjct: 1   MLRSEKPVAVEDIVNIYKESPSIIITHYHGLTVSQVSSLRESLKSKEAGFKVVKNTLAKI 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A   T +  I++LF G + IVYS  PV   K+ V+F+  N+  +++GG+V+  VL++ SI
Sbjct: 61  AANQTGLDSIANLFAGPTAIVYSKEPVEMAKLVVNFAKANDNLKIIGGIVDNHVLDEHSI 120

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKN 169
           K+++ LP L  +R  I+  +Q+ AT++V +L  P + + R I A   KN
Sbjct: 121 KELSKLPALNELRGKIVGLLQAPATKVVGVLQAPSSSMARVIQAHASKN 169


>gi|15892102|ref|NP_359816.1| 50S ribosomal protein L10 [Rickettsia conorii str. Malish 7]
 gi|34580867|ref|ZP_00142347.1| 50S ribosomal protein L10 [Rickettsia sibirica 246]
 gi|229586377|ref|YP_002844878.1| 50S ribosomal protein L10 [Rickettsia africae ESF-5]
 gi|20139554|sp|Q92J88|RL10_RICCN RecName: Full=50S ribosomal protein L10
 gi|259645491|sp|C3PMH5|RL10_RICAE RecName: Full=50S ribosomal protein L10
 gi|15619226|gb|AAL02717.1| 50S ribosomal protein L10 [Rickettsia conorii str. Malish 7]
 gi|28262252|gb|EAA25756.1| 50S ribosomal protein L10 [Rickettsia sibirica 246]
 gi|228021427|gb|ACP53135.1| 50S ribosomal protein L10 [Rickettsia africae ESF-5]
          Length = 169

 Score =  130 bits (327), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 63/169 (37%), Positives = 102/169 (60%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M R  K V + ++  I+  S SI++ HY G++V+Q+  LR+ ++    G KV KN L KI
Sbjct: 1   MLRSEKPVAVEDIVNIYKESPSIIITHYHGLTVSQVSSLRESLKSKEAGFKVVKNTLAKI 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A   T +  I +LF G + IVYS  PV   K+ V+F+  N+  +++GG+V+  VL++ SI
Sbjct: 61  AANQTGLNSIVNLFAGPTAIVYSKEPVEMAKLVVNFAKANDNLKIIGGIVDNHVLDEHSI 120

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKN 169
           K+++ LP L  +R  I+  +Q+ AT++V +L  P + + R I A   KN
Sbjct: 121 KELSKLPTLNELRGKIVGLLQAPATKVVGVLQAPSSSMARVIQAHASKN 169


>gi|163853413|ref|YP_001641456.1| ribosomal protein L10 [Methylobacterium extorquens PA1]
 gi|218532272|ref|YP_002423088.1| 50S ribosomal protein L10 [Methylobacterium chloromethanicum CM4]
 gi|254563342|ref|YP_003070437.1| 50S ribosomal subunit protein L10 [Methylobacterium extorquens DM4]
 gi|226699973|sp|A9W8N6|RL10_METEP RecName: Full=50S ribosomal protein L10
 gi|254798387|sp|B7KN43|RL10_METC4 RecName: Full=50S ribosomal protein L10
 gi|163665018|gb|ABY32385.1| ribosomal protein L10 [Methylobacterium extorquens PA1]
 gi|218524575|gb|ACK85160.1| ribosomal protein L10 [Methylobacterium chloromethanicum CM4]
 gi|254270620|emb|CAX26623.1| 50S ribosomal subunit protein L10 [Methylobacterium extorquens DM4]
          Length = 172

 Score =  129 bits (325), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 66/170 (38%), Positives = 110/170 (64%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M+R  K+  +S L+ +F+++  +VVAHYKG++VA ++ LR +M++AG  VKVAKNRL  I
Sbjct: 1   MDRTAKADLVSTLNGVFNANAVVVVAHYKGLTVADMQKLRSQMKQAGATVKVAKNRLASI 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A+  T +  I  L  G +L+ YS  PV A K++V F+  N++  +LGG +    LN D +
Sbjct: 61  ALDGTDVASIKPLLKGPTLLAYSSDPVAAAKVAVDFAKTNDKLVILGGAMGTTALNPDGV 120

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQ 170
           K +ASLP L+ +RA ++  IQ+ AT++ +++  P  ++ R   A+  K++
Sbjct: 121 KALASLPSLDELRAKLVGLIQAPATKVAQVVNAPAAKLARVFGAYAKKDE 170


>gi|67459540|ref|YP_247164.1| 50S ribosomal protein L10 [Rickettsia felis URRWXCal2]
 gi|75536055|sp|Q4UKD2|RL10_RICFE RecName: Full=50S ribosomal protein L10
 gi|67005073|gb|AAY61999.1| 50S ribosomal protein L10 [Rickettsia felis URRWXCal2]
          Length = 169

 Score =  129 bits (325), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 62/169 (36%), Positives = 102/169 (60%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M R  K V + ++  I+  S S+++ HY G++V+Q+  LR  ++    G KV KN L KI
Sbjct: 1   MLRSEKPVAVEDIVNIYKESPSVIITHYHGLTVSQVSSLRDSLKSKEAGFKVVKNTLAKI 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A   T +  I++LF G + IVYS  PV   K+ V+F+  N+  +++GG+V+  VL++ SI
Sbjct: 61  AANQTGLDSIANLFAGPTAIVYSKEPVEMAKLVVNFAKANDNLKIIGGIVDNHVLDEHSI 120

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKN 169
           K+++ LP L  +R  I+  +Q+ AT++V +L  P + + R I A   KN
Sbjct: 121 KELSKLPSLNELRGKIVGLLQAPATKVVGVLQAPSSSMARVIQAHASKN 169


>gi|23012510|ref|ZP_00052577.1| COG0244: Ribosomal protein L10 [Magnetospirillum magnetotacticum
           MS-1]
          Length = 171

 Score =  129 bits (323), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 65/169 (38%), Positives = 100/169 (59%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M+R  K+  +  L       G +VV HY G++VA++ DLR KMR AG   KV KNRL K+
Sbjct: 1   MDRTQKTEWVGSLHGTLGDVGLVVVTHYMGLTVAEMTDLRGKMRAAGASFKVTKNRLTKL 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A+  T    I+DLFVG + I  S  PV A K+   ++  N++ ++LGG + K  L+ + +
Sbjct: 61  ALVGTEFESIADLFVGPTAIAVSRDPVAAAKVIADYAKTNDKLKILGGSLGKLRLDVNGV 120

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKN 169
           K +A+LP L+ +RA ++  I + ATR+  +L  P  Q+ R + A  DK+
Sbjct: 121 KALATLPSLDELRAKLLGMISTPATRIAGVLQAPAGQLARVLKAKADKD 169


>gi|255263416|ref|ZP_05342758.1| 50S ribosomal protein L10 [Thalassiobium sp. R2A62]
 gi|255105751|gb|EET48425.1| 50S ribosomal protein L10 [Thalassiobium sp. R2A62]
          Length = 189

 Score =  129 bits (323), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 61/168 (36%), Positives = 104/168 (61%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           ++R  K   + +L +IF SSG +VV+HY+G++VA+++DLR +MREAGG V+VAKN+L KI
Sbjct: 19  VDRAQKEQLVDDLGQIFESSGVVVVSHYEGLTVAEMQDLRAQMREAGGAVRVAKNKLAKI 78

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A+       I++   G +++ YS+ PV A K+   FS  N + ++LGG + +  L+   +
Sbjct: 79  ALEGKPCASIAEYLTGMTVLAYSEDPVAAAKVVQEFSKGNEKLQILGGAMGENALDVAGV 138

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDK 168
           K +A++P  E + A I+  I + A+ +   +G P + +   +S   DK
Sbjct: 139 KAVAAMPSREELIASIVGCIGAPASNIAGAIGAPASNIASILSTVEDK 186


>gi|83949809|ref|ZP_00958542.1| ribosomal protein L10 [Roseovarius nubinhibens ISM]
 gi|83837708|gb|EAP77004.1| ribosomal protein L10 [Roseovarius nubinhibens ISM]
          Length = 172

 Score =  128 bits (322), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 60/170 (35%), Positives = 104/170 (61%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M+R  K   + EL +IF SSG +VVAHY+G++VA+++DLR + REA   V+VAKNRL KI
Sbjct: 1   MDRAQKEKVVEELGQIFESSGVVVVAHYEGLTVAEMQDLRSRAREAEASVRVAKNRLAKI 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A+       I+D   G +++ +S+ PV A K++  F+ DN +F +LGG + +  L++  +
Sbjct: 61  ALDGKPCASIADYLSGMTVLTFSEDPVAAAKVAEGFAKDNKKFEILGGAMGENALDRAGV 120

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQ 170
           + ++ +P  E + A I+  I + A+ +   +G P + +   +S   +K +
Sbjct: 121 EAVSKMPSREELIASIVGCIAAPASNIAGAIGAPASNIASILSTIEEKAE 170


>gi|294012919|ref|YP_003546379.1| ribosomal protein L10 [Sphingobium japonicum UT26S]
 gi|292676249|dbj|BAI97767.1| ribosomal protein L10 [Sphingobium japonicum UT26S]
          Length = 171

 Score =  128 bits (322), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 66/169 (39%), Positives = 102/169 (60%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M+R  K+  +S L+   +  G +VV    G++VAQ   LR+KMREAGG  KV KNRL KI
Sbjct: 1   MDRNQKAEVVSALNAHLAEVGVVVVTRNLGLTVAQSTQLRQKMREAGGTYKVTKNRLAKI 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A+  T   GISDL  G   +  S  PV A K++V F+  N++  ++GG + + +LN + +
Sbjct: 61  ALEGTDYTGISDLLTGPVGLASSADPVAAAKVAVEFAKTNDKLEIVGGAMGEVLLNAEGV 120

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKN 169
           K +AS+P L+ +RA I+  + + AT+L  +   P  Q+ R  +A+ +KN
Sbjct: 121 KALASMPSLDELRAKIVGLLVAPATKLATVTQAPAAQLARVFNAYAEKN 169


>gi|89053057|ref|YP_508508.1| 50S ribosomal protein L10 [Jannaschia sp. CCS1]
 gi|122499579|sp|Q28UX9|RL10_JANSC RecName: Full=50S ribosomal protein L10
 gi|88862606|gb|ABD53483.1| LSU ribosomal protein L10P [Jannaschia sp. CCS1]
          Length = 170

 Score =  128 bits (322), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 66/168 (39%), Positives = 107/168 (63%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M+R  K   + EL +IF SSG +VVAHY+G++VA ++DLR ++R+AGG V+VAKN+L KI
Sbjct: 1   MDRAQKEKVVEELGQIFESSGVVVVAHYQGLTVANMQDLRGRVRDAGGAVRVAKNKLAKI 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A+  T + GISDL  G +++ YSD PV A K +  F+ +N+ + +LGG + + +L+ D +
Sbjct: 61  ALDGTDVAGISDLMTGMTVLAYSDDPVAAAKAADEFAKENDNYVILGGAMGENILDADGV 120

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDK 168
           K +A +P  E + + I   I + A  +   +G P + +   +S   +K
Sbjct: 121 KAVAKMPSREELISSIAGCIGAPAANIAGAIGAPASNIASVLSTIEEK 168


>gi|307293950|ref|ZP_07573794.1| ribosomal protein L10 [Sphingobium chlorophenolicum L-1]
 gi|306880101|gb|EFN11318.1| ribosomal protein L10 [Sphingobium chlorophenolicum L-1]
          Length = 171

 Score =  128 bits (322), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 65/169 (38%), Positives = 103/169 (60%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M+R  K+  +S L+   +  G +VV    G++VAQ   LR+KMR+AGG  KV KNRL KI
Sbjct: 1   MDRNQKAEVVSALNAYLADVGVVVVTRNLGLTVAQSTQLRQKMRDAGGTYKVTKNRLAKI 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A+  TS  GISDL  G   +  S  PV A K++V F+  N++  ++GG + + +LN + +
Sbjct: 61  ALEGTSYTGISDLLTGPVGLASSADPVAAAKVAVEFAKTNDKLEIVGGAMGEVLLNAEGV 120

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKN 169
           K +AS+P L+ +RA ++  + + AT+L  +   P  Q+ R  +A+ +KN
Sbjct: 121 KALASMPSLDELRAKLVGLLVAPATKLATVTQAPAAQLARVFNAYAEKN 169


>gi|159042821|ref|YP_001531615.1| 50S ribosomal protein L10 [Dinoroseobacter shibae DFL 12]
 gi|189040914|sp|A8LLK4|RL10_DINSH RecName: Full=50S ribosomal protein L10
 gi|157910581|gb|ABV92014.1| 50S ribosomal protein L10 [Dinoroseobacter shibae DFL 12]
          Length = 172

 Score =  128 bits (321), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 66/170 (38%), Positives = 110/170 (64%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M+R  K   + EL +IF SSG +VVAHY G++VA+++D R +MREAGG V+VAKNRL KI
Sbjct: 1   MDRAQKEKLVDELGQIFESSGVVVVAHYAGLTVAEMQDFRARMREAGGSVRVAKNRLAKI 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A++      I +L  G +++ YS+ PV A K++ +++ DN+++++LGG + +  L+Q  +
Sbjct: 61  ALQGKPNEKIGELLTGMTVLAYSEDPVAAAKVADAYAKDNSKYQILGGAMGEDYLDQAGV 120

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQ 170
           K +AS+P  E + A I S I + A+ +   +G P + +   +S   +K +
Sbjct: 121 KAVASMPSREELIAQIASCIGAPASNIAGAIGAPASNIASILSTIEEKAE 170


>gi|240140833|ref|YP_002965313.1| 50S ribosomal subunit protein L10 [Methylobacterium extorquens AM1]
 gi|240010810|gb|ACS42036.1| 50S ribosomal subunit protein L10 [Methylobacterium extorquens AM1]
          Length = 172

 Score =  128 bits (321), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 65/170 (38%), Positives = 110/170 (64%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M+R  K+  +S L+ +F+++  +VVAHYKG++VA ++ LR +M++AG  VKVAK+RL  I
Sbjct: 1   MDRTAKADLVSTLNGVFNANAVVVVAHYKGLTVADMQKLRSQMKQAGATVKVAKDRLASI 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A+  T +  I  L  G +L+ YS  PV A K++V F+  N++  +LGG +    LN D +
Sbjct: 61  ALDGTDVASIKPLLKGPTLLAYSSDPVAAAKVAVDFAKTNDKLVILGGAMGTTALNPDGV 120

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQ 170
           K +ASLP L+ +RA ++  IQ+ AT++ +++  P  ++ R   A+  K++
Sbjct: 121 KALASLPSLDELRAKLVGLIQAPATKVAQVVNAPAAKLARVFGAYAKKDE 170


>gi|254294449|ref|YP_003060472.1| ribosomal protein L10 [Hirschia baltica ATCC 49814]
 gi|254042980|gb|ACT59775.1| ribosomal protein L10 [Hirschia baltica ATCC 49814]
          Length = 171

 Score =  127 bits (320), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 62/169 (36%), Positives = 102/169 (60%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M+R GK   +  L  IF  +G+++V HY G++VA++ DLR K+   G  +KV KNRL KI
Sbjct: 1   MDRAGKIKALEMLKGIFGEAGAVIVTHYSGLTVAEMSDLRTKLAAEGASLKVIKNRLAKI 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A+       ++ +F G   I Y+  PV A K+  ++S DN +  ++GG++E  VL++  +
Sbjct: 61  ALDGRGGDELAGMFTGPVAIAYAPDPVSAAKVCAAYSKDNEKLVLVGGIMENDVLDKAKV 120

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKN 169
           + +A +P L+ +R  II  IQ+ AT++  +L  P  Q+ R ISA+  K+
Sbjct: 121 EALAKMPSLDQLRGKIIGVIQAPATKVAGVLQAPAGQLARVISAYSTKD 169


>gi|157803325|ref|YP_001491874.1| 50S ribosomal protein L10 [Rickettsia canadensis str. McKiel]
 gi|166230064|sp|A8EXK6|RL10_RICCK RecName: Full=50S ribosomal protein L10
 gi|157784588|gb|ABV73089.1| 50S ribosomal protein L10 [Rickettsia canadensis str. McKiel]
          Length = 169

 Score =  127 bits (320), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 62/169 (36%), Positives = 102/169 (60%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M R  KSV + ++  I+  S S+++ HY G++V+Q+  LR+ ++    G KV KN L KI
Sbjct: 1   MLRSEKSVAVEDIVNIYKESPSVIITHYHGLTVSQVSSLRESLKSQEAGFKVVKNTLAKI 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A   T +  I +LF G + I YS  PV   K+ V+F+  N+  +++GGVV+  VL++ SI
Sbjct: 61  AANQTGLNNIVELFAGPTAIAYSKEPVGMAKLVVNFAKANDNLKIIGGVVDNHVLDKHSI 120

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKN 169
           K+++ LP L  +R  I+  +Q+ AT+++ +L  P + + R I A   KN
Sbjct: 121 KELSKLPLLNELRGKIVELLQAPATKVLGVLQAPSSSMARVIQAHASKN 169


>gi|157828053|ref|YP_001494295.1| 50S ribosomal protein L10 [Rickettsia rickettsii str. 'Sheila
           Smith']
 gi|165932750|ref|YP_001649539.1| 50S ribosomal protein L10 [Rickettsia rickettsii str. Iowa]
 gi|166230065|sp|A8GQW2|RL10_RICRS RecName: Full=50S ribosomal protein L10
 gi|189040929|sp|B0BWA7|RL10_RICRO RecName: Full=50S ribosomal protein L10
 gi|157800534|gb|ABV75787.1| 50S ribosomal protein L10 [Rickettsia rickettsii str. 'Sheila
           Smith']
 gi|165907837|gb|ABY72133.1| LSU ribosomal protein L10P [Rickettsia rickettsii str. Iowa]
          Length = 169

 Score =  127 bits (320), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 63/169 (37%), Positives = 103/169 (60%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M R  K V + ++  I+  S SI++ HY G++V+Q+  LR+ ++    G KV KN L KI
Sbjct: 1   MLRSEKPVAVEDIVNIYKESPSIIITHYHGLTVSQVSVLREALKSKEAGFKVVKNTLAKI 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A   T +  I++LF G + IVYS  PV   K+ V+F+  N+  +++GG+V+  VL++ SI
Sbjct: 61  AANQTGLNSIANLFAGPTAIVYSKEPVEMAKLVVNFAKANDNLKIIGGIVDNHVLDEHSI 120

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKN 169
           K+++ L  L  +R  II  +Q+ AT++V +L  P + + R I A+  KN
Sbjct: 121 KELSKLLTLNELRGKIIGLLQAPATQVVGVLQAPSSSMARVIQAYASKN 169


>gi|51473337|ref|YP_067094.1| 50S ribosomal protein L10 [Rickettsia typhi str. Wilmington]
 gi|61214909|sp|Q68XN0|RL10_RICTY RecName: Full=50S ribosomal protein L10
 gi|51459649|gb|AAU03612.1| 50S ribosomal protein L10 [Rickettsia typhi str. Wilmington]
          Length = 169

 Score =  127 bits (320), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 61/169 (36%), Positives = 103/169 (60%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M R  K V + ++  I+  S S+++ HY G++V+Q+  LR+ ++    G KV KN L KI
Sbjct: 1   MLRSEKPVAVEDIVNIYKESPSVIITHYHGLTVSQVSSLREALKSKEVGFKVVKNTLAKI 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A + T +  I+DLF G S IVYS  PV   ++ V+F+N N+  +++GG+V+  +L+  +I
Sbjct: 61  AAKHTGLDSITDLFAGPSAIVYSKEPVEMARLVVNFANSNDNLKIIGGIVDNHILDTYAI 120

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKN 169
           K++A LP L  +R  I+  +Q+ AT++V +L    + + R I A   K+
Sbjct: 121 KELAKLPSLHELRGKIVGLLQAPATKVVGVLQATSSSIARVIHAHAIKH 169


>gi|239947113|ref|ZP_04698866.1| 50S ribosomal protein L10 [Rickettsia endosymbiont of Ixodes
           scapularis]
 gi|239921389|gb|EER21413.1| 50S ribosomal protein L10 [Rickettsia endosymbiont of Ixodes
           scapularis]
          Length = 169

 Score =  127 bits (318), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 61/169 (36%), Positives = 101/169 (59%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M R  K V + ++  I+  S S+++ HY G++V+Q+  LR+ ++    G KV KN L KI
Sbjct: 1   MLRSEKPVAVEDIVNIYKESPSVIITHYHGLTVSQVSSLRESLKSKEAGFKVVKNTLAKI 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A   T +  I++LF G + IVYS  PV   K+ V+F+  N   +++GG+V+  VL+++SI
Sbjct: 61  AANQTGLDSIANLFAGPTAIVYSKEPVEMAKLVVNFAKANYNLKIIGGIVDNHVLDENSI 120

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKN 169
           K+++ LP L  +R  I+  +Q+ AT+ V +   P + + R I A   KN
Sbjct: 121 KELSKLPSLNELRGKIVGLLQAPATKFVGVSQAPSSSMARVIQAHASKN 169


>gi|91205970|ref|YP_538325.1| 50S ribosomal protein L10 [Rickettsia bellii RML369-C]
 gi|157826666|ref|YP_001495730.1| 50S ribosomal protein L10 [Rickettsia bellii OSU 85-389]
 gi|122425303|sp|Q1RHC8|RL10_RICBR RecName: Full=50S ribosomal protein L10
 gi|166230063|sp|A8GV22|RL10_RICB8 RecName: Full=50S ribosomal protein L10
 gi|91069514|gb|ABE05236.1| 50S ribosomal protein L10 [Rickettsia bellii RML369-C]
 gi|157801970|gb|ABV78693.1| 50S ribosomal protein L10 [Rickettsia bellii OSU 85-389]
          Length = 169

 Score =  127 bits (318), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 63/169 (37%), Positives = 101/169 (59%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M R  K   + E++ I+  S S++VAHY G++V+++  LR+ ++    G KV KN L KI
Sbjct: 1   MLRSEKPEVVEEIASIYKDSPSVIVAHYHGLTVSEVNSLRESLKSKDAGFKVVKNTLAKI 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A     +  I  LF G + IVYS  PV   K+ V+F+  N   +++GG+V+K VLN+ SI
Sbjct: 61  AANKAGLDDIVSLFSGPTAIVYSKEPVEMAKLVVNFAKSNENLKIVGGIVDKQVLNEHSI 120

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKN 169
           K+++ LP L  +R+ I+  +Q+ AT++  +L  P + + R I A   KN
Sbjct: 121 KELSKLPSLNELRSKIVGLLQAPATKIAGVLQAPSSSLARVIQANASKN 169


>gi|119383497|ref|YP_914553.1| 50S ribosomal protein L10 [Paracoccus denitrificans PD1222]
 gi|166230043|sp|A1B013|RL10_PARDP RecName: Full=50S ribosomal protein L10
 gi|119373264|gb|ABL68857.1| LSU ribosomal protein L10P [Paracoccus denitrificans PD1222]
          Length = 171

 Score =  127 bits (318), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 59/158 (37%), Positives = 100/158 (63%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M+R  K   + EL +IF +SG +VVA Y+G++VA+++DLR +MR+AGG V+VAKNRL KI
Sbjct: 1   MDRAQKEQVVEELGQIFDASGVVVVARYEGMTVAEMQDLRAQMRDAGGSVRVAKNRLAKI 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A+       I+D   G +++ +SD PV A K++  ++  N++F +LGG +    L+   +
Sbjct: 61  ALDGKPCASIADYLTGMTVLAFSDDPVAAAKVADKYAKGNDKFVILGGAMGDTALDPAGV 120

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQV 158
           K +A +P  E + A I++ I + A+ +   +G P + +
Sbjct: 121 KAVAQMPSREELIASIVACIGAPASNIAGAIGAPASNI 158


>gi|296282028|ref|ZP_06860026.1| 50S ribosomal protein L10 [Citromicrobium bathyomarinum JL354]
          Length = 171

 Score =  127 bits (318), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 59/169 (34%), Positives = 104/169 (61%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M+R  K+  +++L+ +F+ +G +VV    G++VA+  DLR KMREAG   +VAKNRL KI
Sbjct: 1   MDRSQKTDAVAQLNNVFNEAGVVVVTRNLGLTVAESTDLRAKMREAGATYQVAKNRLAKI 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A++DT   GI +   G + + YS+ PV A K  V F+  N+   V+GG +   VL++  +
Sbjct: 61  ALKDTDYAGIEEYLSGPTALAYSEDPVAAAKAVVEFAKTNDRIEVVGGSMGSQVLDEAGV 120

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKN 169
           + +AS+P L+ +R  ++  + + AT++ +++  P  ++ R   A+  K+
Sbjct: 121 RALASMPSLDELRGKLVGLVNAPATKIAQVVNAPANKLARVFGAYAAKD 169


>gi|238650687|ref|YP_002916540.1| 50S ribosomal protein L10 [Rickettsia peacockii str. Rustic]
 gi|259645492|sp|C4K1P1|RL10_RICPU RecName: Full=50S ribosomal protein L10
 gi|238624785|gb|ACR47491.1| 50S ribosomal protein L10 [Rickettsia peacockii str. Rustic]
          Length = 169

 Score =  126 bits (317), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 62/169 (36%), Positives = 100/169 (59%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M R  K V + ++  I+  S SI++ HY G++V+Q+  LR+ ++    G KV KN L KI
Sbjct: 1   MLRSEKPVAVEDIVNIYKESPSIIITHYHGLTVSQVSSLRESLKSKEAGFKVVKNTLAKI 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A   T +  I++LF G + IVYS  PV   K+ V+F+  N+  +++GG+V+  VL++ SI
Sbjct: 61  AANQTGLNSIANLFAGPTAIVYSKEPVEMAKLVVNFAKANDNLKIIGGIVDNHVLDEHSI 120

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKN 169
           K  + LP L  +R  I+  +Q+ AT++V +L    + + R I A   KN
Sbjct: 121 KDFSKLPTLNELRGNIVGLLQAPATKVVGVLQATSSSMARVIQAHASKN 169


>gi|15604014|ref|NP_220529.1| 50S ribosomal protein L10 [Rickettsia prowazekii str. Madrid E]
 gi|6225955|sp|Q9ZE22|RL10_RICPR RecName: Full=50S ribosomal protein L10
 gi|3860705|emb|CAA14606.1| 50S RIBOSOMAL PROTEIN L10 (rplJ) [Rickettsia prowazekii]
 gi|292571732|gb|ADE29647.1| 50S ribosomal protein L10 [Rickettsia prowazekii Rp22]
          Length = 169

 Score =  126 bits (316), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 59/169 (34%), Positives = 104/169 (61%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M R  K V + ++  I+  S S+++ HY G++V+Q+  LR++++    G KV KN L KI
Sbjct: 1   MLRSEKPVAVEDIVNIYKESPSVIITHYHGLTVSQVSSLREELKSKEAGFKVVKNTLAKI 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A + T +  I++LF G + IVYS  PV   ++ V+F+N N+  +++GG+V+  +L+  SI
Sbjct: 61  AAKQTGLDSITNLFAGPTAIVYSKEPVEMARLVVNFANSNDNLKIIGGIVDNHILDAYSI 120

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKN 169
           K+++ LP L  +R  I+  +Q+ AT++V +L    + + R I A   K+
Sbjct: 121 KELSKLPSLHELRGKIVGLLQAPATKVVGVLQATSSSIARVIHAHAIKH 169


>gi|310817020|ref|YP_003964984.1| 50S ribosomal protein L10 [Ketogulonicigenium vulgare Y25]
 gi|308755755|gb|ADO43684.1| 50S ribosomal protein L10 [Ketogulonicigenium vulgare Y25]
          Length = 170

 Score =  126 bits (316), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 62/168 (36%), Positives = 102/168 (60%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M+R  K   + EL +IF  SG +VVA Y+G++VAQ++DLR KMR+ GG V+VAKN+L KI
Sbjct: 1   MDRAQKESLVEELGQIFERSGVVVVARYEGMTVAQMQDLRAKMRDVGGSVRVAKNKLAKI 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A++      I+D   G ++I YS+ PV A K+  +++  N++  +LGG +    L+   +
Sbjct: 61  ALQGKPCESIADYLTGMTVISYSEDPVAAAKVVDAYAKTNDKLVILGGAMGDSALDPAGV 120

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDK 168
           K +A LP  E + A ++S I + A+ +   +G P + +   +S   +K
Sbjct: 121 KAVAQLPSREELIAQVVSCIGAPASNIAGAIGAPASNIASILSTIEEK 168


>gi|149185494|ref|ZP_01863810.1| ribosomal protein L10 [Erythrobacter sp. SD-21]
 gi|148830714|gb|EDL49149.1| ribosomal protein L10 [Erythrobacter sp. SD-21]
          Length = 171

 Score =  126 bits (316), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 59/165 (35%), Positives = 104/165 (63%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M+R  K+  +++L+++F+ +G +VV    G++VAQ  +LR KMREAG   +VAKNRL K+
Sbjct: 1   MDRSQKADSVAQLNEVFNQAGVVVVTRNLGLTVAQSTELRTKMREAGASYQVAKNRLAKL 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A+  T   GI+D   G + + YS+ PV A K++V F+  N++  ++GG +    L++  +
Sbjct: 61  ALDGTDYTGIADHLSGPTGLAYSEDPVAAAKVAVEFAKTNDKLEIVGGSMGATALDEAGV 120

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAF 165
           K +AS+P L+ +R  I+  + + AT++VR +  P + + R   A+
Sbjct: 121 KALASMPSLDELRGTIVGLVNAPATKVVRTIKEPVSMLARVFGAY 165


>gi|332185506|ref|ZP_08387254.1| ribosomal L10 family protein [Sphingomonas sp. S17]
 gi|332014484|gb|EGI56541.1| ribosomal L10 family protein [Sphingomonas sp. S17]
          Length = 173

 Score =  125 bits (315), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 62/172 (36%), Positives = 105/172 (61%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M+R  K+  ++EL++ F+  G +V+    G++VAQ   LR KMREAG   KV+KNRL KI
Sbjct: 1   MDRDQKTQAVAELNRNFNEVGVVVITRNHGMTVAQSTALRTKMREAGATYKVSKNRLAKI 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A + T   G++D+  G   I  S  PV A K++V F+   ++F ++GG +   VL+   +
Sbjct: 61  AAQGTDYAGVADMLTGPVGIASSIDPVAAAKVAVEFAKTTDKFEIVGGSMGANVLDVAGV 120

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQQG 172
           + +A+LP L+ +RA ++  I + AT+L  +   P  Q+ R ++A+ DK+++ 
Sbjct: 121 QALATLPSLDELRAKLVGLIVAPATKLATITQAPAAQIARVLAAYADKDKEA 172


>gi|110681147|ref|YP_684154.1| 50S ribosomal protein L10 [Roseobacter denitrificans OCh 114]
 gi|163732878|ref|ZP_02140323.1| 50S ribosomal protein L10 [Roseobacter litoralis Och 149]
 gi|123172018|sp|Q160X5|RL10_ROSDO RecName: Full=50S ribosomal protein L10
 gi|109457263|gb|ABG33468.1| ribosomal protein L10, putative [Roseobacter denitrificans OCh 114]
 gi|161394238|gb|EDQ18562.1| 50S ribosomal protein L10 [Roseobacter litoralis Och 149]
          Length = 171

 Score =  125 bits (315), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 59/168 (35%), Positives = 103/168 (61%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M+R  K   + EL +IF SSG +VV+HY G++VA+++DLR + R+AGG V+VAKNRL KI
Sbjct: 1   MDRAQKEQLVDELGQIFESSGVVVVSHYAGLTVAEMQDLRARARDAGGSVRVAKNRLAKI 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A+       I+DL  G +++ +S+ PV A K++  ++ +N +F +LGG + +  L+   +
Sbjct: 61  ALEGKPCASIADLLTGMTVLTFSEDPVAAAKVAQDYAKENQKFVILGGAMGENALDAAGV 120

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDK 168
           + ++ +P  E + A I   + + A+ +   +G P + +   +S   DK
Sbjct: 121 EAVSKMPSREELIATIAGMLGAPASNIAGAIGAPASNIASILSTVEDK 168


>gi|326386254|ref|ZP_08207878.1| 50S ribosomal protein L10 [Novosphingobium nitrogenifigens DSM
           19370]
 gi|326209479|gb|EGD60272.1| 50S ribosomal protein L10 [Novosphingobium nitrogenifigens DSM
           19370]
          Length = 171

 Score =  125 bits (313), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 67/169 (39%), Positives = 108/169 (63%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M+R  K+  ++ L++IFS +G++V+    G++VAQ   LR K+REAG   KVAKNRL K+
Sbjct: 1   MDRSQKAESVAYLNEIFSEAGAVVITRNLGMTVAQSTALRTKIREAGATYKVAKNRLAKL 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           AI+ T+  GI DLF G + +  S  PV A K+ V F+   ++  +LGG +   VL+ D I
Sbjct: 61  AIQGTAYEGIGDLFTGPTAVAASADPVAAAKVIVEFAKTTDKIEILGGGMGSQVLDADGI 120

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKN 169
           K +A++P L+ +RA +I  IQ+ AT++ +L   P  ++ R  +A+ +K+
Sbjct: 121 KALATMPSLDELRAKLIGLIQAPATKIAQLTTAPAAKLARVFNAYAEKD 169


>gi|254465737|ref|ZP_05079148.1| ribosomal protein L10 [Rhodobacterales bacterium Y4I]
 gi|206686645|gb|EDZ47127.1| ribosomal protein L10 [Rhodobacterales bacterium Y4I]
          Length = 172

 Score =  125 bits (313), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 59/170 (34%), Positives = 103/170 (60%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M+R  K   + EL +IF SSG +VVAHY G++VA+++DLR + R+A   V+VAKNRL KI
Sbjct: 1   MDRAQKEKVVEELGQIFESSGVVVVAHYAGLTVAEMQDLRARARDANSSVRVAKNRLAKI 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A+       ++ L  G +++ YS+ PV A K++  F+ DN +F +LGG + +  L++  +
Sbjct: 61  ALEGKPCENMAGLLTGMTVLTYSEDPVSAAKVAEDFAKDNKKFEILGGAMGENALDRAGV 120

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQ 170
           + ++ +P  + + A I S I + A+ +   +G P + +   +S   +K +
Sbjct: 121 EAVSKMPSRDELIAQIASCIGAPASNIAGAIGAPASNIASILSTIEEKAE 170


>gi|329850783|ref|ZP_08265628.1| ribosomal protein L10 family protein [Asticcacaulis biprosthecum
           C19]
 gi|328841098|gb|EGF90669.1| ribosomal protein L10 family protein [Asticcacaulis biprosthecum
           C19]
          Length = 172

 Score =  125 bits (313), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 64/172 (37%), Positives = 108/172 (62%), Gaps = 2/172 (1%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M+R  K+  I EL  +F+SSG++VV  Y G++  ++ +LR ++R+ G  VKV KNRL + 
Sbjct: 1   MDRAQKAATIEELKGVFASSGAVVVTQYTGMTFVEMSELRNRLRKEGAVVKVFKNRLAQK 60

Query: 61  AIRDTSIRGISD-LFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
           A+ D S+    D LF G   +VYS  PV A KISV ++ +N++ +++GG++E  VL +  
Sbjct: 61  AL-DGSVGEKGDALFKGPVALVYSADPVTAAKISVQYAKENDKLKIIGGIMETDVLTEAG 119

Query: 120 IKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQQ 171
           ++ +A+LP L+ +R  +I  +Q+ AT++  +L  P   V R I A+  +N +
Sbjct: 120 VRSLATLPSLDELRGKLIGLLQAPATKIAGVLVAPAGAVARVIGAYARENAE 171


>gi|83312241|ref|YP_422505.1| 50S ribosomal protein L10 [Magnetospirillum magneticum AMB-1]
 gi|97181719|sp|Q2W2H9|RL10_MAGMM RecName: Full=50S ribosomal protein L10
 gi|82947082|dbj|BAE51946.1| Ribosomal protein L10 [Magnetospirillum magneticum AMB-1]
          Length = 171

 Score =  125 bits (313), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 62/169 (36%), Positives = 98/169 (57%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M+R  K+  +  L       G +VV HY G++VA++ DLR KMR AG   KV KNRL K+
Sbjct: 1   MDRTQKTEWVGSLQGTLGDVGLVVVTHYSGLTVAEMTDLRGKMRAAGASFKVTKNRLTKL 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A+  T    I+DLFVG + I  S  PV A K+   ++  N++ ++LGG +    L+ + +
Sbjct: 61  ALAGTEFESIADLFVGPTAIAVSRDPVAAAKVVADYAKANDKLKILGGSLGSLRLDVNGV 120

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKN 169
           K +A+LP L+ +R  ++  + + ATR+  +L  P  Q+ R + A  DK+
Sbjct: 121 KALATLPSLDELRGKLLGMLSTPATRIAGVLQAPAGQLARVLKAKADKD 169


>gi|126724851|ref|ZP_01740694.1| ribosomal protein L10 [Rhodobacterales bacterium HTCC2150]
 gi|126706015|gb|EBA05105.1| ribosomal protein L10 [Rhodobacterales bacterium HTCC2150]
          Length = 171

 Score =  124 bits (312), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 61/168 (36%), Positives = 100/168 (59%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M+R  K   + EL +IF SSG +VVAHY GI+VA+++DLR KM E GG V+VAKNRL KI
Sbjct: 1   MDRAQKEKVVEELGQIFESSGVVVVAHYAGITVAEMQDLRAKMSEVGGSVRVAKNRLAKI 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A+       I +   G +++ YS+ PV A K++V ++  N + ++LGG + +  L+   +
Sbjct: 61  ALEGKPCESIGEYLTGMTVLGYSEDPVAAAKVAVEYAKSNPKLQILGGSMGENALDPAGV 120

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDK 168
             ++ +P  + + A I+  I + A+ +   +G P + +   +S   DK
Sbjct: 121 VAVSKMPSRDELIASIVGCIGAPASNIAGAIGAPASNIAGILSEVEDK 168


>gi|163739423|ref|ZP_02146833.1| 50S ribosomal protein L10 [Phaeobacter gallaeciensis BS107]
 gi|163740211|ref|ZP_02147605.1| ribosomal protein L10 [Phaeobacter gallaeciensis 2.10]
 gi|161386069|gb|EDQ10444.1| ribosomal protein L10 [Phaeobacter gallaeciensis 2.10]
 gi|161387176|gb|EDQ11535.1| 50S ribosomal protein L10 [Phaeobacter gallaeciensis BS107]
          Length = 164

 Score =  124 bits (312), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 57/161 (35%), Positives = 100/161 (62%)

Query: 10  ISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRG 69
           + EL +IF SSG +VVAHY G++VA+++DLR +  +AG  V+VAKNRL KIA+       
Sbjct: 2   VEELGQIFESSGVVVVAHYTGLTVAEMQDLRARASDAGTSVRVAKNRLAKIALEGKPCEN 61

Query: 70  ISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASLPDL 129
           +SDL  G +++ YS+ PV A K++  F+ +N +F +LGG + +  L++  ++ ++ +P  
Sbjct: 62  MSDLLTGMTVLTYSEDPVSAAKVAEDFAKENKKFEILGGAMGENALDRAGVEAVSKMPSR 121

Query: 130 EGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQ 170
           + + A I S I + A+ +   +G P + +   +S   +K +
Sbjct: 122 DELIAQIASCIGAPASNIAGAIGAPASNIASILSTIEEKAE 162


>gi|126734763|ref|ZP_01750509.1| ribosomal protein L10, putative [Roseobacter sp. CCS2]
 gi|126715318|gb|EBA12183.1| ribosomal protein L10, putative [Roseobacter sp. CCS2]
          Length = 170

 Score =  124 bits (310), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 59/168 (35%), Positives = 101/168 (60%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M+R  K   + +L +IF SSG +VVAHY+G++VA+++DLR  MREAGG V+VAKN+L KI
Sbjct: 1   MDRAQKEQLVDDLGQIFESSGVVVVAHYEGMTVAEMQDLRAHMREAGGSVRVAKNKLAKI 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A+       I++   G +++ YS+ PV A K+   ++ +N++  +LGG +    L+   +
Sbjct: 61  ALEGKPCANIAEYLEGMTVLAYSEDPVAAAKVVDKYAKENDKLVILGGAMGDTALDVAGV 120

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDK 168
           K +A +P  E + A I+  I +  + +   +G P + +   +S   +K
Sbjct: 121 KAVAGMPSREELIASIVGCIGAPGSNIAGAIGAPASNIASVLSTIEEK 168


>gi|197104682|ref|YP_002130059.1| 50S ribosomal protein L10 [Phenylobacterium zucineum HLK1]
 gi|226699983|sp|B4R8K3|RL10_PHEZH RecName: Full=50S ribosomal protein L10
 gi|196478102|gb|ACG77630.1| 50S ribosomal protein L10 [Phenylobacterium zucineum HLK1]
          Length = 171

 Score =  124 bits (310), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 64/170 (37%), Positives = 105/170 (61%), Gaps = 2/170 (1%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M+R  K   I  L  +F+ SG++VV HY G++VA++ DLR K+RE G  +KV KN L + 
Sbjct: 1   MDRAQKQEAIEALKGVFADSGAVVVTHYLGLTVAEMTDLRGKLREQGAQLKVVKNTLAQK 60

Query: 61  AIRDTSIRGISD-LFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
           A+ D S+    D LF G   I ++  PV A K++  ++ DN++F V+GG++ + VL+Q  
Sbjct: 61  AL-DGSVGEAGDALFKGPVAIAFAPDPVSAAKVATQYAKDNDKFTVVGGLMGQQVLDQKG 119

Query: 120 IKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKN 169
           +  +A+LP L+ +R  II  +Q+ AT++  +L  P  Q+ R + A+  K+
Sbjct: 120 VSALATLPSLDQLRGKIIGLLQAPATKVAGVLQAPAGQLARVMGAYAAKD 169


>gi|86137183|ref|ZP_01055761.1| ribosomal protein L10 [Roseobacter sp. MED193]
 gi|85826507|gb|EAQ46704.1| ribosomal protein L10 [Roseobacter sp. MED193]
          Length = 185

 Score =  123 bits (309), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 58/170 (34%), Positives = 103/170 (60%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           ++R  K   + EL +IF SSG +VVAHY G++VA+++DLR +  +AG  V+VAKNRL KI
Sbjct: 14  VDRAQKEKLVEELGQIFESSGVVVVAHYAGLTVAEMQDLRARASDAGSAVRVAKNRLAKI 73

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A+       +S+L  G +++ YS+ PV A K++  F+ +N +F +LGG + +  L++  +
Sbjct: 74  ALEGKPCESMSNLLTGMTVLTYSEDPVAAAKVAEDFAKENKKFEILGGAMGENALDRAGV 133

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQ 170
             ++ +P  + + A I S I + A+ +   +G P + +   +S   +K +
Sbjct: 134 TAVSKMPSRDELIAQIASCIGAPASNIAGAIGAPASNIASILSTIEEKAE 183


>gi|387911|gb|AAA23000.1| ribosomal protein L10 [Brucella abortus]
          Length = 172

 Score =  123 bits (309), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 55/110 (50%), Positives = 81/110 (73%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           ++R  K   ++ L+  F  SGS+VVAHY G++VAQ+ DLR KMR+AGG VKVAKNRL KI
Sbjct: 35  VDRAEKREFVAWLNGAFKESGSVVVAHYTGLTVAQMSDLRSKMRDAGGSVKVAKNRLAKI 94

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVV 110
           A++ T   GI+DLF GQ+++ Y++ P+ APK++V F+  N++  +LGG +
Sbjct: 95  ALQGTESEGIADLFTGQTVVAYANDPITAPKVAVEFAKANDKLVILGGAM 144


>gi|77462249|ref|YP_351753.1| 50S ribosomal protein L10 [Rhodobacter sphaeroides 2.4.1]
 gi|126461111|ref|YP_001042225.1| 50S ribosomal protein L10 [Rhodobacter sphaeroides ATCC 17029]
 gi|126461125|ref|YP_001042239.1| 50S ribosomal protein L10 [Rhodobacter sphaeroides ATCC 17029]
 gi|97181908|sp|Q3J5T2|RL10_RHOS4 RecName: Full=50S ribosomal protein L10
 gi|77386667|gb|ABA77852.1| LSU ribosomal protein L10P [Rhodobacter sphaeroides 2.4.1]
 gi|126102775|gb|ABN75453.1| LSU ribosomal protein L10P [Rhodobacter sphaeroides ATCC 17029]
 gi|126102789|gb|ABN75467.1| LSU ribosomal protein L10P [Rhodobacter sphaeroides ATCC 17029]
          Length = 171

 Score =  123 bits (309), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 65/169 (38%), Positives = 106/169 (62%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M+R  K   + EL +IF SSG +VVAHY GI+VAQ++DLR +MRE GG V+VAKNRL KI
Sbjct: 1   MDRAQKEKVVEELGQIFESSGVVVVAHYAGITVAQMQDLRAQMREVGGSVRVAKNRLAKI 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A+       + DL  G +++ YS+ PV A K++ +++  N++F +LGG +   +L+   +
Sbjct: 61  ALAGKPSEKMGDLLTGMTVMAYSEDPVAAAKVADAYAKKNDKFVILGGAMGDTILDPAGV 120

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKN 169
           K +A++P  E + A I+S I + A+ +   +G P + +   +S   ++ 
Sbjct: 121 KTVAAMPSREELIAQIVSCIGAPASNIAGAIGAPASNIAGILSTLEERE 169


>gi|46203577|ref|ZP_00051320.2| COG0244: Ribosomal protein L10 [Magnetospirillum magnetotacticum
           MS-1]
          Length = 179

 Score =  123 bits (308), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 58/131 (44%), Positives = 87/131 (66%)

Query: 16  IFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRGISDLFV 75
           +F +S  +VVAHYKG++VA ++ LR +M++AG  VKVAKNRL  IA+  T +  I  L  
Sbjct: 1   MFDTSAVVVVAHYKGLTVADMQKLRSQMKQAGATVKVAKNRLASIALDGTDVASIKPLLK 60

Query: 76  GQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASLPDLEGIRAG 135
           G +L+ YS  PV A K++V F+  N++  +LGG +    LN D +K +ASLP L+ +RA 
Sbjct: 61  GPTLLAYSSDPVAAAKVAVDFAKTNDKLVILGGAMGTTALNPDGVKALASLPSLDELRAK 120

Query: 136 IISAIQSNATR 146
           ++  IQ+ AT+
Sbjct: 121 LVGLIQAPATK 131


>gi|84499873|ref|ZP_00998139.1| ribosomal protein L10 [Oceanicola batsensis HTCC2597]
 gi|84391807|gb|EAQ04075.1| ribosomal protein L10 [Oceanicola batsensis HTCC2597]
          Length = 162

 Score =  123 bits (308), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 58/159 (36%), Positives = 96/159 (60%)

Query: 10  ISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRG 69
           + EL +IF SSG +VVAHY G++VA+++ LR K REA   V+VAKNRL KIA+       
Sbjct: 2   VEELGQIFESSGVVVVAHYTGLTVAEMQTLRAKAREADASVRVAKNRLAKIALDGKPCES 61

Query: 70  ISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASLPDL 129
           I  L  G +++ YS+ PV A K++  F+ DN +F +LGG + +  L++  ++ ++ +P  
Sbjct: 62  IGSLLTGMTVLTYSEDPVAAAKVAEDFAKDNKKFEILGGSMGENALDRAGVEAVSKMPSR 121

Query: 130 EGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDK 168
           + + A I+  I + A+ +   +G P + +   +S   DK
Sbjct: 122 DELIASIVGCIGAPASNIAGAIGAPASNIASILSTIEDK 160


>gi|209964028|ref|YP_002296943.1| 50S ribosomal protein L10 [Rhodospirillum centenum SW]
 gi|226699993|sp|B6IRP4|RL10_RHOCS RecName: Full=50S ribosomal protein L10
 gi|209957494|gb|ACI98130.1| ribosomal protein L10 [Rhodospirillum centenum SW]
          Length = 172

 Score =  122 bits (307), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 59/170 (34%), Positives = 100/170 (58%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M+R  K   ++ L+     +G I+V    G++VA++ DLR+KMR AG   KV KNRL +I
Sbjct: 1   MDRTQKEATVAALNSSLQEAGLIIVTKQSGMTVAEVTDLRRKMRAAGCSFKVTKNRLARI 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A++ T    +   F G + I YS  PV A K++V ++  N++F+++GG +    L+   +
Sbjct: 61  ALKGTQFETLDGFFKGPTAIAYSKDPVAAAKVAVDYAKTNDKFQIVGGGLPGLKLDSQGV 120

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQ 170
             ++ LP L  +RA ++  IQ+ ATR+  +L  P  QV R ++A+  K++
Sbjct: 121 DALSKLPSLNELRASLLGMIQTPATRIAGVLQAPGGQVARVLAAYAKKDE 170


>gi|114771281|ref|ZP_01448701.1| ribosomal protein L10 [alpha proteobacterium HTCC2255]
 gi|114548206|gb|EAU51093.1| ribosomal protein L10 [alpha proteobacterium HTCC2255]
          Length = 170

 Score =  122 bits (306), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 57/168 (33%), Positives = 102/168 (60%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M+R  K   + EL +IF+ SG +VV+HY GI+VA+++D R +MR+ GG V+VAKN+L KI
Sbjct: 1   MDRAQKEALVKELGQIFTDSGVVVVSHYAGITVAEMQDFRSRMRDVGGSVRVAKNKLAKI 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A+       IS L  G +++ +S+ PV A K++  ++ +N++  +LGG +    L++  +
Sbjct: 61  ALEGKPCESISGLLDGMTVLSFSEDPVAAAKVTEEYAKENDKLVILGGSMGDNALDRAGV 120

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDK 168
           K +A++P  E + A I+  I + A+ +   +G P + +   +    +K
Sbjct: 121 KAVAAMPSREELIASIVGCIAAPASNIAGAVGAPASNIASILETIEEK 168


>gi|254439611|ref|ZP_05053105.1| ribosomal protein L10, putative [Octadecabacter antarcticus 307]
 gi|198255057|gb|EDY79371.1| ribosomal protein L10, putative [Octadecabacter antarcticus 307]
          Length = 171

 Score =  122 bits (306), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 59/168 (35%), Positives = 103/168 (61%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M+R  K   + +L +IF SSG +VV+HY+G++VA+++DLR +MREAGG V+VAKN+L KI
Sbjct: 1   MDRAQKEQLVEDLGQIFESSGVVVVSHYEGLTVAEMQDLRARMREAGGSVRVAKNKLAKI 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A+   +   I+    G +++ +S+ PV A K++  ++ DN +  +LGG +    L+   +
Sbjct: 61  ALEGKACASIAKHLDGMTVMTFSEDPVAAAKVTQGYAKDNEKLVILGGAMGDIDLDPAGV 120

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDK 168
           K ++ LP  E + A I+  I + A+ +   +G P + +   +S   +K
Sbjct: 121 KAVSELPSREELIASIVGCIAAPASNIAGAIGAPASNIASILSTIEEK 168


>gi|84685447|ref|ZP_01013345.1| ribosomal protein L10 [Maritimibacter alkaliphilus HTCC2654]
 gi|84666604|gb|EAQ13076.1| ribosomal protein L10 [Rhodobacterales bacterium HTCC2654]
          Length = 162

 Score =  122 bits (306), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 58/159 (36%), Positives = 97/159 (61%)

Query: 10  ISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRG 69
           + EL +IF SSG +VVAHY+G++VA+++DLR +MR+ GG V+VAKNRL KIA+       
Sbjct: 2   VEELGQIFESSGVVVVAHYEGLTVAEMQDLRAQMRDVGGSVRVAKNRLAKIALEGKPAAS 61

Query: 70  ISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASLPDL 129
           I+    G +++ YS+ PV A K+   ++ DN +  +LGG + +  L+   + ++A +P  
Sbjct: 62  IAQYLTGMTVLAYSEDPVAAAKVMDKYAKDNEKLVILGGAMGEEALDTAGVGRVAKMPSR 121

Query: 130 EGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDK 168
           E + A I S I + A+ +   +G P + +   +S   +K
Sbjct: 122 EELLAQIASCIGAPASNIAGAIGAPASNIASILSTIEEK 160


>gi|157825318|ref|YP_001493038.1| 50S ribosomal protein L10 [Rickettsia akari str. Hartford]
 gi|166230062|sp|A8GMA5|RL10_RICAH RecName: Full=50S ribosomal protein L10
 gi|157799276|gb|ABV74530.1| 50S ribosomal protein L10 [Rickettsia akari str. Hartford]
          Length = 169

 Score =  122 bits (305), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 60/169 (35%), Positives = 101/169 (59%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M R  K V + ++  I+  S SI++  Y G++V+Q+  LR+ ++    G KV KN L KI
Sbjct: 1   MLRSEKPVAVGDVVNIYKESPSIIITRYHGLTVSQVSSLRESLKSREAGFKVVKNTLAKI 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A + T +  I++LF G + IVYS  PV   K+ V+F+  N   +++GG+V+  VL++ SI
Sbjct: 61  AAKQTGLDSIANLFAGPTAIVYSKEPVEMAKLVVNFAKSNGNLKIVGGIVDNRVLDEYSI 120

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKN 169
           K+++ LP L  +R  I+  +Q+ +T++V +L  P   + R + A   KN
Sbjct: 121 KELSKLPSLNELRGKIVWLLQAPSTKVVGVLQAPSVSMARVLQAHASKN 169


>gi|114799263|ref|YP_761538.1| 50S ribosomal protein L10 [Hyphomonas neptunium ATCC 15444]
 gi|123128464|sp|Q0BYA5|RL10_HYPNA RecName: Full=50S ribosomal protein L10
 gi|114739437|gb|ABI77562.1| ribosomal protein L10 [Hyphomonas neptunium ATCC 15444]
          Length = 171

 Score =  121 bits (303), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 62/169 (36%), Positives = 99/169 (58%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M++ GKS  +  L  +F  +G +VV HY G++VA++  LR  +R+ G   KV KNRL KI
Sbjct: 1   MDKAGKSAALENLKGVFEGAGVVVVTHYAGLTVAEMTKLRGLLRKDGAHFKVVKNRLAKI 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A+         DLF G   I YS  PV A K +  FS +N++  ++G V+ + VL+   +
Sbjct: 61  ALGGVGGDKAQDLFQGPVAIAYSPDPVAAAKAADEFSRENSKLVIIGAVMGEQVLDAKGV 120

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKN 169
           + +A LP L+ +R  II  IQ+ AT++  ++  P +Q+ R +SA+  K+
Sbjct: 121 EALAKLPSLDQLRGKIIGVIQAPATKVAGVIQAPASQLARVVSAYASKD 169


>gi|254450050|ref|ZP_05063487.1| ribosomal protein L10 [Octadecabacter antarcticus 238]
 gi|198264456|gb|EDY88726.1| ribosomal protein L10 [Octadecabacter antarcticus 238]
          Length = 171

 Score =  121 bits (303), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 59/168 (35%), Positives = 102/168 (60%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M+R  K   + +L +IF SSG +VV+HY+G++VA+++DLR +MREAGG V+VAKN+L KI
Sbjct: 1   MDRAQKEQLVEDLGQIFESSGVVVVSHYEGLTVAEMQDLRARMREAGGSVRVAKNKLAKI 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A+       I+    G +++ +S+ PV A K++  ++ DN +  +LGG +    L+   +
Sbjct: 61  ALEGKPCASIAKHLDGMTVMTFSEDPVAAAKVTQGYAKDNEKLVILGGAMGDIDLDPAGV 120

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDK 168
           K ++ LP  E + A I+  I + A+ +   +G P + +   +S   +K
Sbjct: 121 KAVSELPSREELIASIVGCIAAPASNIAGAIGAPASNIASILSTIDEK 168


>gi|294085949|ref|YP_003552709.1| 50S ribosomal protein L10 [Candidatus Puniceispirillum marinum
           IMCC1322]
 gi|292665524|gb|ADE40625.1| Ribosomal protein L10 [Candidatus Puniceispirillum marinum
           IMCC1322]
          Length = 189

 Score =  121 bits (303), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 63/170 (37%), Positives = 100/170 (58%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           +NR  K+  I  L   F++S +IVV H  G++VA+  +LR KMREAG G KV KNR+ K+
Sbjct: 18  VNRTEKAELIETLQATFNASTTIVVTHQVGLTVAESGELRLKMREAGAGFKVTKNRIAKL 77

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A++DT    +  LF G + I  S  PV A K  V F+  N +  ++GG ++  VL++  +
Sbjct: 78  ALKDTRYEDLDSLFTGPTAIGTSQDPVAAAKTLVEFAKTNTKLTIIGGSIDGKVLDKSGV 137

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQ 170
           + +A LP L+ +R  ++  +Q+ A +L R+   P  ++ R I A  D+ Q
Sbjct: 138 EALAKLPSLDELRGKLVGLLQAPAGKLARVAQAPAGKLARVIKAREDQLQ 187


>gi|221638103|ref|YP_002524365.1| 50S ribosomal protein L10 [Rhodobacter sphaeroides KD131]
 gi|221158884|gb|ACL99863.1| 50S ribosomal protein L10 [Rhodobacter sphaeroides KD131]
          Length = 163

 Score =  120 bits (302), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 62/160 (38%), Positives = 102/160 (63%)

Query: 10  ISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRG 69
           + EL +IF SSG +VVAHY GI+VAQ++DLR +MRE GG V+VAKNRL KIA+       
Sbjct: 2   VEELGQIFESSGVVVVAHYAGITVAQMQDLRAQMREVGGSVRVAKNRLAKIALAGKPSEK 61

Query: 70  ISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASLPDL 129
           + DL  G +++ YS+ PV A K++ +++  N++F +LGG +   +L+   +K +A++P  
Sbjct: 62  MGDLLTGMTVMAYSEDPVAAAKVADAYAKKNDKFVILGGAMGDTILDPAGVKTVAAMPSR 121

Query: 130 EGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKN 169
           E + A I+S I + A+ +   +G P + +   +S   ++ 
Sbjct: 122 EELIAQIVSCIGAPASNIAGAIGAPASNIAGILSTLEERE 161


>gi|114570354|ref|YP_757034.1| 50S ribosomal protein L10P [Maricaulis maris MCS10]
 gi|122315778|sp|Q0ANP1|RL10_MARMM RecName: Full=50S ribosomal protein L10
 gi|114340816|gb|ABI66096.1| LSU ribosomal protein L10P [Maricaulis maris MCS10]
          Length = 171

 Score =  120 bits (301), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 62/168 (36%), Positives = 100/168 (59%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M+R  K   + EL+ IFS +GS+V+AHY G++VA++ +LR K+RE GG  KV +NRL KI
Sbjct: 1   MDRIQKEASVEELNGIFSEAGSVVMAHYNGMTVAEMTELRAKLRELGGTFKVVRNRLAKI 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A++     G +DLF G   I YS+  V APK+ V ++  N++  +LGG +E+ V +   I
Sbjct: 61  ALQGKPGEGAADLFTGPVAIAYSEDFVAAPKVLVEYAKSNDKLVILGGFMEEDVFDAAGI 120

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDK 168
             ++ +P  E + A I + +   A+++ + L  P   +  AI    +K
Sbjct: 121 DALSKMPSREELIATISARLMGQASQVAQRLMAPAQGLAGAIDVIREK 168


>gi|288957411|ref|YP_003447752.1| large subunit ribosomal protein L10 [Azospirillum sp. B510]
 gi|288909719|dbj|BAI71208.1| large subunit ribosomal protein L10 [Azospirillum sp. B510]
          Length = 173

 Score =  120 bits (300), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 57/171 (33%), Positives = 99/171 (57%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M+R  K   I+ L      +G +VV H+ G++V ++ DLR K+R AG   KV KNRL + 
Sbjct: 1   MDRTQKEATIAALQSKLQDTGLVVVTHHLGLTVKEVTDLRAKVRAAGASFKVTKNRLARR 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           +++ T   G+  LF G + I +S  PV A K+   ++  N + +++G  +   +L+ + +
Sbjct: 61  SLQGTQFEGLDGLFKGPTAIAFSKDPVAAAKVVADYAKTNEKLKIVGASLGTQILDAEGV 120

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQQ 171
           K +ASLP L+ +R  ++  IQ+ ATR+  +L  P  QV R ++A+  K+ +
Sbjct: 121 KALASLPSLDELRGRLVGMIQTPATRIAGVLQAPGGQVARVLAAYAKKDDE 171


>gi|258542019|ref|YP_003187452.1| 50S ribosomal protein L10 [Acetobacter pasteurianus IFO 3283-01]
 gi|329114224|ref|ZP_08242986.1| 50S ribosomal protein L10 [Acetobacter pomorum DM001]
 gi|256633097|dbj|BAH99072.1| LSU ribosomal protein L10P [Acetobacter pasteurianus IFO 3283-01]
 gi|256636154|dbj|BAI02123.1| LSU ribosomal protein L10P [Acetobacter pasteurianus IFO 3283-03]
 gi|256639209|dbj|BAI05171.1| LSU ribosomal protein L10P [Acetobacter pasteurianus IFO 3283-07]
 gi|256642263|dbj|BAI08218.1| LSU ribosomal protein L10P [Acetobacter pasteurianus IFO 3283-22]
 gi|256645318|dbj|BAI11266.1| LSU ribosomal protein L10P [Acetobacter pasteurianus IFO 3283-26]
 gi|256648373|dbj|BAI14314.1| LSU ribosomal protein L10P [Acetobacter pasteurianus IFO 3283-32]
 gi|256651426|dbj|BAI17360.1| LSU ribosomal protein L10P [Acetobacter pasteurianus IFO
           3283-01-42C]
 gi|256654417|dbj|BAI20344.1| LSU ribosomal protein L10P [Acetobacter pasteurianus IFO 3283-12]
 gi|326696300|gb|EGE47979.1| 50S ribosomal protein L10 [Acetobacter pomorum DM001]
          Length = 172

 Score =  120 bits (300), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 60/170 (35%), Positives = 96/170 (56%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           MNR  K   I+ L+ +F+ +  +VV    G++VA + +LR+K+R AG   KVAKNRL  +
Sbjct: 1   MNRTEKKAFIASLAAVFAQTSMVVVTRNDGLTVAAVTELRRKVRAAGANYKVAKNRLATL 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A+  T   GI+ L  G + + +S+ PV   K  V F+  N++  +LGG +   VL+ D I
Sbjct: 61  ALDGTQFNGIAPLLQGPTALAWSEDPVAVAKAVVEFAKTNDKLVLLGGSLGSQVLDADGI 120

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQ 170
           K +A LP L+ +RA ++  I + ATR+  +   P  Q+ R   A+    +
Sbjct: 121 KALAELPSLDALRAQLVGLISTPATRIASVTQAPAGQLARVFGAYAKTGE 170


>gi|260577194|ref|ZP_05845170.1| ribosomal protein L10 [Rhodobacter sp. SW2]
 gi|259020574|gb|EEW23894.1| ribosomal protein L10 [Rhodobacter sp. SW2]
          Length = 171

 Score =  120 bits (300), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 62/168 (36%), Positives = 106/168 (63%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M+R  K   + EL +IF+SSG +VVAHY GI+VAQ++DLR +MR  GG V+VAKN+L +I
Sbjct: 1   MDRAQKEKVVGELDQIFASSGVVVVAHYAGITVAQMQDLRAEMRAVGGSVRVAKNKLARI 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A+       + DL  G +++ YS+ PV A K++ +++  N++F +LGG +   +L+   +
Sbjct: 61  ALEGKPAAKMGDLLTGMTVMAYSEDPVAAAKVADAYAKKNDKFVILGGAMGDTILDPAGV 120

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDK 168
           K +AS+P  E + A I++ I + A+ +   +G P + +   +S   ++
Sbjct: 121 KAVASMPSREELIASIVACIGAPASSIAGAIGAPASNIASILSTIEER 168


>gi|148556379|ref|YP_001263961.1| 50S ribosomal protein L10 [Sphingomonas wittichii RW1]
 gi|166230075|sp|A5VC07|RL10_SPHWW RecName: Full=50S ribosomal protein L10
 gi|148501569|gb|ABQ69823.1| LSU ribosomal protein L10P [Sphingomonas wittichii RW1]
          Length = 171

 Score =  119 bits (299), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 60/169 (35%), Positives = 101/169 (59%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M+R  K+  +++L   F  +  ++V    G++VAQ   LR KMREAG   KV+KN+L +I
Sbjct: 1   MDRAQKAELVADLKSTFEGTSVVIVTRNLGLTVAQSTALRTKMREAGASYKVSKNKLARI 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A+  T+ + I+DL VG + +  S  PV   K+ V F+  N++  ++GG + + VL+   +
Sbjct: 61  ALEGTTYQAINDLLVGPTALATSADPVAPAKVIVDFAKTNDKLEIVGGAMGETVLDVAGV 120

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKN 169
           K +A LP L+ +RA I+  IQ+ AT++V+++  P  Q+ R   A+  K 
Sbjct: 121 KALAELPSLDELRAKIVGLIQAPATKVVQIVQAPAGQLARVFGAYAAKE 169


>gi|146278578|ref|YP_001168737.1| 50S ribosomal protein L10 [Rhodobacter sphaeroides ATCC 17025]
 gi|166230061|sp|A4WVL8|RL10_RHOS5 RecName: Full=50S ribosomal protein L10
 gi|145556819|gb|ABP71432.1| LSU ribosomal protein L10P [Rhodobacter sphaeroides ATCC 17025]
          Length = 171

 Score =  119 bits (298), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 62/169 (36%), Positives = 106/169 (62%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M+R  K   + EL +IF SSG +VVAHY G++VAQ+++LR +MR+ GG V+VAKNRL KI
Sbjct: 1   MDRAQKEKVVEELGQIFESSGVVVVAHYAGVTVAQMQELRAQMRDVGGSVRVAKNRLAKI 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A+       + DL  G +++ YS+ PV A K++ +++  N++F +LGG +   +L+   +
Sbjct: 61  ALAGKPSEKMGDLLTGMTVMAYSEDPVAAAKVAEAYAKKNDKFVILGGAMGDTILDPAGV 120

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKN 169
           K +A++P  E + A I+S I + A+ +   +G P + +   +S   ++ 
Sbjct: 121 KTVAAMPSREELIAQIVSCIGAPASSIAGAIGAPASNIAGILSTLEERE 169


>gi|330814208|ref|YP_004358447.1| LSU ribosomal protein L10P [Candidatus Pelagibacter sp. IMCC9063]
 gi|327487303|gb|AEA81708.1| LSU ribosomal protein L10P [Candidatus Pelagibacter sp. IMCC9063]
          Length = 170

 Score =  119 bits (298), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 58/154 (37%), Positives = 97/154 (62%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           MNR+ KS  +S L +  +++ ++++ HY G++V Q+ DLR +MREAG  +KV KNR+ KI
Sbjct: 1   MNREQKSSYVSSLKESLNNNEAMMIYHYHGLNVNQLDDLRNQMREAGALLKVTKNRITKI 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A++DT       LF GQ+ +  S  P+   K  V+F   N+  +++GGV++  VL  + +
Sbjct: 61  ALKDTQHEEAISLFSGQTGVALSKDPITLAKTLVNFQKKNDMLKIVGGVMDSKVLAPEDV 120

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTP 154
            +IA+LP L+  RA I + +Q+ A +L+ +L  P
Sbjct: 121 AKIATLPTLDEARAKIAAILQTPAQQLISILLAP 154


>gi|315499736|ref|YP_004088539.1| ribosomal protein l10 [Asticcacaulis excentricus CB 48]
 gi|315417748|gb|ADU14388.1| ribosomal protein L10 [Asticcacaulis excentricus CB 48]
          Length = 172

 Score =  119 bits (297), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 57/170 (33%), Positives = 106/170 (62%), Gaps = 1/170 (0%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M+R  K+  I EL  +F+ SGS+VVA Y G++  ++ DLR ++R+ G  ++V KNRL + 
Sbjct: 1   MDRAKKAESIEELKSVFAESGSVVVAQYSGMTFVEMADLRLRLRKEGAVLRVFKNRLAQK 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVE-KGVLNQDS 119
           A+   +      LF   +++ Y++ PV A KI+  ++ +N++F+++GG++E   VL+ + 
Sbjct: 61  ALAGAAGEQGDALFKFPTVLAYANDPVTAAKIAAQYAKENDKFKIVGGIMEGTTVLDANG 120

Query: 120 IKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKN 169
           +K +A+LP L+ +R  +I  +Q+ AT++  +L  P  Q+ R  +A+  K 
Sbjct: 121 VKALATLPSLDELRGKLIGLLQAPATKVAGVLQAPAGQLARVFNAYATKE 170


>gi|103487186|ref|YP_616747.1| 50S ribosomal protein L10 [Sphingopyxis alaskensis RB2256]
 gi|122984979|sp|Q1GSF8|RL10_SPHAL RecName: Full=50S ribosomal protein L10
 gi|98977263|gb|ABF53414.1| LSU ribosomal protein L10P [Sphingopyxis alaskensis RB2256]
          Length = 171

 Score =  117 bits (294), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 59/165 (35%), Positives = 100/165 (60%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M+R  K+  +S L+   S++ S+V+    G++VAQ   LR++MR+AG   +V KNRL KI
Sbjct: 1   MDRAEKAEAVSSLNATLSNAASVVIVRNLGLTVAQSTVLRQQMRDAGANFRVTKNRLAKI 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A+  TS  GI +L  G + I  S  PV A KI+V F+  N++  ++GG +   +L+ + +
Sbjct: 61  ALDGTSYTGIGELLTGPTAIASSTDPVAAAKIAVEFAKTNDKLEIVGGGMGDVILDVEGV 120

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAF 165
           K +ASLP L+ +R  ++  +Q+ AT++ ++   P  Q+ R   A+
Sbjct: 121 KALASLPSLDELRGKLVGLLQAPATKVAQIAAAPAGQLARVFGAY 165


>gi|294675846|ref|YP_003576461.1| 50S ribosomal protein L10 [Rhodobacter capsulatus SB 1003]
 gi|294474666|gb|ADE84054.1| 50S ribosomal protein L10 [Rhodobacter capsulatus SB 1003]
          Length = 171

 Score =  117 bits (294), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 61/158 (38%), Positives = 101/158 (63%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M+R  K   + EL +IF SSG +VVA Y+G++VAQ++DLR KMR+ GG V+VAKN L KI
Sbjct: 1   MDRAQKEKVVEELGQIFESSGVVVVARYEGMTVAQMQDLRAKMRDVGGSVRVAKNTLAKI 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A+       ++ L  G +++ YS+ PV A K++ +++  N++F +LGG + K  L++  +
Sbjct: 61  ALEGKPCESMAKLLTGMTVLAYSEDPVAAAKVAEAYAKTNDKFDILGGAMGKDALDKAGV 120

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQV 158
           K +A++P  E + A I S I + A+ +   +G P + +
Sbjct: 121 KAVAAMPSREELIAQIASCIGAPASNIAGAIGAPASNI 158


>gi|254456076|ref|ZP_05069505.1| LSU ribosomal protein L10P [Candidatus Pelagibacter sp. HTCC7211]
 gi|207083078|gb|EDZ60504.1| LSU ribosomal protein L10P [Candidatus Pelagibacter sp. HTCC7211]
          Length = 173

 Score =  117 bits (293), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 52/151 (34%), Positives = 99/151 (65%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M +  K   ISE+S  F +S +++V HY+G+++ Q+ +LR +MRE G   K+ KNR+ K+
Sbjct: 2   MTKVQKKNYISEMSTQFENSKAVMVTHYQGLTMVQLDELRAQMREHGIIFKITKNRITKL 61

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A+ +T  + +SDLF G + + + +  +++ +I   F+ DN+  +++GG+++  VL+Q  +
Sbjct: 62  ALENTKCKELSDLFKGPTAVAFGEDAIMSARILSKFAKDNDSLKLIGGIMDNEVLDQAGV 121

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLL 151
           + +ASLP L+  RA I+  + + A++LV +L
Sbjct: 122 QNVASLPTLDEARANIVGILNAPASKLVSIL 152


>gi|114327209|ref|YP_744366.1| 50S ribosomal protein L10 [Granulibacter bethesdensis CGDNIH1]
 gi|114315383|gb|ABI61443.1| LSU ribosomal protein L10P [Granulibacter bethesdensis CGDNIH1]
          Length = 175

 Score =  116 bits (291), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 56/170 (32%), Positives = 98/170 (57%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           + R  K   ++ L+ +F+ +  +VV   KG++VA++ +LR+++R AG   KVAKNRL  +
Sbjct: 4   LERTEKREFVASLAAVFAETSIVVVTQNKGLTVAEVTELRRRVRAAGANYKVAKNRLANL 63

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A+  +   GI  L  G + + +S+ PV A K+ V F+  N++  +LGG +    L+   +
Sbjct: 64  ALEGSQFEGIKPLLKGPTALAWSEDPVAAAKVVVDFAKTNDKLAILGGSLGSQTLDASGV 123

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQ 170
           K +A LP L+ +RA ++  I + ATR+  +L  P  Q+ R   A+  K +
Sbjct: 124 KALADLPSLDTLRAQLVGLISTPATRIAGVLQAPAGQLARVFGAYSKKEE 173


>gi|254701985|ref|ZP_05163813.1| 50S ribosomal protein L10 [Brucella suis bv. 5 str. 513]
          Length = 96

 Score =  116 bits (291), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 52/96 (54%), Positives = 72/96 (75%)

Query: 1  MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
          M+R  K   ++ L+  F  SGS+VVAHY G++VAQ+ DLR KMR+AGG VKVAKNRL KI
Sbjct: 1  MDRAEKREFVAWLNGAFKESGSVVVAHYTGLTVAQMSDLRSKMRDAGGSVKVAKNRLAKI 60

Query: 61 AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSF 96
          A++ T   GI+DLF GQ+++ Y++ P+ APK++V F
Sbjct: 61 ALQGTESEGIADLFTGQTVVAYANDPITAPKVAVEF 96


>gi|148260947|ref|YP_001235074.1| ribosomal protein L10 [Acidiphilium cryptum JF-5]
 gi|166229696|sp|A5FZX3|RL10_ACICJ RecName: Full=50S ribosomal protein L10
 gi|146402628|gb|ABQ31155.1| LSU ribosomal protein L10P [Acidiphilium cryptum JF-5]
          Length = 174

 Score =  116 bits (291), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 56/170 (32%), Positives = 99/170 (58%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M+R  K   + +L+ +F+ +  +VV+   G++VA +  LR KMREAG   KVAKNRL  +
Sbjct: 1   MDRAQKREFVDQLAAVFAETSMVVVSRNDGLTVADVTALRVKMREAGAQYKVAKNRLAHL 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A+  T   G+  +  G + + +S  PV   K++V F+  N +F ++GG +   +L+   +
Sbjct: 61  ALEGTRFDGLKPMLKGPTALAWSQDPVAVAKVAVEFAKTNEKFVLVGGALGTQMLDASGV 120

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQ 170
           K +A LP L+ +RA ++  IQ+ AT++  +L  P  Q+ R  +A+   ++
Sbjct: 121 KALAELPSLDQLRAKLLGLIQAPATKVAGVLQAPAGQLARVFAAYARADE 170


>gi|37912999|gb|AAR05328.1| ribosomal protein L10 [uncultured marine alpha proteobacterium
           HOT2C01]
          Length = 168

 Score =  116 bits (290), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 60/168 (35%), Positives = 99/168 (58%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           MNR+ K + IS L  I S +  ++V HY+G+S+  + DLR +   +G  +KV KNRL K+
Sbjct: 1   MNREQKEIFISNLKNILSENRLVLVFHYRGMSMTDMTDLRVQSFNSGCNIKVTKNRLTKL 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A+  T    +S+LF G + I YS+ PV   K+  +F+ +N+   +LGG+++  +L  + I
Sbjct: 61  ALEGTDKSELSNLFDGPTAIAYSNDPVQLTKLLTNFAKNNSNLVILGGIMDNEILTVEKI 120

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDK 168
           + ++ LP LE IRA +I  I S A ++  +L  P   + R + A+  K
Sbjct: 121 EILSKLPSLEEIRAQLIGLISSPAQKIASVLTAPSGGLARILKAYSTK 168


>gi|144900871|emb|CAM77735.1| 50S ribosomal protein L10 [Magnetospirillum gryphiswaldense MSR-1]
          Length = 171

 Score =  115 bits (289), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 64/169 (37%), Positives = 98/169 (57%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M+R  K   +  L      +G +VV HY G++VA+I  LR KMR AG   KV KNRL K+
Sbjct: 1   MDRTQKKEWVGSLHGTLEGAGLVVVTHYSGLTVAEITALRGKMRAAGASFKVTKNRLTKL 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A+  T+   I+DLF G + I +S  PV A KI+  F+  N++ ++LGG +    L+   I
Sbjct: 61  ALEGTAYENIADLFTGPTAIAFSADPVAAAKIAAEFAKTNDKLKILGGSLGGQRLDVAGI 120

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKN 169
           + +A+LP L+ +R  ++  I + ATR+  +L  P  Q+ R + A  DK+
Sbjct: 121 QALATLPSLDELRGKLLGMISTPATRIAGVLQAPAGQLARVLKAKADKD 169


>gi|302382916|ref|YP_003818739.1| ribosomal protein L10 [Brevundimonas subvibrioides ATCC 15264]
 gi|302193544|gb|ADL01116.1| ribosomal protein L10 [Brevundimonas subvibrioides ATCC 15264]
          Length = 171

 Score =  115 bits (289), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 57/169 (33%), Positives = 99/169 (58%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M+R  K+  I  L  +F+ +GS+VVAH  G++VA+++DLR ++R AGG  KV KNRL   
Sbjct: 1   MDRAQKAESIESLKGVFAEAGSVVVAHNLGLTVAEMEDLRGRLRSAGGAFKVVKNRLALK 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A+          LF G   I Y+++P  A K+S  F+  N+ F ++GG + + V++   +
Sbjct: 61  ALEAAEGSEYHGLFKGPVGIAYAENPATAAKVSTEFAKGNDRFVIVGGFMGETVVDLKGV 120

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKN 169
           + ++ LP L+ IRA ++  + + AT++  ++  P  Q+ R  +A+  K 
Sbjct: 121 ESLSKLPTLDEIRASLLGLLNAPATKIAGVVQAPAAQLARVFNAYATKE 169


>gi|284444292|gb|ADB85801.1| 50S ribosomal protein L10 [Candidatus Liberibacter solanacearum]
 gi|284444296|gb|ADB85804.1| 50S ribosomal protein L10 [Candidatus Liberibacter solanacearum]
          Length = 83

 Score =  115 bits (289), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 54/81 (66%), Positives = 71/81 (87%)

Query: 91  KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASLPDLEGIRAGIISAIQSNATRLVRL 150
           KISV F+NDN++F +LGG++EK +L QDSIK+IASLP++E IR+GI+SAIQS+ATRLV L
Sbjct: 2   KISVGFANDNSQFEILGGILEKDILTQDSIKKIASLPNIEEIRSGILSAIQSSATRLVML 61

Query: 151 LGTPQTQVVRAISAFVDKNQQ 171
           L TPQ Q+VR +SAF +KN+Q
Sbjct: 62  LETPQNQIVRVLSAFEEKNRQ 82


>gi|218683241|gb|ACL00659.1| 50S ribosomal protein L10 [Candidatus Liberibacter sp. CA DP-1]
 gi|247797365|gb|ACT09141.1| 50S ribosomal protein L10 [Candidatus Liberibacter solanacearum]
 gi|247797368|gb|ACT09143.1| 50S ribosomal protein L10 [Candidatus Liberibacter solanacearum]
          Length = 83

 Score =  115 bits (288), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 54/81 (66%), Positives = 71/81 (87%)

Query: 91  KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASLPDLEGIRAGIISAIQSNATRLVRL 150
           KISV F+NDN++F +LGG++EK +L QDSIK+IASLP++E IR+GI+SAIQS+ATRLV L
Sbjct: 2   KISVGFANDNSQFEILGGILEKDMLTQDSIKKIASLPNIEEIRSGILSAIQSSATRLVML 61

Query: 151 LGTPQTQVVRAISAFVDKNQQ 171
           L TPQ Q+VR +SAF +KN+Q
Sbjct: 62  LETPQNQIVRVLSAFEEKNRQ 82


>gi|71083812|ref|YP_266532.1| 50S ribosomal protein L10P [Candidatus Pelagibacter ubique
           HTCC1062]
 gi|91763152|ref|ZP_01265116.1| LSU ribosomal protein L10P [Candidatus Pelagibacter ubique
           HTCC1002]
 gi|97181823|sp|Q4FLL0|RL10_PELUB RecName: Full=50S ribosomal protein L10
 gi|71062925|gb|AAZ21928.1| LSU ribosomal protein L10P [Candidatus Pelagibacter ubique
           HTCC1062]
 gi|91717565|gb|EAS84216.1| LSU ribosomal protein L10P [Candidatus Pelagibacter ubique
           HTCC1002]
          Length = 166

 Score =  115 bits (287), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 50/151 (33%), Positives = 98/151 (64%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           MN++ K   ISE+   F ++ +++V HY+G++++Q+ +LR +MRE G    + KNR+ KI
Sbjct: 1   MNKEQKKNYISEMETQFQNNEAVMVTHYQGLTMSQLDELRAQMREHGIKFTITKNRITKI 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A+  T  + +S+LF G + + +S+  +I+ +I   F+  N   ++LGG++   VL+Q ++
Sbjct: 61  ALEKTKCKELSNLFTGATAVAFSNDAIISARILSKFAKTNESLKLLGGIMGNEVLDQAAV 120

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLL 151
           + +A+LP L+  RA ++  + + A++LV +L
Sbjct: 121 QNVANLPTLDEARANLVGILATPASKLVSIL 151


>gi|84515195|ref|ZP_01002558.1| Ribosomal protein L10 [Loktanella vestfoldensis SKA53]
 gi|84511354|gb|EAQ07808.1| Ribosomal protein L10 [Loktanella vestfoldensis SKA53]
          Length = 162

 Score =  115 bits (287), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 59/159 (37%), Positives = 97/159 (61%)

Query: 10  ISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRG 69
           + EL +IF SSG +VVAHY+G++VA+++DLR +MR+AGG V+VAKN+L KIA+       
Sbjct: 2   VDELGQIFESSGVVVVAHYEGMTVAEMQDLRARMRDAGGAVRVAKNKLAKIALEGKPCES 61

Query: 70  ISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASLPDL 129
           I+   +G ++I YS+ PV A K+  +++  N +  VLGG +    L+   +K +A +P  
Sbjct: 62  IATYLMGMTVIAYSEDPVAAAKVIDAYAKTNEKLVVLGGAMGDTALDPAGVKAVAGMPSR 121

Query: 130 EGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDK 168
           E + A I+  I + A  +   +G P + +   +S   +K
Sbjct: 122 EELIASIVGCIAAPAANIAGAIGAPASNIASILSTIEEK 160


>gi|16124751|ref|NP_419315.1| 50S ribosomal protein L10 [Caulobacter crescentus CB15]
 gi|221233467|ref|YP_002515903.1| 50S ribosomal protein L10 [Caulobacter crescentus NA1000]
 gi|13959463|sp|P58060|RL10_CAUCR RecName: Full=50S ribosomal protein L10
 gi|254798367|sp|B8GZW1|RL10_CAUCN RecName: Full=50S ribosomal protein L10
 gi|13421675|gb|AAK22483.1| ribosomal protein L10 [Caulobacter crescentus CB15]
 gi|220962639|gb|ACL93995.1| LSU ribosomal protein L10P [Caulobacter crescentus NA1000]
          Length = 172

 Score =  115 bits (287), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 60/171 (35%), Positives = 104/171 (60%), Gaps = 3/171 (1%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M+R  K   I  L  +F+ +G++VV HY G++VA++ DLR ++R+ G  +KV KN L   
Sbjct: 1   MDRAQKQESIESLKSVFADAGAVVVTHYMGLTVAEMTDLRLRLRKEGAAIKVVKNTLALK 60

Query: 61  AIRDTSIRGISD-LFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEK-GVLNQD 118
           A+ D  +    D LF G   I Y    V A KI+V F+ +N++ +++GGV+++  VL++ 
Sbjct: 61  AL-DGKLGDKGDKLFTGPVAIAYGPDAVSAAKIAVQFAKENDKLKIVGGVLDQTNVLDEA 119

Query: 119 SIKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKN 169
            ++ +A+LP L+ +R  +I  IQ+ AT++  +L  P  Q+ R  +A+  K+
Sbjct: 120 GVRALATLPSLDELRGKLIGLIQAPATKIAGVLQAPAAQLARVFNAYATKD 170


>gi|260425399|ref|ZP_05779379.1| 50S ribosomal protein L10 [Citreicella sp. SE45]
 gi|260423339|gb|EEX16589.1| 50S ribosomal protein L10 [Citreicella sp. SE45]
          Length = 206

 Score =  114 bits (285), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 56/168 (33%), Positives = 99/168 (58%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           ++R  K   + EL +IF SSG +VV+ Y+G++VA++ DLR + R A   V+VAKNRL KI
Sbjct: 37  VDRAQKEKVVEELGQIFESSGVVVVSRYEGLTVAEMTDLRARARAADTQVRVAKNRLAKI 96

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A++      IS    G +++ YS+ PV A K+   F+ DN +F +LGG + +  L++  +
Sbjct: 97  ALQGMGCESISSYLEGMTVLTYSEDPVAAAKVVEDFAKDNKKFEILGGAMGETALDRAGV 156

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDK 168
           + ++ +P  E + A I+  I + A+ +   +G P + +   ++   +K
Sbjct: 157 EAVSKMPSREELIASIVGCIGAPASNIAGAIGAPASNIASILTTIEEK 204


>gi|209545074|ref|YP_002277303.1| 50S ribosomal protein L10 [Gluconacetobacter diazotrophicus PAl 5]
 gi|209532751|gb|ACI52688.1| ribosomal protein L10 [Gluconacetobacter diazotrophicus PAl 5]
          Length = 172

 Score =  114 bits (285), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 59/170 (34%), Positives = 95/170 (55%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M+R  K   ++ L+ +F+ +  +VV    G++VA    LR+++R AG   KVAKNRL  +
Sbjct: 1   MDRTEKREFVASLAAVFAETSMVVVTRNDGLTVADATILRQRVRAAGATYKVAKNRLANL 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A+  T   GIS L  G + + +S  PV   K+ V F+  N +  +LGG +    LN D +
Sbjct: 61  ALAGTRFEGISPLLKGPTALSWSADPVAVAKVLVEFAKTNEKLVLLGGALGTQTLNVDGV 120

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQ 170
           K +A LP L+ +RA ++  I + ATR+  +L  P  Q+ R   A+  K++
Sbjct: 121 KALAELPSLDTLRAQLVGLISTPATRIAGVLQAPAGQLARVFGAYAKKDE 170


>gi|261752553|ref|ZP_05996262.1| 50S ribosomal protein L10 [Brucella suis bv. 5 str. 513]
 gi|261742306|gb|EEY30232.1| 50S ribosomal protein L10 [Brucella suis bv. 5 str. 513]
          Length = 132

 Score =  114 bits (285), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 51/96 (53%), Positives = 72/96 (75%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           ++R  K   ++ L+  F  SGS+VVAHY G++VAQ+ DLR KMR+AGG VKVAKNRL KI
Sbjct: 37  VDRAEKREFVAWLNGAFKESGSVVVAHYTGLTVAQMSDLRSKMRDAGGSVKVAKNRLAKI 96

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSF 96
           A++ T   GI+DLF GQ+++ Y++ P+ APK++V F
Sbjct: 97  ALQGTESEGIADLFTGQTVVAYANDPITAPKVAVEF 132


>gi|326404345|ref|YP_004284427.1| 50S ribosomal protein L10 [Acidiphilium multivorum AIU301]
 gi|325051207|dbj|BAJ81545.1| 50S ribosomal protein L10 [Acidiphilium multivorum AIU301]
          Length = 178

 Score =  114 bits (285), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 55/170 (32%), Positives = 99/170 (58%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           ++R  K   + +L+ +F+ +  +VV+   G++VA +  LR KMREAG   KVAKNRL  +
Sbjct: 5   VDRAQKREFVDQLAAVFAETSMVVVSRNDGLTVADVTALRVKMREAGAQYKVAKNRLAHL 64

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A+  T   G+  +  G + + +S  PV   K++V F+  N +F ++GG +   +L+   +
Sbjct: 65  ALEGTRFDGLKPMLKGPTALAWSQDPVAVAKVAVEFAKTNEKFVLVGGALGTQMLDASGV 124

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQ 170
           K +A LP L+ +RA ++  IQ+ AT++  +L  P  Q+ R  +A+   ++
Sbjct: 125 KALAELPSLDQLRAKLLGLIQAPATKVAGVLQAPAGQLARVFAAYARADE 174


>gi|218683245|gb|ACL00661.1| 50S ribosomal protein L10 [Candidatus Liberibacter sp. Burns]
 gi|218683249|gb|ACL00663.1| 50S ribosomal protein L10 [Candidatus Liberibacter sp. Saltillo
           9-08]
 gi|269838640|gb|ACZ48685.1| 50S ribosomal protein L10 [Candidatus Liberibacter solanacearum]
          Length = 83

 Score =  114 bits (284), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 53/81 (65%), Positives = 69/81 (85%)

Query: 91  KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASLPDLEGIRAGIISAIQSNATRLVRL 150
           KISV F+NDN++F +LGG++EK +L QDSIK+IASLP++E IR+GI+SAIQS ATRLV L
Sbjct: 2   KISVGFANDNSQFEILGGILEKDMLTQDSIKKIASLPNIEEIRSGILSAIQSTATRLVML 61

Query: 151 LGTPQTQVVRAISAFVDKNQQ 171
           L TPQ  +VR +SAF +KN+Q
Sbjct: 62  LETPQNHIVRVLSAFEEKNRQ 82


>gi|300022532|ref|YP_003755143.1| ribosomal protein L10 [Hyphomicrobium denitrificans ATCC 51888]
 gi|299524353|gb|ADJ22822.1| ribosomal protein L10 [Hyphomicrobium denitrificans ATCC 51888]
          Length = 172

 Score =  114 bits (284), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 61/170 (35%), Positives = 102/170 (60%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M+R  K   I  L     S+G +VVAH  G+  AQ  D RK++++AGG VKVAKN+L ++
Sbjct: 1   MDRAAKRELIDHLHAELKSTGVVVVAHNTGLVAAQSADFRKRVKDAGGSVKVAKNKLAQL 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A++DT    +S L  G +++ +S  P+ A K +V+++  N +  +LGG + K +L+ + +
Sbjct: 61  ALKDTDAEQLSGLLKGPTILAFSKDPIAAAKAAVTYAKANEKLVILGGAMGKTILDANGV 120

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQ 170
           K +A LP L+ +RA +I  + + AT++ R +  P  Q+ R I A   K +
Sbjct: 121 KALADLPSLDELRAKLIGLLNAPATKIARTVKEPGAQLARVIQAKAAKGE 170


>gi|330993836|ref|ZP_08317768.1| 50S ribosomal protein L10 [Gluconacetobacter sp. SXCC-1]
 gi|329759104|gb|EGG75616.1| 50S ribosomal protein L10 [Gluconacetobacter sp. SXCC-1]
          Length = 172

 Score =  114 bits (284), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 58/170 (34%), Positives = 96/170 (56%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M+R  K   ++ L+ +F+ +  ++V    G+SVA + DLR+++R AG   KVAKNRL  +
Sbjct: 1   MDRTEKREFVASLAAVFAKTSMVIVTRNDGLSVADVTDLRRRVRAAGATHKVAKNRLASL 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A+  T   GI  L  G + + ++D PV   K+ V F+  N +  +LGG +    L+ +SI
Sbjct: 61  ALAGTQFEGIKPLLKGPTALSWADEPVAVAKVLVEFAKTNEKLVLLGGSLGAQTLDVNSI 120

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQ 170
           K +A LP L+ +RA ++  I + ATR+  +L  P  Q+ R   A+    +
Sbjct: 121 KALAELPSLDVLRAQLVGLISTPATRIAGVLQAPAGQLARVFGAYAKTGE 170


>gi|262277086|ref|ZP_06054879.1| 50S ribosomal protein L10 [alpha proteobacterium HIMB114]
 gi|262224189|gb|EEY74648.1| 50S ribosomal protein L10 [alpha proteobacterium HIMB114]
          Length = 170

 Score =  113 bits (283), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 54/154 (35%), Positives = 97/154 (62%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           MNR  K+  I+ L K   ++ +++V HY+G++V Q+ +LR+KMR AG  +KV KNR+ K+
Sbjct: 1   MNRIEKTNYINNLKKDLEANNAMMVYHYEGLNVNQLDELREKMRAAGALLKVTKNRITKL 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A+++TS     +LF G + +  S  P+   KI V+F   N++ +++GG+++  +L    +
Sbjct: 61  ALKETSYSEAENLFTGPTGVALSKDPITLAKILVNFQKGNDKLKIVGGIMDTKLLAPSDV 120

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTP 154
            +IA+LP L+  RA I+  +Q+   +L+ +L  P
Sbjct: 121 AEIATLPTLDEARAKIVGILQAPQQKLLSILLAP 154


>gi|254476956|ref|ZP_05090342.1| ribosomal protein L10 [Ruegeria sp. R11]
 gi|214031199|gb|EEB72034.1| ribosomal protein L10 [Ruegeria sp. R11]
          Length = 164

 Score =  113 bits (282), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 56/161 (34%), Positives = 98/161 (60%)

Query: 10  ISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRG 69
           + EL +IF SSG +VVAHY G++VA+++DLR +   AG  V+VAKNRL KIA+       
Sbjct: 2   VDELGQIFESSGVVVVAHYTGLTVAEMQDLRARASAAGSAVRVAKNRLAKIALEGKPCES 61

Query: 70  ISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASLPDL 129
           +SDL  G +++ YS+ PV A K++  F+ +N +F +LGG + +  L++  ++ ++ +P  
Sbjct: 62  MSDLLTGMTVLTYSEDPVAAAKVAEDFAKENKKFEILGGAMGENALDRAGVEAVSKMPSR 121

Query: 130 EGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQ 170
           E + A I   + + A+ +   +G P + +   +S   +K +
Sbjct: 122 EELIATIAGMLGAPASNIAGAIGAPASNIASILSTIEEKAE 162


>gi|162149182|ref|YP_001603643.1| 50S ribosomal protein L10 [Gluconacetobacter diazotrophicus PAl 5]
 gi|189040918|sp|A9H3S7|RL10_GLUDA RecName: Full=50S ribosomal protein L10
 gi|161787759|emb|CAP57355.1| 50S ribosomal protein L10 [Gluconacetobacter diazotrophicus PAl 5]
          Length = 182

 Score =  112 bits (281), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 58/170 (34%), Positives = 95/170 (55%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           ++R  K   ++ L+ +F+ +  +VV    G++VA    LR+++R AG   KVAKNRL  +
Sbjct: 11  LDRTEKREFVASLAAVFAETSMVVVTRNDGLTVADATILRQRVRAAGATYKVAKNRLANL 70

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A+  T   GIS L  G + + +S  PV   K+ V F+  N +  +LGG +    LN D +
Sbjct: 71  ALAGTRFEGISPLLKGPTALSWSADPVAVAKVLVEFAKTNEKLVLLGGALGTQTLNVDGV 130

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQ 170
           K +A LP L+ +RA ++  I + ATR+  +L  P  Q+ R   A+  K++
Sbjct: 131 KALAELPSLDTLRAQLVGLISTPATRIAGVLQAPAGQLARVFGAYAKKDE 180


>gi|163796061|ref|ZP_02190023.1| Ribosomal protein L10 [alpha proteobacterium BAL199]
 gi|159178520|gb|EDP63060.1| Ribosomal protein L10 [alpha proteobacterium BAL199]
          Length = 170

 Score =  112 bits (280), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 58/164 (35%), Positives = 98/164 (59%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           MNR  K+  I  L + F SS  +V+ H  G++VA+++ LR K+R+AG G KV KNRL ++
Sbjct: 1   MNRAQKADLIDSLRRTFDSSEVVVITHQTGLTVAEVEQLRSKVRKAGAGYKVTKNRLARL 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A++ T    ++  F G + +  S  PV A K+ V F+N N++  ++GG + +  L+ D +
Sbjct: 61  ALQGTRYENLAASFTGPTSVTTSVDPVAAAKVIVEFANSNDKVTIIGGGLGERALSPDEV 120

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISA 164
           K +A  P L+  RA ++  +Q+ A+R+V +L  P   + R  +A
Sbjct: 121 KALAKTPSLDESRAKLVGLLQAPASRMVGVLVAPAGGLARVFAA 164


>gi|83858575|ref|ZP_00952097.1| ribosomal protein L10 [Oceanicaulis alexandrii HTCC2633]
 gi|83853398|gb|EAP91250.1| ribosomal protein L10 [Oceanicaulis alexandrii HTCC2633]
          Length = 171

 Score =  112 bits (280), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 57/170 (33%), Positives = 94/170 (55%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M+R  K   + ELS+IF S+GS+V+  Y G++VA++  LR  +RE GG +KV +NRL KI
Sbjct: 1   MDRTTKEAAVEELSEIFGSAGSVVLTRYSGLTVAEMTKLRGDLREVGGKLKVVRNRLAKI 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A++       SD+F G   I YS+    APK+ V F+  N++F ++GG +E+ + +   +
Sbjct: 61  ALKGQKGEAASDMFEGPVAIAYSEDFTAAPKVVVEFAKSNDKFDLVGGFMEEEIFDAKGV 120

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQ 170
           + ++ LP  E +   I   +   A  +V  L  P   +   I    +K +
Sbjct: 121 EALSKLPSREELIGAIAGRLLGQAGEIVSRLTAPGNTLAAQIETIREKAE 170


>gi|319942162|ref|ZP_08016479.1| ribosomal protein L1 [Sutterella wadsworthensis 3_1_45B]
 gi|319804297|gb|EFW01186.1| ribosomal protein L1 [Sutterella wadsworthensis 3_1_45B]
          Length = 176

 Score =  112 bits (279), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 56/172 (32%), Positives = 102/172 (59%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           +NR+ K+  I+E+S++ S+S ++V+A Y+G++V  +  LR + R+ G  V+V KN LV+ 
Sbjct: 3   LNREDKATVIAEISEVVSNSSAMVIAEYRGLTVQAVTKLRAEARKNGVTVRVVKNTLVRR 62

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A+  T   G++D F G  +  +S  PV   K+ V+F+ DN +  + GG +   V++ D++
Sbjct: 63  AVEGTGFAGLADQFTGPLVYGFSADPVAVAKVLVNFAKDNEKLVIRGGAMADYVMDVDAV 122

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQQG 172
           KQ+AS+P  E + A +++ +     + VR L     + VR ++A  D  +Q 
Sbjct: 123 KQLASMPSREELLAKLMATMNEPIAKFVRTLNEVPARFVRTVAAVRDAKEQA 174


>gi|296116740|ref|ZP_06835348.1| 50S ribosomal protein L10 [Gluconacetobacter hansenii ATCC 23769]
 gi|295976708|gb|EFG83478.1| 50S ribosomal protein L10 [Gluconacetobacter hansenii ATCC 23769]
          Length = 172

 Score =  112 bits (279), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 56/170 (32%), Positives = 97/170 (57%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M+R  K   ++ L+ +F+ +  +VV    G++VA + +LR+++R AG   KVAKNRL  +
Sbjct: 1   MDRTEKREFVASLAAVFAETSMVVVTRNDGLTVADVTELRRRVRAAGATYKVAKNRLANL 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A+  T   GI+ L  G + I ++D PV   K+ V F+  N++  +LGG +    L+ + +
Sbjct: 61  ALAGTQFEGIAPLLKGPTAISWADEPVAVAKVLVEFAKTNDKLVLLGGSLGSQTLSVEGV 120

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQ 170
           K +A LP L+ +RA ++  I + ATR+  +L  P  Q+ R   A+    +
Sbjct: 121 KALAELPSLDVLRAQLVGLISTPATRIAGVLQAPGGQLARVFGAYAKTGE 170


>gi|94495394|ref|ZP_01301974.1| ribosomal protein L10 [Sphingomonas sp. SKA58]
 gi|94424782|gb|EAT09803.1| ribosomal protein L10 [Sphingomonas sp. SKA58]
          Length = 177

 Score =  112 bits (279), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 56/168 (33%), Positives = 100/168 (59%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M+R  K+  +S L+   +  G +VV    G++VAQ   LR+KMR+AG   KV KNRL +I
Sbjct: 7   MDRNQKAEVVSALNAELAEVGVVVVTRNLGMTVAQSTVLRQKMRDAGASYKVTKNRLARI 66

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A+  T+   +SD+  G   +  S  PV A K+++ F+  N++  ++GG + + +L+ + +
Sbjct: 67  ALDGTAYTALSDMLTGPVGLATSVDPVAAAKVAIDFAKTNDKLEIVGGAMGEVLLDAEGV 126

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDK 168
           K +AS+P L+ +RA ++  + + AT+L  +   P  Q+ R  +A+ +K
Sbjct: 127 KALASMPSLDELRAKLVGLLVAPATKLATVTQAPAAQLARVFNAYAEK 174


>gi|126732289|ref|ZP_01748089.1| ribosomal protein L10 [Sagittula stellata E-37]
 gi|126707158|gb|EBA06224.1| ribosomal protein L10 [Sagittula stellata E-37]
          Length = 164

 Score =  111 bits (278), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 53/161 (32%), Positives = 94/161 (58%)

Query: 10  ISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRG 69
           + EL +IF SSG +VVA Y+G++VA++ DLR + R     V+VAKN+L KIA+  T   G
Sbjct: 2   VEELGQIFESSGVVVVARYEGLTVAEMTDLRGRARNGQATVRVAKNKLAKIAVEGTPAEG 61

Query: 70  ISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASLPDL 129
           I+    G +++ +S+ PV A K+   F+ DN +  +LGG +    L++  ++ ++ +P  
Sbjct: 62  IAQYLDGMTVLTFSEDPVAAAKVVEDFAKDNKKLEILGGAMGGTTLDRAGVEAVSKMPSR 121

Query: 130 EGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQ 170
           E + A I+  I + A+ +   +G P + +   +S   +K +
Sbjct: 122 EELIASIVGCIGAPASNIAGAIGAPASNIASILSTIEEKQE 162


>gi|56551623|ref|YP_162462.1| 50S ribosomal protein L10 [Zymomonas mobilis subsp. mobilis ZM4]
 gi|241761252|ref|ZP_04759340.1| ribosomal protein L10 [Zymomonas mobilis subsp. mobilis ATCC 10988]
 gi|260752785|ref|YP_003225678.1| 50S ribosomal protein L10 [Zymomonas mobilis subsp. mobilis NCIMB
           11163]
 gi|61214719|sp|Q5NPK9|RL10_ZYMMO RecName: Full=50S ribosomal protein L10
 gi|56543197|gb|AAV89351.1| ribosomal protein L10 [Zymomonas mobilis subsp. mobilis ZM4]
 gi|241374159|gb|EER63656.1| ribosomal protein L10 [Zymomonas mobilis subsp. mobilis ATCC 10988]
 gi|258552148|gb|ACV75094.1| ribosomal protein L10 [Zymomonas mobilis subsp. mobilis NCIMB
           11163]
          Length = 171

 Score =  111 bits (277), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 60/169 (35%), Positives = 94/169 (55%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M R  K   ++ L   F+ +G IVV    G++VAQ   LR KMREAG   KVAKN+L +I
Sbjct: 1   MERAQKVELVAGLKSAFAEAGVIVVTRNLGLTVAQSTVLRSKMREAGASFKVAKNKLTRI 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A+  T    +SDL  G + I  S  PV A K++V F+  N +  ++G V+   +L+   +
Sbjct: 61  AVEGTPQAPLSDLLTGPTAIATSADPVAAAKVAVEFAKTNKKLEIVGAVMGTTLLDIAGV 120

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKN 169
           + +A LP L+ +R  I+  I + AT++ + +  P  Q+ R   A+  K+
Sbjct: 121 QALAELPSLDELRGKIVGLISAPATKIAQTIQAPAGQLARVFGAYAAKD 169


>gi|119713234|gb|ABL97300.1| ribosomal protein L10 [uncultured marine bacterium HF10_12C08]
          Length = 168

 Score =  111 bits (277), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 56/168 (33%), Positives = 97/168 (57%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M R+ K + I  L  I S +  ++V HY+G+S+  + +LR +   +G  +KV KNRL K+
Sbjct: 1   MKREQKEIFIKNLKTILSENSLVLVFHYRGMSMTDMTELRVQSFNSGCNIKVTKNRLTKL 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A+  T    +S+LF G + I YS+ PV   K+  +F+ +N+   +LGG+++  +L  + I
Sbjct: 61  ALEGTDKSELSELFDGPTAIAYSNDPVELTKLLTNFAKNNSNLVILGGIMDNEILTVEKI 120

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDK 168
           + ++ LP LE IRA +I  I + A ++  +L  P   + R  +A+  K
Sbjct: 121 EILSKLPSLEEIRAQLIGLISTPAQKIASVLTAPSGDLARVFNAYSTK 168


>gi|167644755|ref|YP_001682418.1| 50S ribosomal protein L10 [Caulobacter sp. K31]
 gi|189040909|sp|B0SUP2|RL10_CAUSK RecName: Full=50S ribosomal protein L10
 gi|167347185|gb|ABZ69920.1| ribosomal protein L10 [Caulobacter sp. K31]
          Length = 172

 Score =  111 bits (277), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 58/171 (33%), Positives = 105/171 (61%), Gaps = 3/171 (1%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M+R  K   I  L  +F+ +G++VV HY G++VA++ +LR ++R+     +V KN LV+ 
Sbjct: 1   MDRAQKQESIEALKSVFADAGAVVVTHYMGMTVAEMTELRSRLRKEDATFQVVKNTLVQK 60

Query: 61  AIRDTSIRGISD-LFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVV-EKGVLNQD 118
           A+ D SI    D LF G   I +   PV A KI   ++ +N++ +++GG++ +  VL++ 
Sbjct: 61  AL-DGSIGEAGDALFTGPVAIAFGSDPVSAAKIVTQYAKENDKLKLVGGILGQTTVLDEA 119

Query: 119 SIKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKN 169
           +++ +A+LP L+ IR  +I  IQ+ AT++  +L  P  Q+ R ++A+  K+
Sbjct: 120 AVRALATLPSLDQIRGKLIGLIQAPATKIAGVLQAPAGQLARVLNAYATKD 170


>gi|58038863|ref|YP_190827.1| 50S ribosomal protein L10 [Gluconobacter oxydans 621H]
 gi|81557179|sp|Q5FTX5|RL10_GLUOX RecName: Full=50S ribosomal protein L10
 gi|58001277|gb|AAW60171.1| LSU ribosomal protein L10P [Gluconobacter oxydans 621H]
          Length = 184

 Score =  110 bits (275), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 57/170 (33%), Positives = 94/170 (55%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           ++R  K   +  L+ +F S+  +VV   KG++VA + +LR+++R AG   KVAKNRL   
Sbjct: 11  LDRTEKRAFVEFLADVFGSTSMVVVTQNKGLTVADVTELRRRIRAAGATYKVAKNRLASR 70

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A+  T   GI+ L  G + + +S+ P    K+ V F+  N++  VLGG +    L  D I
Sbjct: 71  ALDGTQFDGIAPLLKGPTALAWSEDPASVAKVIVEFAKTNDKLVVLGGALGSQALGVDGI 130

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQ 170
           K +A LP L+ +RA ++  I + ATR+  ++  P  Q+ R   A+    +
Sbjct: 131 KALAELPSLDELRAKLVGMINTPATRIAGVVQAPAGQLARVFGAYAKAGE 180


>gi|256427009|gb|ACU81077.1| 50S ribosomal protein L10 [Candidatus Liberibacter psyllaurous]
          Length = 79

 Score =  110 bits (275), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 51/78 (65%), Positives = 68/78 (87%)

Query: 94  VSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASLPDLEGIRAGIISAIQSNATRLVRLLGT 153
           V F+NDN++F +LGG++EK +L QDSIK+IASLP++E IR+GI+SAIQS+ATRLV LL T
Sbjct: 1   VGFANDNSQFEILGGILEKDMLTQDSIKKIASLPNIEEIRSGILSAIQSSATRLVMLLET 60

Query: 154 PQTQVVRAISAFVDKNQQ 171
           PQ Q+VR +SAF +KN+Q
Sbjct: 61  PQNQIVRVLSAFEEKNRQ 78


>gi|149913532|ref|ZP_01902065.1| 50S ribosomal protein L10 [Roseobacter sp. AzwK-3b]
 gi|149812652|gb|EDM72481.1| 50S ribosomal protein L10 [Roseobacter sp. AzwK-3b]
          Length = 164

 Score =  110 bits (274), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 56/161 (34%), Positives = 96/161 (59%)

Query: 10  ISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRG 69
           + EL +IF SSG +VVAHY G++VA+++DLR + R A   V+VAKNRL KIA+       
Sbjct: 2   VEELGQIFESSGVVVVAHYAGLTVAEMQDLRARARAAEASVRVAKNRLAKIALEGKPCES 61

Query: 70  ISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASLPDL 129
           I+    G +++ YS+ PV A K++  F+ DN++F +LGG +    L++  +K ++ +P  
Sbjct: 62  IAGYLTGMTVLTYSEDPVSAAKVAEGFAKDNSKFEILGGAMGSDPLDRAGVKAVSDMPSR 121

Query: 130 EGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQ 170
           E + A I   + + A+ +   +G P + +   +S   +K +
Sbjct: 122 EELLAQIAGMLGAPASNIAGAIGAPASNIASILSTIEEKAE 162


>gi|254421128|ref|ZP_05034852.1| ribosomal protein L10, putative [Brevundimonas sp. BAL3]
 gi|196187305|gb|EDX82281.1| ribosomal protein L10, putative [Brevundimonas sp. BAL3]
          Length = 171

 Score =  109 bits (273), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 54/169 (31%), Positives = 99/169 (58%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M+R  K+  I  L  +F+ +GS+VV H  G++VA+++DLR ++R+ GG  KV KNRL   
Sbjct: 1   MDRAQKAESIETLKGVFADAGSVVVTHNLGLTVAEMEDLRGRLRKEGGAFKVVKNRLALK 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A+          LF G   I Y+++P  A K++  F+  N+ F+++GG + + V++   +
Sbjct: 61  ALEAEEGSDYHGLFKGPVGIAYAENPGTAAKVATEFAKANDRFKIIGGFMGETVVDVKGV 120

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKN 169
           + ++ LP L+ +R+ +I  + + AT++  +L  P  Q+ R  +A+  K 
Sbjct: 121 EVLSKLPTLDEVRSQLIGLLNAPATKIAGVLQAPAGQLARVFNAYATKE 169


>gi|85706808|ref|ZP_01037899.1| ribosomal protein L10 [Roseovarius sp. 217]
 gi|85668601|gb|EAQ23471.1| ribosomal protein L10 [Roseovarius sp. 217]
          Length = 164

 Score =  109 bits (273), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 55/161 (34%), Positives = 97/161 (60%)

Query: 10  ISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRG 69
           + EL +IF SSG +VVAHY G++VA+++DLR + R A   V+VAKN+L KIA+       
Sbjct: 2   VEELGQIFESSGVVVVAHYAGLTVAEMQDLRARARAAEASVRVAKNKLAKIALEGKPCAS 61

Query: 70  ISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASLPDL 129
           I++   G +++ YS+ PV A K+S  F+  N +F +LGG +    LN+  ++ ++ +P  
Sbjct: 62  IANYLTGMTVLTYSEDPVAAAKVSEDFAKVNKKFEILGGAMGGTALNRAGVEAVSKMPSR 121

Query: 130 EGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQ 170
           + + A I+  I + A+ +   +G P + +   +S  ++K +
Sbjct: 122 DELIASIVGCIGAPASNIAGAIGAPASNIAGILSTIIEKAE 162


>gi|87198055|ref|YP_495312.1| 50S ribosomal protein L10 [Novosphingobium aromaticivorans DSM
           12444]
 gi|97181804|sp|Q2GCD2|RL10_NOVAD RecName: Full=50S ribosomal protein L10
 gi|87133736|gb|ABD24478.1| LSU ribosomal protein L10P [Novosphingobium aromaticivorans DSM
           12444]
          Length = 170

 Score =  109 bits (273), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 59/165 (35%), Positives = 98/165 (59%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M+R  K+  ++ L+ +F+ +G++V+    G++VAQ   LR K+REAG   KVAKN L K+
Sbjct: 1   MDRSQKAESVAFLNGVFAEAGAVVITRNLGMTVAQSTALRTKIREAGATYKVAKNSLAKL 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A+  T   G+ DLF G + I  S  PV A K  V F+   ++  ++GG +   VLN+  +
Sbjct: 61  AVAGTDYEGLVDLFTGPTAIAASADPVAAAKAVVEFAKTTDKIEIVGGAMGSQVLNEAGV 120

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAF 165
           + +AS+P L+ +R  +I  IQ+ AT++ +L   P  ++ R   A+
Sbjct: 121 RALASMPSLDELRGTLIGLIQAPATKIAQLTTAPAAKLARVFGAY 165


>gi|149203668|ref|ZP_01880637.1| ribosomal protein L10 [Roseovarius sp. TM1035]
 gi|149142785|gb|EDM30827.1| ribosomal protein L10 [Roseovarius sp. TM1035]
          Length = 164

 Score =  109 bits (273), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 54/161 (33%), Positives = 96/161 (59%)

Query: 10  ISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRG 69
           + EL +IF SSG +VVAHY G++VA+++DLR + R A   V+VAKN+L KIA+       
Sbjct: 2   VEELGQIFESSGVVVVAHYAGLTVAEMQDLRARARAAEASVRVAKNKLAKIALEGKPCAS 61

Query: 70  ISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASLPDL 129
           I++   G +++ +S+ PV A K+   F+  N +F +LGG +    LN+  ++ ++ +P  
Sbjct: 62  IANYLTGMTVLTFSEDPVAAAKVCEDFAKANKKFEILGGAMGGTALNRAGVEAVSKMPSR 121

Query: 130 EGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQ 170
           E + A I+  I + A+ +   +G P + +   +S  ++K +
Sbjct: 122 EELIASIVGCIGAPASNIAGAIGAPASNIAGILSTIIEKAE 162


>gi|319778780|ref|YP_004129693.1| LSU ribosomal protein L10p (P0) [Taylorella equigenitalis MCE9]
 gi|317108804|gb|ADU91550.1| LSU ribosomal protein L10p (P0) [Taylorella equigenitalis MCE9]
          Length = 207

 Score =  109 bits (273), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 61/170 (35%), Positives = 100/170 (58%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           +NR  K + I E+S   S + SIVVA Y+GI VA +  LRKK RE+G  ++V KN LV  
Sbjct: 36  LNRNEKQIVIDEISAQLSEAQSIVVAEYRGIDVASVTVLRKKARESGVYLRVLKNTLVTR 95

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           AI++T+ + + D  VG  +   S  PV A K+  SF+ +N++  +  G +   VL+ + I
Sbjct: 96  AIKETNFQQLEDKLVGPLIYAISKDPVAAAKVLSSFAKENDKIVLKAGALPGSVLDSNGI 155

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQ 170
           KQ+A++P  E + + ++  +Q+   + VR L    T+ VR ++A  D+ +
Sbjct: 156 KQLATMPSREELLSKLMGTMQAPIAKFVRTLNEVPTKFVRGLAAVRDQKE 205


>gi|329890169|ref|ZP_08268512.1| ribosomal protein L10 family protein [Brevundimonas diminuta ATCC
           11568]
 gi|328845470|gb|EGF95034.1| ribosomal protein L10 family protein [Brevundimonas diminuta ATCC
           11568]
          Length = 171

 Score =  108 bits (270), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 55/169 (32%), Positives = 96/169 (56%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M+R  K+  I  L  +F+ +G++VV H  G++V +++DLR ++R+ GG  KV KNRL   
Sbjct: 1   MDRAQKAESIESLKSVFADAGAVVVTHNLGLTVVEMEDLRGRLRKEGGAFKVVKNRLALK 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A+          LF G   I Y+  PV A K++  F+  N++F + GG +   VL+   +
Sbjct: 61  ALGVEEGSEYHSLFKGPVGIAYAADPVTAAKVTAEFAKGNDKFVIQGGFMGDKVLDAKGV 120

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKN 169
           + ++ LP L+ +R  +I  +Q+ AT++  +L  P  Q+ R  +A+  K+
Sbjct: 121 EALSKLPSLDQLRGKLIGLLQAPATKVAGVLQAPAGQLARVFNAYATKD 169


>gi|114764156|ref|ZP_01443394.1| ribosomal protein L10 [Pelagibaca bermudensis HTCC2601]
 gi|114543308|gb|EAU46324.1| ribosomal protein L10 [Roseovarius sp. HTCC2601]
          Length = 164

 Score =  107 bits (266), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 52/161 (32%), Positives = 94/161 (58%)

Query: 10  ISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRG 69
           + EL +IF SSG +VV+ Y+G++VA++ DLR +   A   V+VAKNRL KIA++      
Sbjct: 2   VEELGQIFESSGVVVVSRYEGLTVAEMTDLRARASAAETQVRVAKNRLAKIALQGKECES 61

Query: 70  ISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASLPDL 129
           IS    G +++ YS+ PV A K+   F+ DN +  +LGG +    L++  ++ ++ +P  
Sbjct: 62  ISSFLEGMTVLTYSEDPVAAAKVIEDFAKDNKKLEILGGAMGGTALDRAGVEAVSKMPSR 121

Query: 130 EGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQ 170
           + + A I+  I + A+ +   +G P + +   +S+  +K +
Sbjct: 122 DELIASIVGCIGAPASNIAGAIGAPASNIASILSSIEEKAE 162


>gi|85375712|ref|YP_459774.1| 50S ribosomal protein L10 [Erythrobacter litoralis HTCC2594]
 gi|122543133|sp|Q2N5R4|RL10_ERYLH RecName: Full=50S ribosomal protein L10
 gi|84788795|gb|ABC64977.1| ribosomal protein L10 [Erythrobacter litoralis HTCC2594]
          Length = 171

 Score =  106 bits (264), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 59/165 (35%), Positives = 101/165 (61%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M+R  K+  ++EL+ +F+ +G +VV    G++VA   +LR KMREAG   KVAKNRL K+
Sbjct: 1   MDRSQKADAVAELNSVFNEAGVVVVTRNLGLTVAASTELRGKMREAGASYKVAKNRLAKL 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A++DT   GI ++  G   + YS  PV A K +V F+  N+   ++GG +   +L++  +
Sbjct: 61  ALKDTDYEGIGEMLTGPIALGYSADPVAAAKAAVDFAKSNDRLEIVGGSMGGQMLDEAGV 120

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAF 165
           K +AS+P L+ +R  I+  I + AT++ +++  P  ++ R   A+
Sbjct: 121 KALASMPSLDELRGTIVGLINAPATKIAQVVTAPANKLARVFGAY 165


>gi|304321428|ref|YP_003855071.1| 50S ribosomal protein L10 [Parvularcula bermudensis HTCC2503]
 gi|303300330|gb|ADM09929.1| ribosomal protein L10 [Parvularcula bermudensis HTCC2503]
          Length = 174

 Score =  106 bits (264), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 57/171 (33%), Positives = 97/171 (56%), Gaps = 5/171 (2%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           + R+ K  +++ +S + + +  +VV   KG+SVAQ+ DLR K+RE G G+KV KNRL KI
Sbjct: 3   LTREQKGDQVAWISTVLNDNEVLVVIENKGLSVAQVSDLRSKLREVGAGMKVVKNRLAKI 62

Query: 61  AIRDTSIRG---ISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQ 117
           A+    + G   ++ LFVG + I YS+ PV APK+ V ++  +++  + GG++    LN 
Sbjct: 63  AL--AKVDGGNDVAPLFVGPTFIGYSEDPVTAPKVLVEWAKKSDKVEIRGGLMAGTALNA 120

Query: 118 DSIKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDK 168
           D I  ++ +P  E I A I  ++ + A  +   +G P   +   +    +K
Sbjct: 121 DGITNLSKMPSREEIIAQIAGSLTAPAANISGAIGAPAANLAACVKTIAEK 171


>gi|319944814|ref|ZP_08019077.1| 50S ribosomal protein L10 [Lautropia mirabilis ATCC 51599]
 gi|319741928|gb|EFV94352.1| 50S ribosomal protein L10 [Lautropia mirabilis ATCC 51599]
          Length = 174

 Score =  105 bits (262), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 57/170 (33%), Positives = 99/170 (58%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           +NR+ K+  I E+S   + +GSIV+A Y+G++V +I  LRK+ RE+G  ++V KN LV+ 
Sbjct: 3   LNREEKAAVIEEVSAQVAQAGSIVLAEYRGLTVEKITQLRKQARESGVYLRVLKNTLVRR 62

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A++DT    ++D  VG  +   S  PV   K+  SF+  N++  V GG +   V++   +
Sbjct: 63  AVKDTPYEKLADQMVGPLMYGISADPVAPAKLIASFAKANDQLVVKGGAMPNVVMDVAGV 122

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQ 170
           + +A++P  E + A ++  +Q+     VR L    T+ VR ++A  DK +
Sbjct: 123 QALATMPSREELLAKLLGTMQAPVATFVRTLNEVPTKFVRGLAAVRDKQE 172


>gi|330430116|gb|AEC21450.1| 50S ribosomal protein L10 [Pusillimonas sp. T7-7]
          Length = 174

 Score =  104 bits (260), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 57/170 (33%), Positives = 97/170 (57%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           +NRQ K+V I E+S   + + SI++A Y+G+ VA +  LRK  RE+G  ++V KN LV+ 
Sbjct: 3   LNRQEKAVVIEEVSAEVAKAQSIIIAEYRGLDVASVTVLRKTARESGVYLRVLKNTLVRR 62

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A+  T    ++    G  +   S  PV A KI   F+  N++  + GG +   +LNQD +
Sbjct: 63  AVAGTPYEELTAQLSGPLMYAISTDPVSAAKILAGFAKTNDKLVIKGGALPNSLLNQDGV 122

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQ 170
           K +A++P  E + + ++  +Q+  T+ VR L    T+ VR ++A  D+ +
Sbjct: 123 KALATMPSREELLSKLMGTMQAPVTQFVRTLNEVPTKFVRGLAAVRDQKE 172


>gi|303256439|ref|ZP_07342453.1| ribosomal protein L10 [Burkholderiales bacterium 1_1_47]
 gi|331000380|ref|ZP_08324060.1| ribosomal protein L10 [Parasutterella excrementihominis YIT 11859]
 gi|302859930|gb|EFL83007.1| ribosomal protein L10 [Burkholderiales bacterium 1_1_47]
 gi|329572086|gb|EGG53755.1| ribosomal protein L10 [Parasutterella excrementihominis YIT 11859]
          Length = 176

 Score =  103 bits (256), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 53/172 (30%), Positives = 96/172 (55%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           +NRQ K+  I E+S+I + +  +V+A Y+G++V     LRK+ RE G  ++V KN L + 
Sbjct: 3   LNRQEKADMIKEISEIIAGTEGLVIAEYRGLTVDAATKLRKEARENGVQLRVLKNTLARR 62

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A++DT   G+SD FVG  L  +S  PV   K+  +F+  N +  +  G +   VL+   +
Sbjct: 63  AVKDTPFEGLSDQFVGPLLYGFSADPVAPAKVMANFAKTNPQLVIKAGAMPNNVLDVAGV 122

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQQG 172
           +++A++P  + + A +++ +     + VR L     + VR ++A  D  +Q 
Sbjct: 123 EKLATMPSRDELLAKLMATMNEPVAKFVRTLNEVPARFVRTLAAVRDAKEQA 174


>gi|85709554|ref|ZP_01040619.1| ribosomal protein L10 [Erythrobacter sp. NAP1]
 gi|85688264|gb|EAQ28268.1| ribosomal protein L10 [Erythrobacter sp. NAP1]
          Length = 176

 Score =  103 bits (256), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 56/169 (33%), Positives = 105/169 (62%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M+R  K+  +++L+ +F+  G +VV    G++V Q  +LR KMREAG   KVAKNRL K+
Sbjct: 6   MDRSQKADAVAQLNAVFNEVGVVVVTRNLGMTVDQSTELRGKMREAGASYKVAKNRLAKL 65

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A++DT   GI +   G + + +S+ PV A K +V F+  N++  ++GG +   VL++  +
Sbjct: 66  ALKDTDYVGIDEFLTGPTALAWSEDPVAAAKAAVDFAKSNDKLEIVGGSMGTQVLDEAGV 125

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKN 169
           + +AS+P L+ +R  ++  + + AT++ +++  P +++ R   A+  K+
Sbjct: 126 RALASMPSLDELRGKLVGLVNAPATKIAQVVNAPASKLARVFGAYGAKD 174


>gi|220917461|ref|YP_002492765.1| ribosomal protein L10 [Anaeromyxobacter dehalogenans 2CP-1]
 gi|254798354|sp|B8JB72|RL10_ANAD2 RecName: Full=50S ribosomal protein L10
 gi|219955315|gb|ACL65699.1| ribosomal protein L10 [Anaeromyxobacter dehalogenans 2CP-1]
          Length = 174

 Score =  102 bits (255), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 57/165 (34%), Positives = 93/165 (56%), Gaps = 1/165 (0%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           MNR  K   ISEL +  + + + +VA  KG++VA + DLRKK+R+A    ++ KN L   
Sbjct: 1   MNRTEKEQVISELHEKMAKAKAAIVAEPKGLNVAVVTDLRKKLRDAKIDYRIVKNTLAAR 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
           A + T +  ++D FVG + +V S   V+ P K+   F  D   F +   ++E  V++   
Sbjct: 61  AAKGTPVEPVADRFVGPTALVMSYDDVVTPAKLLADFMKDRENFVIRTAIIEGKVIDAKG 120

Query: 120 IKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISA 164
           ++ +A +P L+ +R  I + I   AT+L RL+GTP  Q+ R + A
Sbjct: 121 VQALAKMPGLKELRGQIAAMIAQPATKLARLVGTPGQQLARVVGA 165


>gi|163745524|ref|ZP_02152884.1| 50S ribosomal protein L10 [Oceanibulbus indolifex HEL-45]
 gi|161382342|gb|EDQ06751.1| 50S ribosomal protein L10 [Oceanibulbus indolifex HEL-45]
          Length = 171

 Score =  102 bits (255), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 60/168 (35%), Positives = 101/168 (60%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M+R  K   + EL +IF SSG +VV+HY G++VA+++DLR + R AGG V+VAKNRL KI
Sbjct: 1   MDRAQKEQLVDELGQIFESSGVVVVSHYVGLTVAEMQDLRARARAAGGAVRVAKNRLAKI 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A+       I+DL  G +++ YS+ PV A K++  FS +N +  +LGG + +  L+   +
Sbjct: 61  ALEGKPCESIADLLTGMTVLTYSEDPVAAAKVAQEFSKENPKLVILGGSMGENALDAAGV 120

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDK 168
           + ++ +P  E + + I   + + A+ +   +G P + +   +S   DK
Sbjct: 121 EAVSKMPSREELISTIAGMLGAPASNIAGAIGAPASNIASILSTIEDK 168


>gi|86158015|ref|YP_464800.1| 50S ribosomal protein L10P [Anaeromyxobacter dehalogenans 2CP-C]
 gi|97181466|sp|Q2II80|RL10_ANADE RecName: Full=50S ribosomal protein L10
 gi|85774526|gb|ABC81363.1| LSU ribosomal protein L10P [Anaeromyxobacter dehalogenans 2CP-C]
          Length = 174

 Score =  101 bits (252), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 57/165 (34%), Positives = 92/165 (55%), Gaps = 1/165 (0%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           MNR  K   I EL +  + + + +VA  KG++VA + DLRKK+R+A    ++ KN L   
Sbjct: 1   MNRTEKEQVIGELHEKMAKAKAAIVAEPKGLNVAVVTDLRKKLRDAKIDYRIVKNTLAAR 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
           A + T +  ++D FVG + +V S   V+ P K+   F  D   F +   ++E  V++   
Sbjct: 61  AAKGTPVEPVADRFVGPTALVMSYDDVVTPAKLLADFMKDRENFVIRTAIIEGKVVDAKG 120

Query: 120 IKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISA 164
           ++ +A LP L+ +R  I + I   AT+L RL+GTP  Q+ R + A
Sbjct: 121 VQALAKLPGLKELRGQIAAMIAQPATKLARLVGTPGQQLARVVGA 165


>gi|327438259|dbj|BAK14624.1| ribosomal protein L10 [Solibacillus silvestris StLB046]
          Length = 166

 Score =  101 bits (252), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 51/140 (36%), Positives = 87/140 (62%), Gaps = 1/140 (0%)

Query: 4   QGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIR 63
           + K V++ E++  FS++GSIVV  Y+G++VAQ+ +LRK++REAG   KV KN L + A  
Sbjct: 6   ETKKVQVQEIADKFSAAGSIVVVDYRGLTVAQVTELRKQLREAGVEFKVYKNTLTRRAAE 65

Query: 64  DTSIRGISDLFVGQSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQ 122
              + GI++   G + I +S+  V+AP KI   F+  N    +  G++E  V + + +K 
Sbjct: 66  AAGLEGINEFLTGPNAIAFSNEDVVAPAKIINEFAKKNEALEIKAGIIEGTVASVEDVKA 125

Query: 123 IASLPDLEGIRAGIISAIQS 142
           +A LP  EG+ + ++S +Q+
Sbjct: 126 LAELPSREGLLSMLLSVLQA 145


>gi|320352908|ref|YP_004194247.1| 50S ribosomal protein L10P [Desulfobulbus propionicus DSM 2032]
 gi|320121410|gb|ADW16956.1| LSU ribosomal protein L10P [Desulfobulbus propionicus DSM 2032]
          Length = 172

 Score =  101 bits (251), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 55/171 (32%), Positives = 99/171 (57%), Gaps = 1/171 (0%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           MNR  K+  ISEL++ FS +   VVA Y+G+ V +++ LRK++R+    ++VAKN L+K+
Sbjct: 1   MNRDQKTDVISELNETFSKAKFAVVADYRGLKVTELEKLRKELRQNDAQIQVAKNTLLKL 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
           A++ T+  G+SD F G + +    +  + P K   +F+ + N F +   V+E  VL  + 
Sbjct: 61  AVKGTAYEGLSDFFSGTTAVAVGFTEPVGPSKALTAFAAEFNAFSIRSAVLEGSVLTAED 120

Query: 120 IKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQ 170
           +  ++ LP  E + A ++  + +  T  VR+L     +++ AISA  D+ +
Sbjct: 121 VVALSKLPSREQLLAKLLGTMSAVPTGFVRVLSAVPQKLLYAISAIKDQKE 171


>gi|197122678|ref|YP_002134629.1| 50S ribosomal protein L10 [Anaeromyxobacter sp. K]
 gi|226699904|sp|B4UDT4|RL10_ANASK RecName: Full=50S ribosomal protein L10
 gi|196172527|gb|ACG73500.1| ribosomal protein L10 [Anaeromyxobacter sp. K]
          Length = 174

 Score =  101 bits (251), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 56/165 (33%), Positives = 92/165 (55%), Gaps = 1/165 (0%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           MNR  K   I EL +  + + + +VA  KG++VA + DLRKK+R+A    ++ KN L   
Sbjct: 1   MNRTEKEQVIGELHEKMAKAKAAIVAEPKGLNVAVVTDLRKKLRDAKIDYRIVKNTLAAR 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
           A + T +  ++D FVG + +V S   V+ P K+   F  D   F +   ++E  V++   
Sbjct: 61  AAKGTPVEPVADRFVGPTALVMSYDDVVTPAKLLADFMKDRENFVIRTAIIEGKVIDAKG 120

Query: 120 IKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISA 164
           ++ +A +P L+ +R  I + I   AT+L RL+GTP  Q+ R + A
Sbjct: 121 VQALAKMPGLKELRGQIAAMIAQPATKLARLVGTPGQQLARVVGA 165


>gi|149925887|ref|ZP_01914150.1| 50S ribosomal protein L10 [Limnobacter sp. MED105]
 gi|149825175|gb|EDM84386.1| 50S ribosomal protein L10 [Limnobacter sp. MED105]
          Length = 176

 Score =  101 bits (251), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 56/170 (32%), Positives = 97/170 (57%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           +NRQ K+  I E++   +S+ ++VVA Y+G+SV  +  LRK+ R AG  ++V KN L K 
Sbjct: 3   LNRQEKAAVIEEITGQLASAQAVVVAEYRGLSVESVTQLRKEARAAGVYLRVLKNTLAKR 62

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           AI  T+  G+SD  VG  +   S  PV A K+ V+F+  N++  +  G +   V+  D +
Sbjct: 63  AIAGTAFEGLSDKMVGPLIYGISPDPVAAAKVLVNFAKTNDKLILTAGALPGQVMGVDGV 122

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQ 170
           K +A++P  + + + ++  +Q+     VR L    T+ VR ++A  D+ +
Sbjct: 123 KALATMPSRDELLSKLLGTMQAPIATFVRTLNEVPTKFVRGVAAVRDQKE 172


>gi|118594009|ref|ZP_01551356.1| 50S ribosomal protein L10 [Methylophilales bacterium HTCC2181]
 gi|118439787|gb|EAV46414.1| 50S ribosomal protein L10 [Methylophilales bacterium HTCC2181]
          Length = 173

 Score =  100 bits (250), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 59/168 (35%), Positives = 94/168 (55%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           +N   K   ++E+SK   ++ SI++A Y+G+ V  +  LR K R +G  +KV KN+LVK 
Sbjct: 3   LNLDEKKAVVAEVSKQIENAQSIILAEYRGVDVGNMTSLRVKARNSGVYLKVLKNKLVKR 62

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           AI DT    +S+  VG  +   SD PV A K+   F+ +N+ F +  G +    L+ D+I
Sbjct: 63  AIEDTPFSSLSEDMVGPLVFGISDDPVAAAKVLNDFAKENDLFVIKSGAMPNERLDADAI 122

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDK 168
           K +ASLP  E + A ++  +Q+     VR L    T+ VR ++A  D+
Sbjct: 123 KALASLPSREELLAKLLGTMQAPIATFVRTLNEVPTKFVRGLAAVRDQ 170


>gi|295688167|ref|YP_003591860.1| 50S 50S ribosomal protein L10 [Caulobacter segnis ATCC 21756]
 gi|295430070|gb|ADG09242.1| ribosomal protein L10 [Caulobacter segnis ATCC 21756]
          Length = 172

 Score =  100 bits (249), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 57/170 (33%), Positives = 103/170 (60%), Gaps = 1/170 (0%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M+R  K   I  L  +F+ +G++VV HY G++VA++ DLR ++R+ G  +KV KN L   
Sbjct: 1   MDRAQKQESIESLKSVFTDAGAVVVTHYMGLTVAEMTDLRLRLRKEGAAIKVVKNTLALK 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEK-GVLNQDS 119
           A+          LF G   I Y    V A K++V+++ +N++ +V+GGV+++  VL+++ 
Sbjct: 61  ALDGKLGDKGEKLFTGPVAIAYGPDAVSAAKVAVAYAKENDKLKVVGGVLDQTNVLDENG 120

Query: 120 IKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKN 169
           ++ +A+LP L+ +R  +I  IQ+ AT++  +L  P  Q+ R  +A+  K+
Sbjct: 121 VRALATLPSLDELRGKLIGLIQAPATKIAGVLQAPAGQLARVFNAYATKD 170


>gi|117924146|ref|YP_864763.1| 50S ribosomal protein L10P [Magnetococcus sp. MC-1]
 gi|117607902|gb|ABK43357.1| LSU ribosomal protein L10P [Magnetococcus sp. MC-1]
          Length = 172

 Score =  100 bits (249), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 52/170 (30%), Positives = 98/170 (57%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M +  KS  + E+ ++ SSS   VV HY+G++VA++ +LR K+REAG  V+V KN L K 
Sbjct: 1   MKQADKSKIVEEVRELLSSSSVAVVTHYRGLTVAEMTELRVKLREAGANVRVVKNTLAKR 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A+  T    + +  VG + I +S  PV   K+  +F+  + + +++GGV++   ++ + I
Sbjct: 61  AVAGTPFEALGEFLVGPTSIAFSADPVAPAKVISAFAKTHPKIQIVGGVLDGKAMDAEGI 120

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQ 170
           +++A LP  E + A ++ ++ +  T  V +L       VR ++A  ++ +
Sbjct: 121 ERLAKLPSKEELLAKMLGSLNAPITNFVGVLAAVPGSFVRVLNAVREQKE 170


>gi|83854991|ref|ZP_00948521.1| ribosomal protein L10 [Sulfitobacter sp. NAS-14.1]
 gi|83941513|ref|ZP_00953975.1| ribosomal protein L10 [Sulfitobacter sp. EE-36]
 gi|83842834|gb|EAP82001.1| ribosomal protein L10 [Sulfitobacter sp. NAS-14.1]
 gi|83847333|gb|EAP85208.1| ribosomal protein L10 [Sulfitobacter sp. EE-36]
          Length = 163

 Score = 99.8 bits (247), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 57/159 (35%), Positives = 97/159 (61%)

Query: 10  ISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRG 69
           + EL +IF SSG +VV+HY G++VA ++DLR + R AGG V+VAKNRL KIA+       
Sbjct: 2   VEELGQIFESSGVVVVSHYVGLTVADMQDLRARARAAGGAVRVAKNRLAKIALDGKPCES 61

Query: 70  ISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASLPDL 129
           I+DL  G +++ YS+ PV A K++  F+ +N +F +LGG + +  L+   ++ ++ +P  
Sbjct: 62  IADLLTGMTVLTYSEDPVAAAKVAQEFAKENQKFVILGGAMGENALDVAGVEAVSKMPSR 121

Query: 130 EGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDK 168
           E + + I   + + A+ +   +G P + +   +S   DK
Sbjct: 122 EELISTIAGMLGAPASNIAGAIGAPASNIASILSTIEDK 160


>gi|169830049|ref|YP_001700207.1| 50S ribosomal protein L10 [Lysinibacillus sphaericus C3-41]
 gi|226699972|sp|B1HMZ9|RL10_LYSSC RecName: Full=50S ribosomal protein L10
 gi|168994537|gb|ACA42077.1| 50S ribosomal protein L10 [Lysinibacillus sphaericus C3-41]
          Length = 166

 Score = 99.4 bits (246), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 49/140 (35%), Positives = 88/140 (62%), Gaps = 1/140 (0%)

Query: 4   QGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIR 63
           + K V++ E+++ F ++ S+VV  Y+G++VAQ+ +LRK++REAG   KV KN L + A  
Sbjct: 6   ENKQVQVQEITEKFQNASSVVVVDYRGLNVAQVTELRKQLREAGVEFKVYKNTLTRRAAE 65

Query: 64  DTSIRGISDLFVGQSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQ 122
              + GI+D+ VG + I +S+  V+AP KI   F+  N    +  G++E  + + + +K 
Sbjct: 66  AAGLEGINDVLVGPNAIAFSNEDVVAPAKIINEFAKKNEALEIKAGIIEGTISSVEDVKA 125

Query: 123 IASLPDLEGIRAGIISAIQS 142
           +A LP  EG+ + ++S +Q+
Sbjct: 126 LAELPSREGLLSMLLSVLQA 145


>gi|299541916|ref|ZP_07052239.1| 50S ribosomal protein L10 [Lysinibacillus fusiformis ZC1]
 gi|298725654|gb|EFI66295.1| 50S ribosomal protein L10 [Lysinibacillus fusiformis ZC1]
          Length = 166

 Score = 99.4 bits (246), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 49/140 (35%), Positives = 87/140 (62%), Gaps = 1/140 (0%)

Query: 4   QGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIR 63
           + K V++ E+++ F  + S+VV  Y+G++VAQ+ +LRK++REAG   KV KN L + A  
Sbjct: 6   ENKQVQVQEITEKFQGAASVVVVDYRGLNVAQVTELRKQLREAGVEFKVYKNTLTRRAAE 65

Query: 64  DTSIRGISDLFVGQSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQ 122
              + GI+D+ VG + I +S+  V+AP KI   F+  N    +  G++E  + + + +K 
Sbjct: 66  AAGLEGINDVLVGPNAIAFSNEDVVAPAKIINEFAKKNEALEIKAGIIEGTISSVEDVKA 125

Query: 123 IASLPDLEGIRAGIISAIQS 142
           +A LP  EG+ + ++S +Q+
Sbjct: 126 LAELPSREGLLSMLLSVLQA 145


>gi|302390617|ref|YP_003826438.1| LSU ribosomal protein L10P [Thermosediminibacter oceani DSM 16646]
 gi|302201245|gb|ADL08815.1| LSU ribosomal protein L10P [Thermosediminibacter oceani DSM 16646]
          Length = 172

 Score = 99.0 bits (245), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 58/169 (34%), Positives = 94/169 (55%), Gaps = 2/169 (1%)

Query: 2   NRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIA 61
            R+ K   ++EL   FS + + ++  YKG++VA+I +LR+K+RE G   KV KN L KIA
Sbjct: 3   TREEKQQLVAELKDKFSRARAAILTDYKGLNVAEITELRRKLREQGVEYKVVKNTLTKIA 62

Query: 62  IRDTSIRGISDLFVGQSLIVYS-DSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           ++D     + +   G + + +  D PV   K+ V F+ D+ +  + GGVVE  V ++  I
Sbjct: 63  VKDFEY-NLDEYLEGPTAVAFGFDDPVAPAKVLVDFAKDHKQLEIKGGVVEGRVADKAMI 121

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKN 169
           +Q+A LP  E + A  + A+QS    +V +L  P   +V  + A  DK 
Sbjct: 122 EQLAKLPRKEELIAKAVGAVQSPLYGIVWVLQGPILDLVYTLQAIQDKK 170


>gi|197709091|gb|ACH72643.1| 50S ribosomal subunit protein L10 [Candidatus Liberibacter
           solanacearum]
          Length = 70

 Score = 99.0 bits (245), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 46/69 (66%), Positives = 60/69 (86%)

Query: 103 FRVLGGVVEKGVLNQDSIKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAI 162
           F +LGG++EK +L QDSIK+IASLP++E IR+GI+SAIQS+ATRLV LL TPQ Q+VR +
Sbjct: 1   FEILGGILEKDMLTQDSIKKIASLPNIEEIRSGILSAIQSSATRLVMLLETPQNQIVRVL 60

Query: 163 SAFVDKNQQ 171
           SAF +KN+Q
Sbjct: 61  SAFEEKNRQ 69


>gi|163859288|ref|YP_001633586.1| 50S ribosomal protein L10 [Bordetella petrii DSM 12804]
 gi|226699915|sp|A9IJ29|RL10_BORPD RecName: Full=50S ribosomal protein L10
 gi|163263016|emb|CAP45319.1| 50S ribosomal protein L10 [Bordetella petrii]
          Length = 174

 Score = 98.2 bits (243), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 53/168 (31%), Positives = 95/168 (56%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           +NRQ K+V I E+S   + + SIV+A Y+G+ VA +  LRK  RE+G  ++V KN L + 
Sbjct: 3   LNRQEKAVVIEEVSAAVAKAQSIVIAEYRGLDVASVTVLRKTARESGVYLRVLKNTLARR 62

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A+  T+   +S+   G  +   S+ PV A K+   F+  N++  +  G +   +LNQ+ +
Sbjct: 63  AVAGTAFEPLSEQLTGPLIYGISEDPVSAAKVLAGFAKSNDKLVIKAGSLPNNLLNQEGV 122

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDK 168
           K +A++P  E + + ++  +Q+   + VR L    T+  R ++A  D+
Sbjct: 123 KALATMPSREELLSKLLGTMQAPIAQFVRTLNEVPTKFARGLAAVRDQ 170


>gi|254468888|ref|ZP_05082294.1| ribosomal protein L10 [beta proteobacterium KB13]
 gi|207087698|gb|EDZ64981.1| ribosomal protein L10 [beta proteobacterium KB13]
          Length = 175

 Score = 97.4 bits (241), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 54/170 (31%), Positives = 96/170 (56%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           +N + K   ++E+SK   S+ ++++A Y+G+ VAQ+ DLR K RE+G  ++V KN LVK 
Sbjct: 3   LNLEEKKAVVAEVSKQVESAQALILAEYRGVGVAQLTDLRSKARESGVYLRVLKNTLVKR 62

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A+  T    +S    G  +   S+ PV   K+  +F+ +N+ F +  G +    +++  I
Sbjct: 63  AVEGTPFADLSGDMTGPLIFGMSEDPVAVAKVLNNFAKENDLFVIKSGALPNEKMDEAKI 122

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQ 170
           K +ASLP  E + A ++  +Q+   + VR L    T+ VR ++A  D+ +
Sbjct: 123 KALASLPSREELLAKLMGTMQAPIAKFVRTLNEVPTKFVRGLAAVRDQKE 172


>gi|226309795|ref|YP_002769689.1| 50S ribosomal protein L10 [Brevibacillus brevis NBRC 100599]
 gi|226092743|dbj|BAH41185.1| 50S ribosomal protein L10 [Brevibacillus brevis NBRC 100599]
          Length = 171

 Score = 97.4 bits (241), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 49/141 (34%), Positives = 87/141 (61%), Gaps = 1/141 (0%)

Query: 3   RQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAI 62
           R+ K   I+E++     S + VVA Y+G++VAQ+ +LRK++REAG   +V KN L ++A 
Sbjct: 10  REEKVQAINEIAAKLRESQTTVVADYRGLTVAQVTELRKQLREAGVEFQVLKNSLTRLAT 69

Query: 63  RDTSIRGISDLFVGQSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIK 121
              S+  +     G + + +S   +IAP K+   F+  N++  + GGV+E  V++ + IK
Sbjct: 70  EKESLTELDQYLTGPNALAFSKDDIIAPAKVIAEFAKKNDKLEIKGGVIEGKVVDAEQIK 129

Query: 122 QIASLPDLEGIRAGIISAIQS 142
            +ASLP+ EG+ + ++S +Q+
Sbjct: 130 ALASLPNREGLLSMLLSVLQA 150


>gi|153005084|ref|YP_001379409.1| ribosomal protein L10 [Anaeromyxobacter sp. Fw109-5]
 gi|166229701|sp|A7HCH9|RL10_ANADF RecName: Full=50S ribosomal protein L10
 gi|152028657|gb|ABS26425.1| ribosomal protein L10 [Anaeromyxobacter sp. Fw109-5]
          Length = 174

 Score = 97.1 bits (240), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 55/165 (33%), Positives = 91/165 (55%), Gaps = 1/165 (0%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           MNR  K   I EL +  + + + ++A  KG++VA + +LR+K+REA    ++ KN L   
Sbjct: 1   MNRTEKEQVIGELHEKMAMAKAAILAEPKGLNVATVTELRRKLREAKVEYRIVKNTLAAR 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
           A + T +  I++ FVG + +V S   V+ P K+   F  D   F +   V+E  V++   
Sbjct: 61  AAKGTPVESIAEKFVGPTALVMSYDDVVTPAKLLADFMKDRENFTIRTAVIEGRVVDAKG 120

Query: 120 IKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISA 164
           I+ +A +P L+ +R  I + I   AT+L R+LG P  Q+ R + A
Sbjct: 121 IQSLAKMPGLQELRGQIAAMIAQPATQLARVLGAPGQQLARVLGA 165


>gi|33591286|ref|NP_878930.1| 50S ribosomal protein L10 [Bordetella pertussis Tohama I]
 gi|33594735|ref|NP_882378.1| 50S ribosomal protein L10 [Bordetella parapertussis 12822]
 gi|33599005|ref|NP_886565.1| 50S ribosomal protein L10 [Bordetella bronchiseptica RB50]
 gi|61215255|sp|Q7W0S1|RL10_BORPE RecName: Full=50S ribosomal protein L10
 gi|61215256|sp|Q7W2H1|RL10_BORPA RecName: Full=50S ribosomal protein L10
 gi|61215258|sp|Q7WRE1|RL10_BORBR RecName: Full=50S ribosomal protein L10
 gi|33564811|emb|CAE39753.1| 50S ribosomal protein L10 [Bordetella parapertussis]
 gi|33570928|emb|CAE40392.1| 50S ribosomal protein L10 [Bordetella pertussis Tohama I]
 gi|33575051|emb|CAE30514.1| 50S ribosomal protein L10 [Bordetella bronchiseptica RB50]
          Length = 174

 Score = 97.1 bits (240), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 54/168 (32%), Positives = 94/168 (55%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           +NRQ K+V I E+S   + + SIV+A Y+G+ VA +  LRK  RE+G  ++V KN LV+ 
Sbjct: 3   LNRQEKAVVIEEVSAQVAKAQSIVIAEYRGLDVASVTVLRKTARESGVYLRVLKNTLVRR 62

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A+  T+   +S+   G  +   S  PV A K+   F+  N++  +  G +   +L QD +
Sbjct: 63  AVAGTAFEPLSEQLTGPLIYGISADPVAAAKVLAGFAKSNDKLVIKAGSLPNSLLTQDGV 122

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDK 168
           K +A++P  E + + ++  +Q+   + VR L    T+  R ++A  D+
Sbjct: 123 KALATMPSREELLSKLLGTMQAPIAQFVRTLNEVPTKFARGLAAVRDQ 170


>gi|311109627|ref|YP_003982480.1| 50S ribosomal protein L10 [Achromobacter xylosoxidans A8]
 gi|310764316|gb|ADP19765.1| ribosomal protein L10 [Achromobacter xylosoxidans A8]
          Length = 174

 Score = 97.1 bits (240), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 53/168 (31%), Positives = 94/168 (55%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           +NRQ K+V I E+S   + + SIV+A Y+G+ VA +  LRK  RE+G  ++V KN L + 
Sbjct: 3   LNRQEKAVVIEEVSAEVAKAQSIVIAEYRGLDVASVTVLRKTARESGVYLRVLKNSLARR 62

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A+  T+   +++   G  +   S  PV A K+   F+  N++  +  G +   +LNQD +
Sbjct: 63  AVAGTAFEPLAEQLTGPLIYGISADPVSAAKVLAGFAKSNDKLVIKAGALPNSLLNQDGV 122

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDK 168
           K +A++P  E + + ++  +Q+   + VR L    T+  R ++A  D+
Sbjct: 123 KALATMPSREELLSKLLGTMQAPIAQFVRTLNEVPTKFARGLAAVRDQ 170


>gi|239825682|ref|YP_002948306.1| 50S ribosomal protein L10 [Geobacillus sp. WCH70]
 gi|259645483|sp|C5D3Q6|RL10_GEOSW RecName: Full=50S ribosomal protein L10
 gi|239805975|gb|ACS23040.1| ribosomal protein L10 [Geobacillus sp. WCH70]
          Length = 166

 Score = 96.7 bits (239), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 46/134 (34%), Positives = 84/134 (62%), Gaps = 1/134 (0%)

Query: 10  ISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRG 69
           ++E+++ F +S S V+  Y+G++VA++ +LRK++REAG   KV KN L + A+ +  + G
Sbjct: 12  VAEIAEKFRASKSTVIVDYRGLNVAEVTELRKRLREAGVEFKVYKNTLTRRALAEVGLEG 71

Query: 70  ISDLFVGQSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASLPD 128
           ++D+F G + I +S   V+AP KI   F+ D+    +  GV+E  +   + I  +A LP 
Sbjct: 72  LNDVFTGPNAIAFSKEDVVAPAKILSEFAKDHEALEIKAGVIEGNIATLEEINALAKLPS 131

Query: 129 LEGIRAGIISAIQS 142
            EG+ + ++S +Q+
Sbjct: 132 REGLLSMLLSVLQA 145


>gi|317401594|gb|EFV82221.1| 50S ribosomal protein L10 [Achromobacter xylosoxidans C54]
          Length = 174

 Score = 96.3 bits (238), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 52/168 (30%), Positives = 94/168 (55%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           +NRQ K+V I E+S   + + SIV+A Y+G+ VA +  LRK  RE+G  ++V KN L + 
Sbjct: 3   LNRQEKAVVIEEVSAEVAKAQSIVIAEYRGLDVASVTVLRKTARESGVYLRVLKNSLARR 62

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A+  T+   +++   G  +   S  PV A K+   F+  N++  +  G +   +LNQ+ +
Sbjct: 63  AVAGTAFEPLAEQLTGPLIYGISADPVTAAKVLAGFAKSNDKLVIKAGALPNSLLNQEGV 122

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDK 168
           K +A++P  E + + ++  +Q+   + VR L    T+  R ++A  D+
Sbjct: 123 KALATMPSREELLSKLLGTMQAPIAQFVRTLNEVPTKFARGLAAVRDQ 170


>gi|197253675|gb|ACH54172.1| 50S ribosomal subunit protein L10 [Candidatus Liberibacter
           solanacearum]
          Length = 68

 Score = 95.9 bits (237), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 45/67 (67%), Positives = 59/67 (88%)

Query: 105 VLGGVVEKGVLNQDSIKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISA 164
           +LGG++EK +L QDSIK+IASLP++E IR+GI+SAIQS+ATRLV LL TPQ Q+VR +SA
Sbjct: 1   ILGGILEKDMLTQDSIKKIASLPNIEEIRSGILSAIQSSATRLVMLLETPQNQIVRVLSA 60

Query: 165 FVDKNQQ 171
           F +KN+Q
Sbjct: 61  FEEKNRQ 67


>gi|256257708|ref|ZP_05463244.1| 50S ribosomal protein L10 [Brucella abortus bv. 9 str. C68]
          Length = 106

 Score = 95.9 bits (237), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 42/103 (40%), Positives = 65/103 (63%)

Query: 68  RGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASLP 127
            GI+DLF GQ+++ Y++ P+ APK++V F+  N++  +LGG +    LN D +K +ASLP
Sbjct: 2   EGIADLFTGQTVVAYANDPITAPKVAVEFAKANDKLVILGGAMGATTLNADGVKSLASLP 61

Query: 128 DLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQ 170
            L+ +RA ++  IQ+ A RL  L   P  Q+ R I A   KN+
Sbjct: 62  SLDELRAKLVGMIQTPAQRLAVLTSAPAGQIARVIGAHARKNE 104


>gi|282857088|ref|ZP_06266334.1| LSU ribosomal protein L10P [Pyramidobacter piscolens W5455]
 gi|282585023|gb|EFB90345.1| LSU ribosomal protein L10P [Pyramidobacter piscolens W5455]
          Length = 176

 Score = 95.5 bits (236), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 62/175 (35%), Positives = 101/175 (57%), Gaps = 5/175 (2%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M  Q K  +++EL ++F+ + ++ VA Y+G++VAQ   LRK +R AGG  KVA+NRL +I
Sbjct: 1   MPAQYKVDQVAELKELFNGAEAVFVAEYRGLTVAQASALRKAIRAAGGQAKVARNRLAEI 60

Query: 61  AIRDTSIRGISDLFVGQSLIVY--SDSPVIAPKISVSFSN--DNNEFRVLGGVVEKGVLN 116
           A+ +  +     +  G +L V   ++SP +A  I   FS   +N  F + GGV+ K +L 
Sbjct: 61  ALDEVGLAKDVKMMKGPNLYVVAAANSPAVAKAIK-DFSEVKENAAFVIKGGVMGKNLLG 119

Query: 117 QDSIKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQQ 171
            D++K +AS+P  E + A  + +I S    LV +L      +V A+SA  DK ++
Sbjct: 120 LDNVKALASMPSREELVAKAVGSIASPLRGLVTVLSGLPRGLVTALSAIADKKKE 174


>gi|312869698|ref|ZP_07729845.1| ribosomal protein L10 [Lactobacillus oris PB013-T2-3]
 gi|311094747|gb|EFQ53044.1| ribosomal protein L10 [Lactobacillus oris PB013-T2-3]
          Length = 166

 Score = 95.5 bits (236), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 49/164 (29%), Positives = 91/164 (55%), Gaps = 12/164 (7%)

Query: 10  ISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRG 69
           + + + + +++ S +V  Y+G++VA++ DLRK++R+AG  + V KN+++  A+  T    
Sbjct: 13  VKQTADLINAAQSAIVVDYRGLTVAEVTDLRKQLRDAGVKMSVIKNKILDRAVEGTDYED 72

Query: 70  ISDLFVGQSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASLPD 128
           +   FVG + + +SD   IAP KI   F++D++   + GG +EK V   D I + A++P 
Sbjct: 73  LRSTFVGPTAVAFSDEDPIAPAKILKKFADDHDALEIKGGFIEKSVKTLDEINEYATMPS 132

Query: 129 LEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQQG 172
            E + + + SA+Q            P  ++ RA+ A  DK  + 
Sbjct: 133 REDLLSMLASALQD-----------PMRKIARAVKAVADKEDEA 165


>gi|227529499|ref|ZP_03959548.1| ribosomal protein L10 [Lactobacillus vaginalis ATCC 49540]
 gi|227350584|gb|EEJ40875.1| ribosomal protein L10 [Lactobacillus vaginalis ATCC 49540]
          Length = 166

 Score = 95.5 bits (236), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 49/159 (30%), Positives = 90/159 (56%), Gaps = 12/159 (7%)

Query: 15  KIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRGISDLF 74
           ++ +++ S +V  Y+G++VA++ DLRK++R+AG  + V KN+++  A+  T    +   F
Sbjct: 18  ELINNAESAIVVDYRGLTVAEVTDLRKQLRDAGVKMSVIKNKILDRAVEGTDYEDLKSTF 77

Query: 75  VGQSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASLPDLEGIR 133
           VG + + +SD   IAP KI  +F++D++   + GG +EK V   D I + A++P  E + 
Sbjct: 78  VGPTAVAFSDEDPIAPAKILKNFADDHDALEIKGGFIEKSVKTLDEINEYATMPSREDLL 137

Query: 134 AGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQQG 172
           + + SA+Q            P  ++ RA+ A  DK  + 
Sbjct: 138 SMLASALQD-----------PMRKIARAVKAVADKEDEA 165


>gi|187476525|ref|YP_784549.1| 50S ribosomal protein L10 [Bordetella avium 197N]
 gi|115421111|emb|CAJ47595.1| 50S ribosomal protein L10 [Bordetella avium 197N]
          Length = 174

 Score = 95.1 bits (235), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 52/168 (30%), Positives = 94/168 (55%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           +NRQ K+V I E+S   + + SIV+A Y+G+ VA +  LRK  RE+G  ++V KN L + 
Sbjct: 3   LNRQEKAVVIEEVSAEVAKAQSIVIAEYRGLDVASVTVLRKTARESGVYLRVLKNSLARR 62

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A+  T+   +++   G  +   S  PV A K+   F+  N++  +  G +   +LNQ+ +
Sbjct: 63  AVAGTAFEPLAEQLTGPLIYGISADPVAAAKVLAGFAKSNDKLVIKAGSLPNNLLNQEGV 122

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDK 168
           K +A++P  E + + ++  +Q+   + VR L    T+  R ++A  D+
Sbjct: 123 KALATMPSREELLSKLLGTMQAPIAQFVRTLNEVPTKFARGLAAVRDQ 170


>gi|227825218|ref|ZP_03990050.1| 50S ribosomal protein L10 [Acidaminococcus sp. D21]
 gi|226905717|gb|EEH91635.1| 50S ribosomal protein L10 [Acidaminococcus sp. D21]
          Length = 178

 Score = 95.1 bits (235), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 53/170 (31%), Positives = 91/170 (53%), Gaps = 1/170 (0%)

Query: 3   RQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAI 62
           R  K+ ++SEL  + + S  +++  Y G++VA+  DLR+KMREAG    VAKN  V+IA 
Sbjct: 6   RPEKAAKVSELKDLMTGSKGVILVDYCGLTVAEDTDLRRKMREAGVTYMVAKNTFVRIAA 65

Query: 63  RDTSIRGISDLFVGQSLIVYS-DSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSIK 121
           ++  I G+       + + +S + PV   KI   F+ D+    +  G+++  V+  D +K
Sbjct: 66  KEAGIEGLDSFLEHNTALAFSAEDPVAPAKILSEFAKDHKALEIKAGILDGAVIGLDEVK 125

Query: 122 QIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQQ 171
            +A LP  E + A +I ++Q+  + LV +L       V  + A   K +Q
Sbjct: 126 ALADLPSREVLLAKLIGSMQAPISGLVNVLHGTLRNFVYVVDAVRQKKEQ 175


>gi|295401931|ref|ZP_06811894.1| ribosomal protein L10 [Geobacillus thermoglucosidasius C56-YS93]
 gi|312109250|ref|YP_003987566.1| ribosomal protein L10 [Geobacillus sp. Y4.1MC1]
 gi|294976061|gb|EFG51676.1| ribosomal protein L10 [Geobacillus thermoglucosidasius C56-YS93]
 gi|311214351|gb|ADP72955.1| ribosomal protein L10 [Geobacillus sp. Y4.1MC1]
          Length = 166

 Score = 95.1 bits (235), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 46/134 (34%), Positives = 84/134 (62%), Gaps = 1/134 (0%)

Query: 10  ISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRG 69
           ++E++  F +S S V+  Y+G++VA+I +LRK++REAG   KV KN L + A+ +  + G
Sbjct: 12  VAEIADKFRASKSTVIVDYRGLNVAEITELRKRLREAGVEFKVYKNTLTRRALAEVGLEG 71

Query: 70  ISDLFVGQSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASLPD 128
           ++D+F G + I +S+  V+AP KI   F+ ++    +  GV+E  +   + I  +A LP 
Sbjct: 72  LNDVFTGPNAIAFSNEDVVAPAKILSEFAKEHEALEIKAGVIEGNIATIEEINALAKLPS 131

Query: 129 LEGIRAGIISAIQS 142
            EG+ + ++S +Q+
Sbjct: 132 REGLLSMLLSVLQA 145


>gi|293602650|ref|ZP_06685092.1| 50S ribosomal protein L10 [Achromobacter piechaudii ATCC 43553]
 gi|292818960|gb|EFF77999.1| 50S ribosomal protein L10 [Achromobacter piechaudii ATCC 43553]
          Length = 174

 Score = 94.7 bits (234), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 52/168 (30%), Positives = 93/168 (55%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           +NRQ K+V I E+S   + + SIV+A Y+G+ VA +  LRK  RE+G  ++V KN L + 
Sbjct: 3   LNRQEKAVVIEEVSAEVAKAQSIVIAEYRGLDVASVTVLRKTARESGVYLRVLKNSLARR 62

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A+  T+   +++   G  +   S  PV A K+   F+  N++  +  G +   +L QD +
Sbjct: 63  AVAGTAFEPLAEQLTGPLIYGISTDPVSAAKVIAGFAKSNDKLVIKAGALPNSLLTQDGV 122

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDK 168
           K +A++P  E + + ++  +Q+   + VR L    T+  R ++A  D+
Sbjct: 123 KALATMPSREELLSKLLGTMQAPIAQFVRTLNEVPTKFARGLAAVRDQ 170


>gi|289450077|ref|YP_003475545.1| 50S ribosomal protein L10 [Clostridiales genomosp. BVAB3 str.
           UPII9-5]
 gi|289184624|gb|ADC91049.1| ribosomal protein L10 [Clostridiales genomosp. BVAB3 str. UPII9-5]
          Length = 181

 Score = 94.7 bits (234), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 47/147 (31%), Positives = 89/147 (60%), Gaps = 1/147 (0%)

Query: 6   KSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDT 65
           K  E+S+L++ F ++ +++VA+Y+G++VAQ  +LRK +REAG   KV KN +  +A+R+ 
Sbjct: 10  KKAEVSKLAEAFKNAQTLIVANYRGLTVAQDTELRKALREAGVHYKVVKNTMATLAVREA 69

Query: 66  SIRGISDLFVGQSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIA 124
            I G+ ++F G + + YSD+  +AP K+   FS       + GG  E   +  D ++++A
Sbjct: 70  GIEGLEEVFNGPTAVAYSDNDPVAPAKVIKDFSKKFELLEIKGGATEGKAIGLDVVERLA 129

Query: 125 SLPDLEGIRAGIISAIQSNATRLVRLL 151
           ++P  E +   ++  + S  + L R++
Sbjct: 130 AIPSRETLLTQLVFTLASPISGLARVI 156


>gi|56418630|ref|YP_145948.1| 50S ribosomal protein L10 [Geobacillus kaustophilus HTA426]
 gi|261417596|ref|YP_003251278.1| 50S ribosomal protein L10 [Geobacillus sp. Y412MC61]
 gi|297528471|ref|YP_003669746.1| ribosomal protein L10 [Geobacillus sp. C56-T3]
 gi|319765254|ref|YP_004130755.1| ribosomal protein L10 [Geobacillus sp. Y412MC52]
 gi|61214676|sp|Q5L419|RL10_GEOKA RecName: Full=50S ribosomal protein L10
 gi|56378472|dbj|BAD74380.1| 50S ribosomal protein L10 [Geobacillus kaustophilus HTA426]
 gi|261374053|gb|ACX76796.1| ribosomal protein L10 [Geobacillus sp. Y412MC61]
 gi|297251723|gb|ADI25169.1| ribosomal protein L10 [Geobacillus sp. C56-T3]
 gi|317110120|gb|ADU92612.1| ribosomal protein L10 [Geobacillus sp. Y412MC52]
          Length = 166

 Score = 94.7 bits (234), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 50/163 (30%), Positives = 93/163 (57%), Gaps = 12/163 (7%)

Query: 10  ISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRG 69
           ++E++  F +S + V+  Y+G++VA++ +LRK++REAG   KV KN L + A+ +  + G
Sbjct: 12  VAEIADKFRASKATVIVDYRGLNVAEMTELRKQLREAGVEFKVYKNTLTRRALAEVGLEG 71

Query: 70  ISDLFVGQSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASLPD 128
           + ++F G + I +S+  V+AP KI   F+  +    + GGV+E  + +++ I  +A LP 
Sbjct: 72  LDEVFTGPNAIAFSNEDVVAPAKILSEFAKTHEALEIKGGVIEGNIASKEEIDALAKLPS 131

Query: 129 LEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQQ 171
            EG+ + ++S +Q+           P      AI A  DK ++
Sbjct: 132 REGLLSMLLSVLQA-----------PIRNFALAIKAVADKQEE 163


>gi|148543550|ref|YP_001270920.1| 50S ribosomal protein L10 [Lactobacillus reuteri DSM 20016]
 gi|184152957|ref|YP_001841298.1| 50S ribosomal protein L10 [Lactobacillus reuteri JCM 1112]
 gi|194468097|ref|ZP_03074083.1| ribosomal protein L10 [Lactobacillus reuteri 100-23]
 gi|227363493|ref|ZP_03847613.1| ribosomal protein L10 [Lactobacillus reuteri MM2-3]
 gi|227545174|ref|ZP_03975223.1| ribosomal protein L10 [Lactobacillus reuteri CF48-3A]
 gi|300909151|ref|ZP_07126612.1| 50S ribosomal protein L10 [Lactobacillus reuteri SD2112]
 gi|325681900|ref|ZP_08161418.1| 50S ribosomal protein L10 [Lactobacillus reuteri MM4-1A]
 gi|166981703|sp|A5VIA9|RL10_LACRD RecName: Full=50S ribosomal protein L10
 gi|226699967|sp|B2G5T6|RL10_LACRJ RecName: Full=50S ribosomal protein L10
 gi|148530584|gb|ABQ82583.1| LSU ribosomal protein L10P [Lactobacillus reuteri DSM 20016]
 gi|183224301|dbj|BAG24818.1| 50S ribosomal protein L10 [Lactobacillus reuteri JCM 1112]
 gi|194452950|gb|EDX41848.1| ribosomal protein L10 [Lactobacillus reuteri 100-23]
 gi|227071430|gb|EEI09733.1| ribosomal protein L10 [Lactobacillus reuteri MM2-3]
 gi|227184857|gb|EEI64928.1| ribosomal protein L10 [Lactobacillus reuteri CF48-3A]
 gi|300893016|gb|EFK86375.1| 50S ribosomal protein L10 [Lactobacillus reuteri SD2112]
 gi|324978544|gb|EGC15493.1| 50S ribosomal protein L10 [Lactobacillus reuteri MM4-1A]
          Length = 166

 Score = 94.4 bits (233), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 49/164 (29%), Positives = 91/164 (55%), Gaps = 12/164 (7%)

Query: 10  ISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRG 69
           + + + + +++ S +V  Y+G++VA++ DLRK++R+AG  + V KN+++  A+  T    
Sbjct: 13  VKQTTDMLNAAQSAIVVDYRGLTVAEVTDLRKQLRDAGIQMSVIKNKILDRAVEGTDYED 72

Query: 70  ISDLFVGQSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASLPD 128
           +   FVG + + +SD   IAP KI   F++D++   + GG +EK V   D I + A++P 
Sbjct: 73  LRSTFVGPTAVAFSDEDPIAPAKILKKFADDHDALEIKGGFIEKSVKTLDEINEYANMPG 132

Query: 129 LEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQQG 172
            E + + + SA+Q            P  ++ RA+ A  DK  + 
Sbjct: 133 REELLSMLASALQD-----------PMRKIARAVKAIADKEDEA 165


>gi|262201117|ref|YP_003272325.1| 50S ribosomal protein L10 [Gordonia bronchialis DSM 43247]
 gi|262084464|gb|ACY20432.1| ribosomal protein L10 [Gordonia bronchialis DSM 43247]
          Length = 174

 Score = 94.4 bits (233), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 58/174 (33%), Positives = 94/174 (54%), Gaps = 3/174 (1%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M +  K   ++E+++ F  S + VV  Y+G+SV QI +LR+ + E G    VAKN LVK 
Sbjct: 1   MAKSDKVAAVAEIAEQFKGSTATVVTEYRGLSVTQITELRRSLGE-GATYSVAKNTLVKR 59

Query: 61  AIRDTSIRGISDLFVGQSLIVYSD-SPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
           A  +  + G+ +LF G + I + +  PV+A K   +F+ DN    + GG ++   L+   
Sbjct: 60  AAAEAGVEGLDELFTGPTAIAFIEGEPVVAAKAIKTFAKDNKALVIKGGYMDGRSLSVAE 119

Query: 120 IKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVD-KNQQG 172
           I+QIA L   E + A +  A++ N  +   L   P +QV R  +A  + KN+ G
Sbjct: 120 IEQIADLETREVLLAKLAGAMKGNLAKAAGLFNQPASQVARLAAALQEKKNEAG 173


>gi|227519497|ref|ZP_03949546.1| 50S ribosomal protein L10 [Enterococcus faecalis TX0104]
 gi|227073109|gb|EEI11072.1| 50S ribosomal protein L10 [Enterococcus faecalis TX0104]
          Length = 166

 Score = 93.6 bits (231), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 50/163 (30%), Positives = 94/163 (57%), Gaps = 12/163 (7%)

Query: 10  ISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRG 69
           + E ++ F S+ S+V+  Y+G++V ++ +LRK++REAG  +KV KN ++  A +   + G
Sbjct: 13  VQEAAEKFESAASVVIVDYRGLTVEEVTNLRKQLREAGVEMKVIKNSILSRAAKKVGLDG 72

Query: 70  ISDLFVGQSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASLPD 128
           + ++F G + + +S+  V+AP KI   F+ D     + GGV+E  V + + I  +A LP+
Sbjct: 73  LDEVFTGPTAVAFSNDDVVAPAKIIDEFAKDAKALEIKGGVIEGKVSSVEQITALAKLPN 132

Query: 129 LEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQQ 171
            EG+ + ++S +Q+           P   V  A+ A  +KN++
Sbjct: 133 REGLLSMLLSVLQA-----------PVRNVAYAVKAVAEKNEE 164


>gi|229542215|ref|ZP_04431275.1| ribosomal protein L10 [Bacillus coagulans 36D1]
 gi|229326635|gb|EEN92310.1| ribosomal protein L10 [Bacillus coagulans 36D1]
          Length = 166

 Score = 93.6 bits (231), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 46/134 (34%), Positives = 82/134 (61%), Gaps = 1/134 (0%)

Query: 10  ISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRG 69
           + E++  F SS ++VV  Y+G++VA++ +LRK++REAG   KV KN + + A+    + G
Sbjct: 12  VEEITDKFKSSTAVVVVDYRGLNVAEVTELRKQLREAGVEFKVYKNTMTRRAVEAAGLDG 71

Query: 70  ISDLFVGQSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASLPD 128
           ++ +  G + I +S   V+AP +I   F+ D+    +  GV+E  V   D IK +A+LP 
Sbjct: 72  LNSVMTGPNAIAFSTEDVVAPARILNDFAKDHEALEIKAGVIEGNVATVDEIKALATLPS 131

Query: 129 LEGIRAGIISAIQS 142
            EG+ + ++S +Q+
Sbjct: 132 REGLLSMLLSVLQA 145


>gi|256380620|ref|YP_003104280.1| ribosomal protein L10 [Actinosynnema mirum DSM 43827]
 gi|255924923|gb|ACU40434.1| ribosomal protein L10 [Actinosynnema mirum DSM 43827]
          Length = 184

 Score = 93.2 bits (230), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 59/171 (34%), Positives = 88/171 (51%), Gaps = 2/171 (1%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M +  K   ++ELS  F  S + VV  Y+G+S+AQ+  LR+ +  AG    VAKN LVK 
Sbjct: 1   MAKPSKVSAVAELSDKFRGSSAAVVTEYRGLSMAQLTTLRRALG-AGTTYTVAKNTLVKR 59

Query: 61  AIRDTSIRGISDLFVGQSLIVYSD-SPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
           A  D  + G+  L VG + I + +  PV A K    F+ DN    + GG ++   L+ D 
Sbjct: 60  AAEDAGVEGLEALLVGPTAIAFVEGEPVDAAKALRDFAKDNKALVIKGGYMDGRPLSVDE 119

Query: 120 IKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQ 170
           +  IA L   E + A +  A++ N  +   L   P +QV R  +A V+K Q
Sbjct: 120 VTAIADLESREVLLAKLAGAMKGNLAKAAGLFNAPASQVARLAAALVEKKQ 170


>gi|326382986|ref|ZP_08204675.1| 50S ribosomal protein L10 [Gordonia neofelifaecis NRRL B-59395]
 gi|326198122|gb|EGD55307.1| 50S ribosomal protein L10 [Gordonia neofelifaecis NRRL B-59395]
          Length = 176

 Score = 93.2 bits (230), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 54/171 (31%), Positives = 93/171 (54%), Gaps = 2/171 (1%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M +  K   ++E+++ F+ S + V+  Y+G++V Q++ LR+ + E G    VAKN LVK 
Sbjct: 1   MAKADKVSAVAEIAEQFNGSTAAVITEYRGLTVPQLQQLRRSLGE-GATYSVAKNTLVKR 59

Query: 61  AIRDTSIRGISDLFVGQSLIVYSD-SPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
           A  +  + G+ DLF G + I + +  PV+A K   +F+ DN    + GG ++   L+   
Sbjct: 60  AAAEAGLEGLDDLFTGPTAIAFIEGEPVVAAKAIKTFAKDNKNLVIKGGFMDGRALSVAE 119

Query: 120 IKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQ 170
           I+QIA L   E + A +  A++ N  +   L   P +QV R  +A  +K +
Sbjct: 120 IEQIADLETREVLLAKLAGAMKGNLAKAAGLFTQPASQVARLAAALQEKQE 170


>gi|138893774|ref|YP_001124227.1| 50S ribosomal protein L10 [Geobacillus thermodenitrificans NG80-2]
 gi|196251115|ref|ZP_03149794.1| ribosomal protein L10 [Geobacillus sp. G11MC16]
 gi|166229729|sp|A4IJH8|RL10_GEOTN RecName: Full=50S ribosomal protein L10
 gi|134265287|gb|ABO65482.1| Ribosomal protein L10 [Geobacillus thermodenitrificans NG80-2]
 gi|196209356|gb|EDY04136.1| ribosomal protein L10 [Geobacillus sp. G11MC16]
          Length = 166

 Score = 93.2 bits (230), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 49/163 (30%), Positives = 93/163 (57%), Gaps = 12/163 (7%)

Query: 10  ISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRG 69
           ++E++  F +S + V+  Y+G++VA++ +LRK++REAG   KV KN + + A+ +  + G
Sbjct: 12  VAEIADKFRASKATVIVDYRGLNVAEMTELRKQLREAGIEFKVYKNTMTRRALAEIGLEG 71

Query: 70  ISDLFVGQSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASLPD 128
           + ++F G + I +S+  V+AP KI   F+  +    + GGV+E  V +++ I  +A LP 
Sbjct: 72  LDEVFTGPNAIAFSNEDVVAPAKILSEFAKTHEALEIKGGVIEGSVASKEEIDALAKLPS 131

Query: 129 LEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQQ 171
            EG+ + ++S +Q+           P      A+ A  DK ++
Sbjct: 132 REGLLSMLLSVLQA-----------PIRNFALAVKAVADKQEE 163


>gi|240047795|ref|YP_002961183.1| 50S ribosomal protein L10 [Mycoplasma conjunctivae HRC/581]
 gi|239985367|emb|CAT05380.1| 50S ribosomal protein L10 [Mycoplasma conjunctivae]
          Length = 165

 Score = 92.4 bits (228), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 50/146 (34%), Positives = 85/146 (58%), Gaps = 1/146 (0%)

Query: 3   RQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAI 62
           R  K   ++E+  +  SS S+ +A Y+G++V +++DLRK+++ +G  VKV KNRL KIA 
Sbjct: 5   RAKKEQTVAEIKTLLQSSSSLAIAEYRGLTVNELEDLRKELKSSGTFVKVYKNRLFKIAA 64

Query: 63  RDTSIRGISDLFVGQSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIK 121
           ++    G++D  VG +L  +  +  IAP KI    S D     + GG+ E  V++   I+
Sbjct: 65  QELGFEGLADSLVGPNLFAFGSTDAIAPAKIIFKKSKDQPILVLKGGIYENHVVSSAEIQ 124

Query: 122 QIASLPDLEGIRAGIISAIQSNATRL 147
           +IA+LP+ E     + S++Q    +L
Sbjct: 125 EIATLPNFEEALTMLASSLQGGLKQL 150


>gi|220930955|ref|YP_002507863.1| ribosomal protein L10 [Halothermothrix orenii H 168]
 gi|254798383|sp|B8D0B4|RL10_HALOH RecName: Full=50S ribosomal protein L10
 gi|219992265|gb|ACL68868.1| ribosomal protein L10 [Halothermothrix orenii H 168]
          Length = 172

 Score = 92.4 bits (228), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 56/169 (33%), Positives = 93/169 (55%), Gaps = 12/169 (7%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M R  K   ++EL+   SS+ S+V+  YKG+ VA I +LR K+REAG   +V KN L +I
Sbjct: 1   MPRPEKEAVVNELTDKLSSAKSLVLTDYKGLDVATITELRAKLREAGVEYRVVKNTLARI 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
           A +   I  I+++ VG + I +     ++P K+ V F+ ++ E  + GGV+   V++ + 
Sbjct: 61  AAKKAEIEEINEVLVGPTAIAFGIEDAVSPAKVLVDFAKEHEELEIKGGVLNGEVIDDEK 120

Query: 120 IKQIASLPDLE--------GIRA---GIISAIQSNATRLVRLLGTPQTQ 157
           IK +A +P  E        G++A   G ++ +Q N   LV +L   + Q
Sbjct: 121 IKSLAKIPPREELLAKAFAGMKAPLTGFVNVLQGNIRNLVNVLNQIKDQ 169


>gi|23097564|ref|NP_691030.1| 50S ribosomal protein L10 [Oceanobacillus iheyensis HTE831]
 gi|29336685|sp|Q8ETZ1|RL10_OCEIH RecName: Full=50S ribosomal protein L10
 gi|22775787|dbj|BAC12065.1| 50S ribosomal protein L10 [Oceanobacillus iheyensis HTE831]
          Length = 166

 Score = 92.4 bits (228), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 46/134 (34%), Positives = 81/134 (60%), Gaps = 1/134 (0%)

Query: 10  ISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRG 69
           + E+++ F +S + VV  Y+G+ VA++  LRK++REAG   KV KN + + A+    +  
Sbjct: 12  VEEIAEKFRASQTAVVVDYRGLDVAEVTALRKELREAGIEFKVYKNTMTRRAVEAVELTD 71

Query: 70  ISDLFVGQSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASLPD 128
           ++D   G + I +S+  V+AP +I  +F  D+    + GGV+E  V   D IK +A LP+
Sbjct: 72  LNDTLTGPTAIAFSNDDVVAPARILNNFKKDHEALEIKGGVIEGQVATLDQIKDLADLPN 131

Query: 129 LEGIRAGIISAIQS 142
            EG+ + ++S +Q+
Sbjct: 132 YEGMVSMLLSVLQA 145


>gi|172056129|ref|YP_001812589.1| ribosomal protein L10 [Exiguobacterium sibiricum 255-15]
 gi|171988650|gb|ACB59572.1| ribosomal protein L10 [Exiguobacterium sibiricum 255-15]
          Length = 168

 Score = 92.4 bits (228), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 46/134 (34%), Positives = 86/134 (64%), Gaps = 1/134 (0%)

Query: 10  ISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRG 69
           +SE+++   +S   +V  Y+G++V ++ +LRK++REAG   KV KN L++ A   +++ G
Sbjct: 14  VSEIAEKMQASAGTIVVDYRGLTVDEVTELRKQLREAGVEFKVYKNGLLRRAAVQSNLEG 73

Query: 70  ISDLFVGQSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASLPD 128
           + ++F G + I +S+  VIAP KI  +FS D+    + GG++E  V + + +K +A LP 
Sbjct: 74  LDEVFTGPTAIAFSNEDVIAPAKILNNFSKDHKALELKGGIIEGKVTSVEDVKALAELPS 133

Query: 129 LEGIRAGIISAIQS 142
            EG+ + ++S +Q+
Sbjct: 134 REGLLSMLLSVLQA 147


>gi|108762259|ref|YP_631278.1| 50S ribosomal protein L10 [Myxococcus xanthus DK 1622]
 gi|122389068|sp|Q1D7U5|RL10_MYXXD RecName: Full=50S ribosomal protein L10
 gi|108466139|gb|ABF91324.1| ribosomal protein L10 [Myxococcus xanthus DK 1622]
          Length = 173

 Score = 92.4 bits (228), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 61/172 (35%), Positives = 91/172 (52%), Gaps = 2/172 (1%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M +  K   I EL + FS + S VVA +  + V  +  LRKK RE     KV KN L + 
Sbjct: 1   MLKSEKEEMIKELHEKFSRTTSAVVAEFTKVDVETVTKLRKKFREGNVEYKVIKNTLARR 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAP-KISVSFSND-NNEFRVLGGVVEKGVLNQD 118
           A + TS+  I+D F G   +  S   V+AP KI V F+ D  ++ ++   VVE   ++  
Sbjct: 61  AAQGTSVSVIADDFTGPVALCISYGDVVAPAKILVEFAKDIEDKIKIRTAVVEGRKVDVA 120

Query: 119 SIKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQ 170
            +K +A LP L  +RA ++  I   A++LVR +  P +Q+ R + A  DK Q
Sbjct: 121 GVKALAKLPGLPELRAQLLGVISEPASKLVRTIAAPGSQLARVVQANADKAQ 172


>gi|256854016|ref|ZP_05559381.1| ribosomal protein L10 [Enterococcus faecalis T8]
 gi|307290278|ref|ZP_07570194.1| ribosomal protein L10 [Enterococcus faecalis TX0411]
 gi|256710959|gb|EEU26002.1| ribosomal protein L10 [Enterococcus faecalis T8]
 gi|306498699|gb|EFM68200.1| ribosomal protein L10 [Enterococcus faecalis TX0411]
 gi|315030462|gb|EFT42394.1| ribosomal protein L10 [Enterococcus faecalis TX4000]
          Length = 166

 Score = 92.0 bits (227), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 49/156 (31%), Positives = 90/156 (57%), Gaps = 12/156 (7%)

Query: 17  FSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRGISDLFVG 76
           F S+ S+V+  Y+G++V ++ +LRK++REAG  +KV KN ++  A +   + G+ ++F G
Sbjct: 20  FESAASVVIVDYRGLTVEEVTNLRKQLREAGVEMKVIKNSILSRAAKKVGLDGLDEVFTG 79

Query: 77  QSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASLPDLEGIRAG 135
            + + +S+  V+AP KI   F+ D     + GGV+E  V + + I  +A LP+ EG+ + 
Sbjct: 80  PTAVAFSNDDVVAPAKIIDEFAKDAKALEIKGGVIEGKVSSVEQITALAKLPNREGLLSM 139

Query: 136 IISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQQ 171
           ++S +Q+           P   V  A+ A  +KN++
Sbjct: 140 LLSVLQA-----------PVRNVAYAVKAVAEKNEE 164


>gi|295113661|emb|CBL32298.1| LSU ribosomal protein L10P [Enterococcus sp. 7L76]
          Length = 166

 Score = 92.0 bits (227), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 49/156 (31%), Positives = 90/156 (57%), Gaps = 12/156 (7%)

Query: 17  FSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRGISDLFVG 76
           F S+ S+V+  Y+G++V ++ +LRK++REAG  +KV KN ++  A +   + G+ ++F G
Sbjct: 20  FESAASVVIVDYRGLTVEEVTNLRKQLREAGVEMKVIKNSILSRAAKKVGLDGLDEVFTG 79

Query: 77  QSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASLPDLEGIRAG 135
            + + +S+  V+AP KI   F+ D     + GGV+E  V + + I  +A LP+ EG+ + 
Sbjct: 80  PTAVAFSNDDVVAPAKIIDEFAKDAKALEIKGGVIEGKVSSVEQITALAKLPNREGLLSM 139

Query: 136 IISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQQ 171
           ++S +Q+           P   V  A+ A  +KN++
Sbjct: 140 LLSVLQA-----------PVRNVAYAVKAVAEKNEE 164


>gi|157690887|ref|YP_001485349.1| 50S ribosomal protein L10 [Bacillus pumilus SAFR-032]
 gi|194017504|ref|ZP_03056115.1| ribosomal protein L10 [Bacillus pumilus ATCC 7061]
 gi|166981503|sp|A8F972|RL10_BACP2 RecName: Full=50S ribosomal protein L10
 gi|157679645|gb|ABV60789.1| ribosomal protein L10 [Bacillus pumilus SAFR-032]
 gi|194010776|gb|EDW20347.1| ribosomal protein L10 [Bacillus pumilus ATCC 7061]
          Length = 166

 Score = 92.0 bits (227), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 47/138 (34%), Positives = 81/138 (58%), Gaps = 1/138 (0%)

Query: 6   KSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDT 65
           K V + E++  F  S S V+  Y+G+SV+++ +LRK++R+AG   KV KN L + A+   
Sbjct: 8   KKVVVDEITSKFKDSMSTVIVDYRGLSVSEVTELRKQLRDAGVEFKVYKNTLTRRAVEQV 67

Query: 66  SIRGISDLFVGQSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIA 124
            + G++D   G + I +S+  VIAP KI   F+  +    +  GV+E  V   + +K +A
Sbjct: 68  ELTGLNDFLTGPNAIAFSNEDVIAPAKIINEFAKSHEALEIKAGVIEGNVATVEEVKALA 127

Query: 125 SLPDLEGIRAGIISAIQS 142
            LP  EG+ + ++S +Q+
Sbjct: 128 ELPSREGLLSMLLSVLQA 145


>gi|253998005|ref|YP_003050068.1| 50S ribosomal protein L10 [Methylovorus sp. SIP3-4]
 gi|253984684|gb|ACT49541.1| ribosomal protein L10 [Methylovorus sp. SIP3-4]
          Length = 174

 Score = 91.7 bits (226), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 50/170 (29%), Positives = 95/170 (55%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           +N + K   ++E+S+  +++ +I++A Y+GI V  +  LR + R++G  ++V KN LV+ 
Sbjct: 3   LNLEQKKAVVAEVSEQVATAQAIILAEYRGIEVGDMTQLRAQARKSGVYLRVLKNTLVRR 62

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A+  T   G++D  VG  +   S  PV A K+   F+  N++F +  G +   V++  ++
Sbjct: 63  AVDGTPFSGLADAMVGPLVFGISTDPVAAAKVLSDFAKANDKFVIKAGAMPNQVMDAKAV 122

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQ 170
           + +ASLP  E + A ++  +Q+     VR L    T+  R ++A  D+ Q
Sbjct: 123 QALASLPSREELLAKLLGTMQAPIATFVRTLNEVPTKFARGLAAVRDQKQ 172


>gi|259502672|ref|ZP_05745574.1| 50S ribosomal protein L10 [Lactobacillus antri DSM 16041]
 gi|259169317|gb|EEW53812.1| 50S ribosomal protein L10 [Lactobacillus antri DSM 16041]
          Length = 166

 Score = 91.7 bits (226), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 46/164 (28%), Positives = 91/164 (55%), Gaps = 12/164 (7%)

Query: 10  ISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRG 69
           + + + + +++ + +V  Y+G++VA++ +LR+++R+AG  + V KN+++  A+  T    
Sbjct: 13  VKQTADLINAAETAIVVDYRGLTVAEVTELRQQLRDAGVKMSVIKNKILDRAVEGTDYED 72

Query: 70  ISDLFVGQSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASLPD 128
           +   FVG + + +SD   IAP KI   F++D++   + GG +EK V   D I + A++P 
Sbjct: 73  LRSTFVGPTAVAFSDEDPIAPAKILKKFADDHDALEIKGGFIEKSVKTLDEINEYATMPS 132

Query: 129 LEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQQG 172
            E + + + SA+Q            P  ++ RA+ A  DK  + 
Sbjct: 133 REDLLSMLASALQD-----------PMRKIARAVKAVADKEDEA 165


>gi|313884739|ref|ZP_07818494.1| ribosomal protein L10 [Eremococcus coleocola ACS-139-V-Col8]
 gi|312620000|gb|EFR31434.1| ribosomal protein L10 [Eremococcus coleocola ACS-139-V-Col8]
          Length = 177

 Score = 91.3 bits (225), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 49/168 (29%), Positives = 101/168 (60%), Gaps = 5/168 (2%)

Query: 4   QGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIR 63
           + K+ +++ +S+   +S S++V  Y G++VA++ +LRK++REAG  ++V KN +++ A +
Sbjct: 9   EEKAAQVAAISEKLQNSASVIVVDYLGLNVAEVTELRKQLREAGVEMQVLKNTILRRAAK 68

Query: 64  DTSIRGISDLFVGQSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQ 122
           D +I G+ + F G + + +S   ++AP KI   F+       + GG+VE  V N + I Q
Sbjct: 69  DANIEGLDEYFAGPTAVAFSSEDIVAPAKILSEFAKKAENLSIKGGLVEGKVANVEVINQ 128

Query: 123 IASLPDLEGIRAGIISAIQS---NATRLVRLLGTPQTQVVRAISAFVD 167
           +AS+P  E + A +   +Q+   N   +++ + +P  ++  A++A ++
Sbjct: 129 VASMPGREELLAMLAQVLQAPIRNTASVLQQM-SPALKMAYALNAVIE 175


>gi|302205468|gb|ADL09810.1| 50S ribosomal protein L10 [Corynebacterium pseudotuberculosis C231]
          Length = 171

 Score = 91.3 bits (225), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 54/164 (32%), Positives = 90/164 (54%), Gaps = 6/164 (3%)

Query: 10  ISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVK--VAKNRLVKIAIRDTSI 67
           ++EL + F+ + SIV+  Y+G++VAQI +LR+ +   G  V+  VAKN L+K+A ++  +
Sbjct: 10  LAELKERFADTDSIVITEYRGLTVAQITELRRSL---GADVQYSVAKNTLLKLAAKEAGV 66

Query: 68  RGISDLFVGQSLIVY-SDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASL 126
            G+ DL  G + I +     V A K    F+++N  F V GG ++   LN D +  IA L
Sbjct: 67  EGLDDLLSGPTAIAFIKGEAVDAAKAMKKFASNNKAFVVKGGYMDGDALNADQVNAIAEL 126

Query: 127 PDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQ 170
            + E   A +  A++ N  +   L   P +QV R  +A  +K +
Sbjct: 127 DNRETTLAKLAGAMKGNLAKAAGLFNAPASQVARLGAALQEKKE 170


>gi|25027049|ref|NP_737103.1| 50S ribosomal protein L10 [Corynebacterium efficiens YS-314]
 gi|259508468|ref|ZP_05751368.1| 50S ribosomal protein L10 [Corynebacterium efficiens YS-314]
 gi|29336732|sp|Q8FSA1|RL10_COREF RecName: Full=50S ribosomal protein L10
 gi|23492329|dbj|BAC17303.1| putative 50S ribosomal protein L10 [Corynebacterium efficiens
           YS-314]
 gi|259163932|gb|EEW48486.1| 50S ribosomal protein L10 [Corynebacterium efficiens YS-314]
          Length = 171

 Score = 91.3 bits (225), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 54/162 (33%), Positives = 86/162 (53%), Gaps = 6/162 (3%)

Query: 10  ISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVK--VAKNRLVKIAIRDTSI 67
           ++EL   F+ + SIV+  Y+G++VAQ  +LR+ +   G  V+  VAKN LVKIA ++  +
Sbjct: 10  LAELKAQFAETDSIVLTEYRGLTVAQTTELRRAL---GDDVQYSVAKNTLVKIAAQEAGV 66

Query: 68  RGISDLFVGQSLIVY-SDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASL 126
            G+ DL  G + + +     V   K+   F +DN  F V GG ++   L  D +K IA L
Sbjct: 67  EGLDDLLTGPTAVAFIKGEAVDTAKVLKKFGDDNKAFVVKGGYMDGNALTADQVKAIAEL 126

Query: 127 PDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDK 168
            + E   A +  A++ N  +   L   P +QV R  +A  +K
Sbjct: 127 DNRETTLAKLAGAMKGNLAKAAGLFNAPASQVARLAAALQEK 168


>gi|300857728|ref|YP_003782711.1| 50S ribosomal protein L10 [Corynebacterium pseudotuberculosis
           FRC41]
 gi|300685182|gb|ADK28104.1| 50S ribosomal protein L10 [Corynebacterium pseudotuberculosis
           FRC41]
 gi|302330021|gb|ADL20215.1| 50S ribosomal protein L10 [Corynebacterium pseudotuberculosis 1002]
 gi|308275704|gb|ADO25603.1| 50S ribosomal protein L10 [Corynebacterium pseudotuberculosis I19]
          Length = 206

 Score = 91.3 bits (225), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 54/164 (32%), Positives = 90/164 (54%), Gaps = 6/164 (3%)

Query: 10  ISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVK--VAKNRLVKIAIRDTSI 67
           ++EL + F+ + SIV+  Y+G++VAQI +LR+ +   G  V+  VAKN L+K+A ++  +
Sbjct: 45  LAELKERFADTDSIVITEYRGLTVAQITELRRSL---GADVQYSVAKNTLLKLAAKEAGV 101

Query: 68  RGISDLFVGQSLIVY-SDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASL 126
            G+ DL  G + I +     V A K    F+++N  F V GG ++   LN D +  IA L
Sbjct: 102 EGLDDLLSGPTAIAFIKGEAVDAAKAMKKFASNNKAFVVKGGYMDGDALNADQVNAIAEL 161

Query: 127 PDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQ 170
            + E   A +  A++ N  +   L   P +QV R  +A  +K +
Sbjct: 162 DNRETTLAKLAGAMKGNLAKAAGLFNAPASQVARLGAALQEKKE 205


>gi|329944328|ref|ZP_08292587.1| ribosomal protein L10 [Actinomyces sp. oral taxon 170 str. F0386]
 gi|328531058|gb|EGF57914.1| ribosomal protein L10 [Actinomyces sp. oral taxon 170 str. F0386]
          Length = 173

 Score = 91.3 bits (225), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 52/172 (30%), Positives = 92/172 (53%), Gaps = 4/172 (2%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGG-VKVAKNRLVK 59
           M R  K   ++ L+  F  + ++++  Y+G+SVAQ+K+LR+ +  AG     V KN L  
Sbjct: 1   MARPDKEAAVAALADKFRQADAVLLTEYRGLSVAQLKELRRSL--AGSAEYTVVKNTLAA 58

Query: 60  IAIRDTSIRGISDLFVGQSLIVY-SDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQD 118
           IA R   + G +D   G S + + +  PV A K    F+ +N +  + GGV++  VL+ D
Sbjct: 59  IAARQVGLEGFADDLTGPSALTFVTGEPVEAAKALRDFAKENQQLVIKGGVMDGAVLSAD 118

Query: 119 SIKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQ 170
            + ++ASL   E + A    A++++ ++   L   P +Q VR + A  +K +
Sbjct: 119 GVDKLASLESREVLLAKTAGAVKASLSKAAYLFAAPASQAVRTVDALREKQE 170


>gi|262197201|ref|YP_003268410.1| ribosomal protein L10 [Haliangium ochraceum DSM 14365]
 gi|262080548|gb|ACY16517.1| ribosomal protein L10 [Haliangium ochraceum DSM 14365]
          Length = 174

 Score = 91.3 bits (225), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 45/157 (28%), Positives = 91/157 (57%), Gaps = 2/157 (1%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M+R  K   ++E+    S+  S+VVA Y+G+ V  +  +R++ R+AG G +V KN L+KI
Sbjct: 1   MDRLAKEQVVNEMKGTMSNVMSVVVADYRGLDVPTVTHMREEFRKAGCGYRVVKNTLLKI 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYS-DSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
           A++ + +  +S L  G + +++S +SP    K+++ F+ +   F + GG  E  VL+ D 
Sbjct: 61  AVKGSDVEPLSSLLSGPTAVMWSNESPSAPAKLALQFAKEKKAFNIRGGYFEGQVLDMDG 120

Query: 120 IKQIASLPDLEGIRAGIISAIQSNATRLVR-LLGTPQ 155
           +++++ +P  + ++A ++    +     VR ++  PQ
Sbjct: 121 VERLSKMPGKQELQATLLMTFLAAPQNFVRQIIAAPQ 157


>gi|313200073|ref|YP_004038731.1| 50S ribosomal protein L10 [Methylovorus sp. MP688]
 gi|312439389|gb|ADQ83495.1| ribosomal protein L10 [Methylovorus sp. MP688]
          Length = 174

 Score = 91.3 bits (225), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 50/170 (29%), Positives = 95/170 (55%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           +N + K   ++E+S+  +++ +I++A Y+GI V  +  LR + R++G  ++V KN LV+ 
Sbjct: 3   LNLEQKKAVVAEVSEQVATAQAIILAEYRGIEVGDMTQLRAQARKSGVYLRVLKNTLVRR 62

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A+  T   G++D  VG  +   S  PV A K+   F+  N++F +  G +   V++  ++
Sbjct: 63  AVDGTPFFGLADAMVGPLVFGISTDPVAAAKVLSDFAKANDKFVIKAGAMPNQVMDAKAV 122

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQ 170
           + +ASLP  E + A ++  +Q+     VR L    T+  R ++A  D+ Q
Sbjct: 123 QALASLPSREELLAKLLGTMQAPIATFVRTLNEVPTKFARGLAAVRDQKQ 172


>gi|325288568|ref|YP_004264749.1| LSU ribosomal protein L10P [Syntrophobotulus glycolicus DSM 8271]
 gi|324963969|gb|ADY54748.1| LSU ribosomal protein L10P [Syntrophobotulus glycolicus DSM 8271]
          Length = 174

 Score = 91.3 bits (225), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 50/162 (30%), Positives = 91/162 (56%)

Query: 2   NRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIA 61
           N + K   + E+ +    S  +V+A Y+G++V+Q+  LR ++R+AG   +V KN +V+ A
Sbjct: 3   NYEEKQKIVDEIKEKLQESSGVVLADYRGMTVSQVTKLRVELRQAGIEYRVLKNTMVRRA 62

Query: 62  IRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSIK 121
             +  ++G+     G + + +S  PV   KI + F   N E ++  GVVE  V+  D IK
Sbjct: 63  ADEIGLQGLDPYLKGLTAVAFSADPVAPAKILIEFGKKNKELQIKAGVVEGQVVGADKIK 122

Query: 122 QIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAIS 163
            +A+LP  E + A +++ +Q+  + LV +L  P  ++V A+ 
Sbjct: 123 DLAALPSREVLLAQVLAGMQAPISGLVNVLQGPIRKMVYALE 164


>gi|222152112|ref|YP_002561272.1| 50S ribosomal protein L10 [Macrococcus caseolyticus JCSC5402]
 gi|254798386|sp|B9E8Q8|RL10_MACCJ RecName: Full=50S ribosomal protein L10
 gi|222121241|dbj|BAH18576.1| 50S ribosomal protein L10 [Macrococcus caseolyticus JCSC5402]
          Length = 172

 Score = 91.3 bits (225), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 53/159 (33%), Positives = 91/159 (57%), Gaps = 9/159 (5%)

Query: 6   KSVEISE-----LSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           K++EI +     +++   +S S ++  Y+G++VAQ+ +LRK++REAG   KV KN LV+ 
Sbjct: 4   KAIEIKQQKADVITEQLKNSVSTIIVDYRGLTVAQVTELRKQLREAGVEFKVYKNTLVRR 63

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
           +     I GI +   G + I +S   V+AP KI   F+ +N    +  G++E  V + + 
Sbjct: 64  SAAAAGIEGIDEFLTGPNAIAFSTEEVVAPAKIIADFAKENEALEIKAGIIEGTVTSAED 123

Query: 120 IKQIASLPDLEGIRAGIISAIQS---NATRLVRLLGTPQ 155
           +K IASLP  EG+ + ++S +Q+   N    V+ +G  Q
Sbjct: 124 VKAIASLPSKEGLISMVLSVLQAPIRNFAYAVKAVGEQQ 162


>gi|114778901|ref|ZP_01453698.1| 50S ribosomal protein L10 [Mariprofundus ferrooxydans PV-1]
 gi|114550870|gb|EAU53436.1| 50S ribosomal protein L10 [Mariprofundus ferrooxydans PV-1]
          Length = 172

 Score = 91.3 bits (225), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 53/170 (31%), Positives = 89/170 (52%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M +  K   + EL   +S S   +VA Y+G++V+++  LR+++REAG  ++V KN L + 
Sbjct: 1   MKKNDKQRIVDELHTAWSESTVGIVAQYRGLTVSEMGTLRRQLREAGVSLQVVKNTLARR 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A  DT  +   +LF G   I Y   PV   K    F+  +    V GGV++  +++   I
Sbjct: 61  AATDTGFKAAEELFTGPVAIAYGSEPVGMAKAISDFAKAHKALEVRGGVLDGKLIDVQGI 120

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQ 170
             +ASLP  E + A ++ ++QS  +  VR L       VR ++A  D+ +
Sbjct: 121 TALASLPSREVLLAKMLGSMQSPISGFVRTLSEVPASFVRTLAAVRDQKE 170


>gi|323490603|ref|ZP_08095808.1| 50S ribosomal protein L10 [Planococcus donghaensis MPA1U2]
 gi|323395695|gb|EGA88536.1| 50S ribosomal protein L10 [Planococcus donghaensis MPA1U2]
          Length = 166

 Score = 91.3 bits (225), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 46/140 (32%), Positives = 85/140 (60%), Gaps = 1/140 (0%)

Query: 4   QGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIR 63
           + K V +  ++  F+++ S+VV  Y+G++VAQ+ +LRK++REAG   KV KN + + A  
Sbjct: 6   ETKKVVVQTIADKFNAAASVVVVDYRGLNVAQLTELRKQLREAGVEFKVYKNSMTRRATE 65

Query: 64  DTSIRGISDLFVGQSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQ 122
              +  I++ F G + I +S+  V+AP +I  +F+  N    +  GV+E  V + + +K 
Sbjct: 66  MHGLEAINEHFTGPNAIAFSNEDVVAPARIINNFAKANEALEIKAGVIEGAVASAEDMKA 125

Query: 123 IASLPDLEGIRAGIISAIQS 142
           +A LP  EG+ + ++S +Q+
Sbjct: 126 LAELPSREGLLSMLLSVLQA 145


>gi|148284108|ref|YP_001248198.1| 50S ribosomal protein L10 [Orientia tsutsugamushi str. Boryong]
 gi|166230042|sp|A5CC95|RL10_ORITB RecName: Full=50S ribosomal protein L10
 gi|146739547|emb|CAM79276.1| 50S ribosomal protein L10 [Orientia tsutsugamushi str. Boryong]
          Length = 169

 Score = 90.9 bits (224), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 48/155 (30%), Positives = 87/155 (56%), Gaps = 1/155 (0%)

Query: 13  LSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRGISD 72
           L  I+ ++ +IV  HY G++VAQ+  +RK +R +G  +K+ KN L KIA+ +  I+  +D
Sbjct: 13  LEGIYKNANTIVAIHYHGLTVAQLTQIRKDLRVSGARLKIVKNTLAKIAVANLKIKQ-AD 71

Query: 73  LFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASLPDLEGI 132
           +F G   I YS+  +  PK+ + F++     +V+GG V++ V   + I+Q+ASL   E  
Sbjct: 72  IFSGPIAIAYSEDYITVPKVILRFADQYPSLKVVGGFVDQKVATMNDIEQLASLATSESH 131

Query: 133 RAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVD 167
           +   +S +Q    R   +   P  ++V  +  +V+
Sbjct: 132 KGNFLSLLQIPIRRFATVSHAPLVKLVTILKNYVN 166


>gi|184154747|ref|YP_001843087.1| 50S ribosomal protein L10 [Lactobacillus fermentum IFO 3956]
 gi|227514014|ref|ZP_03944063.1| ribosomal protein L10 [Lactobacillus fermentum ATCC 14931]
 gi|260663224|ref|ZP_05864116.1| 50S ribosomal protein L10 [Lactobacillus fermentum 28-3-CHN]
 gi|226699966|sp|B2GAC5|RL10_LACF3 RecName: Full=50S ribosomal protein L10
 gi|183226091|dbj|BAG26607.1| 50S ribosomal protein L10 [Lactobacillus fermentum IFO 3956]
 gi|227087600|gb|EEI22912.1| ribosomal protein L10 [Lactobacillus fermentum ATCC 14931]
 gi|260552416|gb|EEX25467.1| 50S ribosomal protein L10 [Lactobacillus fermentum 28-3-CHN]
          Length = 167

 Score = 90.9 bits (224), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 49/167 (29%), Positives = 93/167 (55%), Gaps = 12/167 (7%)

Query: 6   KSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDT 65
           K+ E+  ++    ++ S +V  Y+G++V ++ DLRK++R+A   + V KN++++ A+  T
Sbjct: 9   KAEEVKSVNAQLLAAESAIVVDYRGLTVEEVTDLRKQLRDANIKMSVIKNKILERAVEGT 68

Query: 66  SIRGISDLFVGQSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIA 124
               +   FVG + + +SD   IAP KI   F++D++   + GG++EK V   D+I + A
Sbjct: 69  DYEDLKATFVGPTAVAFSDEDPIAPAKILKKFADDHDALEIKGGIIEKKVQTLDAINEYA 128

Query: 125 SLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQQ 171
           ++P  E + + + SA+Q            P  ++ RA+ A  DK  +
Sbjct: 129 TMPGREDLLSMLASALQD-----------PMRKIARAVKAVADKGDE 164


>gi|228995489|ref|ZP_04155157.1| 50S ribosomal protein L10 [Bacillus mycoides Rock3-17]
 gi|229003114|ref|ZP_04160961.1| 50S ribosomal protein L10 [Bacillus mycoides Rock1-4]
 gi|228758129|gb|EEM07327.1| 50S ribosomal protein L10 [Bacillus mycoides Rock1-4]
 gi|228764218|gb|EEM13097.1| 50S ribosomal protein L10 [Bacillus mycoides Rock3-17]
          Length = 166

 Score = 90.9 bits (224), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 45/134 (33%), Positives = 81/134 (60%), Gaps = 1/134 (0%)

Query: 10  ISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRG 69
           ++E+++    S S +V  Y+G++VA+  +LRK +REAG   KV KN L + A     + G
Sbjct: 12  VTEIAEKLRESKSTIVVDYRGLTVAEATELRKNLREAGVEFKVYKNSLTRRAAESVEMAG 71

Query: 70  ISDLFVGQSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASLPD 128
           +++   G + I +S+  VIAP K+   F+ D+    +  GV+E  +++ D +K IA+LP 
Sbjct: 72  LNEFLTGPNAIAFSNEDVIAPAKVLNDFAKDHEALEIKAGVIEGKLVSLDEVKAIATLPS 131

Query: 129 LEGIRAGIISAIQS 142
            EG+ + ++S +Q+
Sbjct: 132 REGLLSMLLSVLQA 145


>gi|212637943|ref|YP_002314463.1| 50S ribosomal protein L10 [Anoxybacillus flavithermus WK1]
 gi|212559423|gb|ACJ32478.1| Ribosomal protein L10 [Anoxybacillus flavithermus WK1]
          Length = 184

 Score = 90.9 bits (224), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 43/134 (32%), Positives = 82/134 (61%), Gaps = 1/134 (0%)

Query: 10  ISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRG 69
           ++E+++   +S S ++  Y+G++VAQ+ +LRK++REAG   KV KN L + A+ +  + G
Sbjct: 30  VAEIAEKLRASKSTIIVDYRGLNVAQVTELRKQLREAGIEFKVYKNTLTRRAVAELGLEG 89

Query: 70  ISDLFVGQSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASLPD 128
           + +   G + I +S+  V+AP KI   F+  N   ++  G++E  V   + +K +A LP 
Sbjct: 90  LDETLTGPNAIAFSNDDVVAPAKILNEFAKKNEALKIKAGIIEGNVATFEEVKALAELPS 149

Query: 129 LEGIRAGIISAIQS 142
            EG+ + ++S +Q+
Sbjct: 150 REGLLSMLLSVLQA 163


>gi|189184703|ref|YP_001938488.1| 50S ribosomal protein L10 [Orientia tsutsugamushi str. Ikeda]
 gi|226699981|sp|B3CV57|RL10_ORITI RecName: Full=50S ribosomal protein L10
 gi|189181474|dbj|BAG41254.1| 50S ribosomal protein L10 [Orientia tsutsugamushi str. Ikeda]
          Length = 169

 Score = 90.9 bits (224), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 47/155 (30%), Positives = 87/155 (56%), Gaps = 1/155 (0%)

Query: 13  LSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRGISD 72
           L  I+ ++ +IV  HY G++VAQ+  +RK +R +G  +K+ KN L KIA+ +  ++ + D
Sbjct: 13  LEGIYKNANTIVAIHYHGLTVAQLTQIRKDLRVSGARLKIVKNTLAKIAVANLKVKQV-D 71

Query: 73  LFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASLPDLEGI 132
           +F G   I YS+  +  PK+ + F++     +V+GG V++ V   + I+Q+ASL   E  
Sbjct: 72  IFSGPIAIAYSEDYITVPKVILRFADQYPSLKVVGGFVDQKVATMNDIEQLASLATSESH 131

Query: 133 RAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVD 167
           +   +S +Q    R   +   P  ++V  +  +V+
Sbjct: 132 KGNFLSLLQIPIRRFATVSHAPLVKLVTILKNYVN 166


>gi|229824596|ref|ZP_04450665.1| hypothetical protein GCWU000282_01943 [Catonella morbi ATCC 51271]
 gi|229785967|gb|EEP22081.1| hypothetical protein GCWU000282_01943 [Catonella morbi ATCC 51271]
          Length = 166

 Score = 90.5 bits (223), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 45/138 (32%), Positives = 87/138 (63%), Gaps = 1/138 (0%)

Query: 6   KSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDT 65
           K  E+S++++   S+ S+VV  Y G++V ++ +LRK++R+ G  +KV KN +++ A    
Sbjct: 9   KQEEVSKVAEELKSAASVVVVDYLGLTVEEVTNLRKELRDNGVQMKVVKNTILRRAAAQA 68

Query: 66  SIRGISDLFVGQSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIA 124
            I G+   FVG + IV+S+S V+AP K+   F+    +  + GG++E    + + +K +A
Sbjct: 69  EIEGLDAHFVGPTAIVFSESEVVAPAKVIAEFAKKAEKLEIKGGLIEGKAASAEDVKALA 128

Query: 125 SLPDLEGIRAGIISAIQS 142
           +LPD +G+ + ++S +Q+
Sbjct: 129 ALPDRDGLLSMLLSVLQA 146


>gi|320532560|ref|ZP_08033367.1| ribosomal protein L10 [Actinomyces sp. oral taxon 171 str. F0337]
 gi|320135231|gb|EFW27372.1| ribosomal protein L10 [Actinomyces sp. oral taxon 171 str. F0337]
          Length = 173

 Score = 90.5 bits (223), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 52/172 (30%), Positives = 92/172 (53%), Gaps = 4/172 (2%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGG-VKVAKNRLVK 59
           M R  K   ++ L+  F  + ++++  Y+G+SVAQ+K+LR+ +  AG     V KN L  
Sbjct: 1   MARPDKEAAVAALADKFRQADAVLLTEYRGLSVAQLKELRRSL--AGNAEYTVVKNTLAA 58

Query: 60  IAIRDTSIRGISDLFVGQSLIVY-SDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQD 118
           IA R   + G +D   G S + + +  PV A K    F+ DN +  + GGV++  VL+ D
Sbjct: 59  IAARQVGLEGFADDLTGPSALTFVTGEPVEAAKALRDFAKDNQQLVIKGGVMDGTVLSAD 118

Query: 119 SIKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQ 170
            + ++ASL   E + A    A++++ ++   L   P ++ VR + A  +K +
Sbjct: 119 GVDKLASLESREVLLAKTAGAVKASLSKAAYLFAAPASKAVRTVDALREKQE 170


>gi|29377195|ref|NP_816349.1| 50S ribosomal protein L10 [Enterococcus faecalis V583]
 gi|227554203|ref|ZP_03984250.1| 50S ribosomal protein L10 [Enterococcus faecalis HH22]
 gi|229544900|ref|ZP_04433625.1| 50S ribosomal protein L10 [Enterococcus faecalis TX1322]
 gi|229549167|ref|ZP_04437892.1| 50S ribosomal protein L10 [Enterococcus faecalis ATCC 29200]
 gi|255971884|ref|ZP_05422470.1| 50S ribosomal protein L10 [Enterococcus faecalis T1]
 gi|255974879|ref|ZP_05425465.1| 50S ribosomal protein L10 [Enterococcus faecalis T2]
 gi|256616783|ref|ZP_05473629.1| 50S ribosomal protein L10 [Enterococcus faecalis ATCC 4200]
 gi|256763342|ref|ZP_05503922.1| 50S ribosomal protein L10 [Enterococcus faecalis T3]
 gi|256957944|ref|ZP_05562115.1| 50S ribosomal protein L10 [Enterococcus faecalis DS5]
 gi|256961036|ref|ZP_05565207.1| 50S ribosomal protein L10 [Enterococcus faecalis Merz96]
 gi|256963822|ref|ZP_05567993.1| 50S ribosomal protein L10 [Enterococcus faecalis HIP11704]
 gi|257079881|ref|ZP_05574242.1| 50S ribosomal protein L10 [Enterococcus faecalis JH1]
 gi|257081719|ref|ZP_05576080.1| 50S ribosomal protein L10 [Enterococcus faecalis E1Sol]
 gi|257084316|ref|ZP_05578677.1| 50S ribosomal protein L10 [Enterococcus faecalis Fly1]
 gi|257087685|ref|ZP_05582046.1| 50S ribosomal protein L10 [Enterococcus faecalis D6]
 gi|257090903|ref|ZP_05585264.1| 50S ribosomal protein L10 [Enterococcus faecalis CH188]
 gi|257416887|ref|ZP_05593881.1| 50S ribosomal protein L10 [Enterococcus faecalis AR01/DG]
 gi|257421670|ref|ZP_05598660.1| 50S ribosomal protein L10 [Enterococcus faecalis X98]
 gi|293384574|ref|ZP_06630440.1| ribosomal protein L10 [Enterococcus faecalis R712]
 gi|293386803|ref|ZP_06631374.1| ribosomal protein L10 [Enterococcus faecalis S613]
 gi|294779897|ref|ZP_06745279.1| ribosomal protein L10 [Enterococcus faecalis PC1.1]
 gi|300860427|ref|ZP_07106514.1| ribosomal protein L10 [Enterococcus faecalis TUSoD Ef11]
 gi|307269254|ref|ZP_07550608.1| ribosomal protein L10 [Enterococcus faecalis TX4248]
 gi|307271769|ref|ZP_07553040.1| ribosomal protein L10 [Enterococcus faecalis TX0855]
 gi|307276954|ref|ZP_07558064.1| ribosomal protein L10 [Enterococcus faecalis TX2134]
 gi|307278735|ref|ZP_07559802.1| ribosomal protein L10 [Enterococcus faecalis TX0860]
 gi|307288664|ref|ZP_07568645.1| ribosomal protein L10 [Enterococcus faecalis TX0109]
 gi|312900078|ref|ZP_07759395.1| ribosomal protein L10 [Enterococcus faecalis TX0470]
 gi|312902542|ref|ZP_07761748.1| ribosomal protein L10 [Enterococcus faecalis TX0635]
 gi|312906400|ref|ZP_07765408.1| ribosomal protein L10 [Enterococcus faecalis DAPTO 512]
 gi|312951891|ref|ZP_07770779.1| ribosomal protein L10 [Enterococcus faecalis TX0102]
 gi|312979441|ref|ZP_07791129.1| ribosomal protein L10 [Enterococcus faecalis DAPTO 516]
 gi|61215271|sp|Q830Q7|RL10_ENTFA RecName: Full=50S ribosomal protein L10
 gi|29344661|gb|AAO82419.1| ribosomal protein L10 [Enterococcus faecalis V583]
 gi|227176650|gb|EEI57622.1| 50S ribosomal protein L10 [Enterococcus faecalis HH22]
 gi|229305721|gb|EEN71717.1| 50S ribosomal protein L10 [Enterococcus faecalis ATCC 29200]
 gi|229310001|gb|EEN75988.1| 50S ribosomal protein L10 [Enterococcus faecalis TX1322]
 gi|255962902|gb|EET95378.1| 50S ribosomal protein L10 [Enterococcus faecalis T1]
 gi|255967751|gb|EET98373.1| 50S ribosomal protein L10 [Enterococcus faecalis T2]
 gi|256596310|gb|EEU15486.1| 50S ribosomal protein L10 [Enterococcus faecalis ATCC 4200]
 gi|256684593|gb|EEU24288.1| 50S ribosomal protein L10 [Enterococcus faecalis T3]
 gi|256948440|gb|EEU65072.1| 50S ribosomal protein L10 [Enterococcus faecalis DS5]
 gi|256951532|gb|EEU68164.1| 50S ribosomal protein L10 [Enterococcus faecalis Merz96]
 gi|256954318|gb|EEU70950.1| 50S ribosomal protein L10 [Enterococcus faecalis HIP11704]
 gi|256987911|gb|EEU75213.1| 50S ribosomal protein L10 [Enterococcus faecalis JH1]
 gi|256989749|gb|EEU77051.1| 50S ribosomal protein L10 [Enterococcus faecalis E1Sol]
 gi|256992346|gb|EEU79648.1| 50S ribosomal protein L10 [Enterococcus faecalis Fly1]
 gi|256995715|gb|EEU83017.1| 50S ribosomal protein L10 [Enterococcus faecalis D6]
 gi|256999715|gb|EEU86235.1| 50S ribosomal protein L10 [Enterococcus faecalis CH188]
 gi|257158715|gb|EEU88675.1| 50S ribosomal protein L10 [Enterococcus faecalis ARO1/DG]
 gi|257163494|gb|EEU93454.1| 50S ribosomal protein L10 [Enterococcus faecalis X98]
 gi|291078120|gb|EFE15484.1| ribosomal protein L10 [Enterococcus faecalis R712]
 gi|291083806|gb|EFE20769.1| ribosomal protein L10 [Enterococcus faecalis S613]
 gi|294453009|gb|EFG21429.1| ribosomal protein L10 [Enterococcus faecalis PC1.1]
 gi|300849466|gb|EFK77216.1| ribosomal protein L10 [Enterococcus faecalis TUSoD Ef11]
 gi|306500418|gb|EFM69754.1| ribosomal protein L10 [Enterococcus faecalis TX0109]
 gi|306504596|gb|EFM73799.1| ribosomal protein L10 [Enterococcus faecalis TX0860]
 gi|306506377|gb|EFM75537.1| ribosomal protein L10 [Enterococcus faecalis TX2134]
 gi|306511647|gb|EFM80646.1| ribosomal protein L10 [Enterococcus faecalis TX0855]
 gi|306514473|gb|EFM83034.1| ribosomal protein L10 [Enterococcus faecalis TX4248]
 gi|310627554|gb|EFQ10837.1| ribosomal protein L10 [Enterococcus faecalis DAPTO 512]
 gi|310630080|gb|EFQ13363.1| ribosomal protein L10 [Enterococcus faecalis TX0102]
 gi|310634212|gb|EFQ17495.1| ribosomal protein L10 [Enterococcus faecalis TX0635]
 gi|311287812|gb|EFQ66368.1| ribosomal protein L10 [Enterococcus faecalis DAPTO 516]
 gi|311292835|gb|EFQ71391.1| ribosomal protein L10 [Enterococcus faecalis TX0470]
 gi|315025516|gb|EFT37448.1| ribosomal protein L10 [Enterococcus faecalis TX2137]
 gi|315032566|gb|EFT44498.1| ribosomal protein L10 [Enterococcus faecalis TX0017]
 gi|315035089|gb|EFT47021.1| ribosomal protein L10 [Enterococcus faecalis TX0027]
 gi|315143892|gb|EFT87908.1| ribosomal protein L10 [Enterococcus faecalis TX2141]
 gi|315148679|gb|EFT92695.1| ribosomal protein L10 [Enterococcus faecalis TX4244]
 gi|315151753|gb|EFT95769.1| ribosomal protein L10 [Enterococcus faecalis TX0012]
 gi|315154319|gb|EFT98335.1| ribosomal protein L10 [Enterococcus faecalis TX0031]
 gi|315155580|gb|EFT99596.1| ribosomal protein L10 [Enterococcus faecalis TX0043]
 gi|315159588|gb|EFU03605.1| ribosomal protein L10 [Enterococcus faecalis TX0312]
 gi|315162119|gb|EFU06136.1| ribosomal protein L10 [Enterococcus faecalis TX0645]
 gi|315165285|gb|EFU09302.1| ribosomal protein L10 [Enterococcus faecalis TX1302]
 gi|315168699|gb|EFU12716.1| ribosomal protein L10 [Enterococcus faecalis TX1341]
 gi|315170484|gb|EFU14501.1| ribosomal protein L10 [Enterococcus faecalis TX1342]
 gi|315174948|gb|EFU18965.1| ribosomal protein L10 [Enterococcus faecalis TX1346]
 gi|315573834|gb|EFU86025.1| ribosomal protein L10 [Enterococcus faecalis TX0309B]
 gi|315579649|gb|EFU91840.1| ribosomal protein L10 [Enterococcus faecalis TX0630]
 gi|315580270|gb|EFU92461.1| ribosomal protein L10 [Enterococcus faecalis TX0309A]
 gi|323481640|gb|ADX81079.1| ribosomal protein L10 family protein [Enterococcus faecalis 62]
 gi|327535934|gb|AEA94768.1| 50S ribosomal protein L10 [Enterococcus faecalis OG1RF]
 gi|329578033|gb|EGG59447.1| ribosomal protein L10 [Enterococcus faecalis TX1467]
          Length = 166

 Score = 90.5 bits (223), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 48/156 (30%), Positives = 90/156 (57%), Gaps = 12/156 (7%)

Query: 17  FSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRGISDLFVG 76
           F S+ S+V+  Y+G++V ++ +LRK++R+AG  +KV KN ++  A +   + G+ ++F G
Sbjct: 20  FESAASVVIVDYRGLTVEEVTNLRKQLRDAGVEMKVIKNSILSRAAKKVGLDGLDEVFTG 79

Query: 77  QSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASLPDLEGIRAG 135
            + + +S+  V+AP KI   F+ D     + GGV+E  V + + I  +A LP+ EG+ + 
Sbjct: 80  PTAVAFSNDDVVAPAKIIDEFAKDAKALEIKGGVIEGKVSSVEQITALAKLPNREGLLSM 139

Query: 136 IISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQQ 171
           ++S +Q+           P   V  A+ A  +KN++
Sbjct: 140 LLSVLQA-----------PVRNVAYAVKAVAEKNEE 164


>gi|167043579|gb|ABZ08274.1| putative ribosomal protein L10 [uncultured marine microorganism
           HF4000_APKG2K17]
          Length = 174

 Score = 90.5 bits (223), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 52/172 (30%), Positives = 93/172 (54%), Gaps = 5/172 (2%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M R  K  ++SEL  IF++  + V+  Y+GI   Q+ +LRK++ +A   +KV KN L +I
Sbjct: 1   MERSQKEAKVSELRSIFNNMSAGVLVDYRGIEANQVVELRKQLNDASSTMKVLKNSLARI 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYSD-SPVIAPKISVSFSNDNNEFRVLGGVV----EKGVL 115
           A  DT    ++D F     +VYSD  PV+  K+    + + +  ++L G++    +  +L
Sbjct: 61  AAEDTPFSELADQFTQTRALVYSDGDPVVQAKVLSKAAKNIDNLKILAGILVGDSKTSIL 120

Query: 116 NQDSIKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVD 167
           N   ++ ++ LP  E +   ++  +Q+ AT+ VR L     + VR ++A  D
Sbjct: 121 NTGEVEALSKLPLREELIVKLLFLMQAPATQFVRTLNAVPAKFVRTLAAIRD 172


>gi|294101327|ref|YP_003553185.1| ribosomal protein L10 [Aminobacterium colombiense DSM 12261]
 gi|293616307|gb|ADE56461.1| ribosomal protein L10 [Aminobacterium colombiense DSM 12261]
          Length = 176

 Score = 90.5 bits (223), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 55/167 (32%), Positives = 95/167 (56%), Gaps = 5/167 (2%)

Query: 10  ISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRG 69
           ++EL ++   S ++ VA Y+G++VA+I +LR K+R+AGG +KVAKN L KIA+++  +  
Sbjct: 10  VNELKEMLDKSEAVFVAEYRGLTVAKITELRAKVRQAGGEMKVAKNTLFKIALQEKDMPV 69

Query: 70  ISDLFVGQSL--IVYSDSPVIAPKISVSFSND--NNEFRVLGGVVEKGVLNQDSIKQIAS 125
             D+  G ++  +VY D PV   K+   FS D  N  F + GG++   +L+   +  +A 
Sbjct: 70  PEDIMAGPNVYTVVY-DDPVAVAKVFAEFSRDKSNKAFVMKGGIMGTSILDAAQVGALAD 128

Query: 126 LPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQQG 172
           LP  E + A ++S I +  + LV +L      +   +S   +K +Q 
Sbjct: 129 LPSREVLIAQVVSTIAAPLSGLVTVLSGSIRGLATCLSQIKEKKEQA 175


>gi|293375379|ref|ZP_06621660.1| ribosomal protein L10 [Turicibacter sanguinis PC909]
 gi|325844443|ref|ZP_08168170.1| ribosomal protein L10 [Turicibacter sp. HGF1]
 gi|292645932|gb|EFF63961.1| ribosomal protein L10 [Turicibacter sanguinis PC909]
 gi|325489117|gb|EGC91501.1| ribosomal protein L10 [Turicibacter sp. HGF1]
          Length = 187

 Score = 90.1 bits (222), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 43/138 (31%), Positives = 84/138 (60%), Gaps = 1/138 (0%)

Query: 6   KSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDT 65
           KS  ++E +  F  S S+VV  Y+G++V+++ +LRK++R  G   KV KN + + A+ + 
Sbjct: 9   KSQLVAEYAGQFKESASLVVVDYRGLTVSEVTELRKQLRAEGVEFKVLKNNISRRAVTEA 68

Query: 66  SIRGISDLFVGQSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIA 124
              G+S+ FVG + + YS   V+AP ++  +FS ++    +  G++E  V   + + ++A
Sbjct: 69  GFEGLSEAFVGPTAVAYSKEDVVAPARVLYNFSKEHQALELKAGLIEGSVATLEQVMELA 128

Query: 125 SLPDLEGIRAGIISAIQS 142
            LP+ EG+ + ++S +Q+
Sbjct: 129 KLPNREGLLSMLLSVLQA 146


>gi|227487143|ref|ZP_03917459.1| 50S ribosomal protein L10 [Corynebacterium glucuronolyticum ATCC
           51867]
 gi|227541690|ref|ZP_03971739.1| 50S ribosomal protein L10 [Corynebacterium glucuronolyticum ATCC
           51866]
 gi|227092801|gb|EEI28113.1| 50S ribosomal protein L10 [Corynebacterium glucuronolyticum ATCC
           51867]
 gi|227182505|gb|EEI63477.1| 50S ribosomal protein L10 [Corynebacterium glucuronolyticum ATCC
           51866]
          Length = 175

 Score = 90.1 bits (222), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 53/165 (32%), Positives = 86/165 (52%), Gaps = 6/165 (3%)

Query: 7   SVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVK--VAKNRLVKIAIRD 64
           + E+++L + F  + S+V+  Y+G++V QI D R  +   G  VK  VAKN L+K A  +
Sbjct: 13  TAELAKLKEYFDEADSLVLTEYRGLTVQQITDFRTDL---GKDVKYHVAKNTLIKRAAAE 69

Query: 65  TSIRGISDLFVGQSLIVY-SDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQI 123
             I G+ DL  G + + +     V A K    F +DN++F V GG ++   L+ D +K +
Sbjct: 70  AGIEGLDDLLTGPTAVAFIKGEAVDAAKAMKKFGSDNDKFVVKGGYMDGAALDADQVKAL 129

Query: 124 ASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDK 168
           A L D E   A +  A++    +   L   P +QV R  +A  +K
Sbjct: 130 ADLDDRETTLAKLAGALKGKMNQAAGLFAAPASQVARLSAALQEK 174


>gi|54027086|ref|YP_121328.1| 50S ribosomal protein L10 [Nocardia farcinica IFM 10152]
 gi|61214795|sp|Q5YPC7|RL10_NOCFA RecName: Full=50S ribosomal protein L10
 gi|54018594|dbj|BAD59964.1| putative ribosomal protein L10 [Nocardia farcinica IFM 10152]
          Length = 176

 Score = 90.1 bits (222), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 54/171 (31%), Positives = 91/171 (53%), Gaps = 2/171 (1%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M +  K   ++E+++ F SS + VV  Y+G+SV ++ +LR+ +  A     VAKN LVK 
Sbjct: 1   MAKAEKVTAVAEIAEQFKSSTATVVTEYRGLSVGKLTELRRALG-AEATYSVAKNTLVKR 59

Query: 61  AIRDTSIRGISDLFVGQSLIVY-SDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
           A  +  + G+ DLFVG + I +    PV A K   +F+ +N    + GG ++   L+   
Sbjct: 60  AAAEAGVEGLDDLFVGPTAITFIKGEPVNAAKALKTFAKENKALIIKGGYMDGAALSVAE 119

Query: 120 IKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQ 170
           ++QIA L   E + A +  A++ N  +   L   P +QV R  +A  +K +
Sbjct: 120 VEQIADLETREVLLAKLAGALKGNLAKAAGLFNAPASQVARLAAALEEKKR 170


>gi|114331774|ref|YP_747996.1| 50S ribosomal protein L10 [Nitrosomonas eutropha C91]
 gi|122313479|sp|Q0AF51|RL10_NITEC RecName: Full=50S ribosomal protein L10
 gi|114308788|gb|ABI60031.1| LSU ribosomal protein L10P [Nitrosomonas eutropha C91]
          Length = 171

 Score = 90.1 bits (222), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 50/168 (29%), Positives = 89/168 (52%)

Query: 2   NRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIA 61
           N + K   ++E+S   + + +IV+A Y+G+ V Q+  LR K RE+G   +V KN  V+ A
Sbjct: 4   NLEEKKAIVAEVSDQIAEAQAIVIAEYRGLGVGQLTQLRVKARESGIYFRVIKNTFVRRA 63

Query: 62  IRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSIK 121
           + DT   G+++  VG         PVI  K+   F+ DN+ F +  G +   V++   + 
Sbjct: 64  VVDTPFSGLAESMVGPLAYGIGSDPVITAKVLHEFAKDNDRFVIKAGAMAGTVMSGKDVA 123

Query: 122 QIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKN 169
            +A+LP  E + + ++  +Q+   + VR L    ++ VR ++A  DK 
Sbjct: 124 ALAALPSREELLSRLLGTLQAPVAKFVRTLNEVPSKFVRGLAAVCDKK 171


>gi|257420109|ref|ZP_05597103.1| 50S ribosomal protein L10 [Enterococcus faecalis T11]
 gi|257161937|gb|EEU91897.1| 50S ribosomal protein L10 [Enterococcus faecalis T11]
          Length = 166

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 47/156 (30%), Positives = 90/156 (57%), Gaps = 12/156 (7%)

Query: 17  FSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRGISDLFVG 76
           F S+ S+V+  Y+G++V ++ +LRK++R+AG  +KV KN ++  A +   + G+ ++F G
Sbjct: 20  FESAASVVIVDYRGLTVEEVTNLRKQLRDAGVEMKVIKNSILSRAAKKVGLDGLDEVFTG 79

Query: 77  QSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASLPDLEGIRAG 135
            + + +S+  ++AP KI   F+ D     + GGV+E  V + + I  +A LP+ EG+ + 
Sbjct: 80  PTAVAFSNDDIVAPAKIIDEFAKDAKALEIKGGVIEGKVSSVEQITALAKLPNREGLLSM 139

Query: 136 IISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQQ 171
           ++S +Q+           P   V  A+ A  +KN++
Sbjct: 140 LLSVLQA-----------PVRNVAYAVKAVAEKNEE 164


>gi|255324709|ref|ZP_05365823.1| 50S ribosomal protein L10 [Corynebacterium tuberculostearicum
           SK141]
 gi|311739235|ref|ZP_07713072.1| 50S ribosomal protein L10 [Corynebacterium pseudogenitalium ATCC
           33035]
 gi|255298184|gb|EET77487.1| 50S ribosomal protein L10 [Corynebacterium tuberculostearicum
           SK141]
 gi|311305661|gb|EFQ81727.1| 50S ribosomal protein L10 [Corynebacterium pseudogenitalium ATCC
           33035]
          Length = 173

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 50/167 (29%), Positives = 92/167 (55%), Gaps = 6/167 (3%)

Query: 7   SVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVK--VAKNRLVKIAIRD 64
           + +++EL +  + + S+V+  Y+G++V+Q+++LR  +   G  V+  VAKN L KIA ++
Sbjct: 7   TADLAELKEKLAGANSVVLTEYRGLTVSQLQELRNDL---GFDVEYSVAKNTLFKIAAKE 63

Query: 65  TSIRGISDLFVGQSLIVY-SDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQI 123
             I G+ DL  G + I +     V A K+   F++DN    + GG ++   L+ D ++ I
Sbjct: 64  AGIEGLDDLLTGPTAIAFIKGEAVDAAKVITKFADDNKALIIKGGYMDGNALSADQVEAI 123

Query: 124 ASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQ 170
           A L + E   A +  A++ +  +   L   P T+ VR ++A  DK +
Sbjct: 124 AKLDNRETTLAKLAGAMKGSMAKAAALFNAPATKAVRTVAALQDKKE 170


>gi|158520717|ref|YP_001528587.1| ribosomal protein L10 [Desulfococcus oleovorans Hxd3]
 gi|158509543|gb|ABW66510.1| ribosomal protein L10 [Desulfococcus oleovorans Hxd3]
          Length = 174

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 47/171 (27%), Positives = 92/171 (53%), Gaps = 1/171 (0%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           +N   K   + EL   F  +  +++  YKG++V Q+ DLR+K++E G   +V KN L++ 
Sbjct: 2   LNLTQKQALVEELRGSFQKAAILILTDYKGLTVEQVNDLRRKLKEVGVEYRVVKNTLLRR 61

Query: 61  AIRDTSIRGISDLFVGQSLIVY-SDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
           A+++T +    D F G + +    D PV   K+   F+  N++  V  GV+   ++++D 
Sbjct: 62  AVQETDMAAAQDHFTGPTAVALGYDDPVAVAKVLCEFAKTNDKLAVKAGVMAGKLMDRDR 121

Query: 120 IKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQ 170
           I  ++ LP  E + A ++  + +  T  VR+L     ++V A++A  ++ +
Sbjct: 122 ITALSKLPSREELLAKLLGTMNAVPTSFVRVLNGIPAKLVYALAAIKEQKE 172


>gi|294496972|ref|YP_003560672.1| 50S ribosomal protein L10 [Bacillus megaterium QM B1551]
 gi|295702339|ref|YP_003595414.1| 50S ribosomal protein L10 [Bacillus megaterium DSM 319]
 gi|294346909|gb|ADE67238.1| 50S ribosomal protein L10 [Bacillus megaterium QM B1551]
 gi|294799998|gb|ADF37064.1| 50S ribosomal protein L10 [Bacillus megaterium DSM 319]
          Length = 166

 Score = 89.4 bits (220), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 49/141 (34%), Positives = 85/141 (60%), Gaps = 2/141 (1%)

Query: 3   RQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAI 62
            Q K V + E+++   +S SIVV  Y+G++VA++ +LRK++REAG   KV KN L + A+
Sbjct: 6   EQKKQV-VDEIAEKLQASNSIVVVDYRGLNVAEVTELRKQLREAGIEFKVYKNTLTRRAV 64

Query: 63  RDTSIRGISDLFVGQSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIK 121
               +  ++D  VG + I +    V+AP KI  +F+ ++    +  GV+E  V + + IK
Sbjct: 65  EKLELTDLNDALVGPNAIAFGGEDVVAPAKILNNFAKEHEALEIKAGVIEGNVASVEEIK 124

Query: 122 QIASLPDLEGIRAGIISAIQS 142
            +A LP  EG+ + ++S +Q+
Sbjct: 125 ALAELPSREGLLSMLLSVLQA 145


>gi|325067666|ref|ZP_08126339.1| 50S ribosomal protein L10 [Actinomyces oris K20]
          Length = 173

 Score = 89.4 bits (220), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 52/172 (30%), Positives = 91/172 (52%), Gaps = 4/172 (2%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGG-VKVAKNRLVK 59
           M R  K   ++ L+  F  + ++++  Y+G+SVAQ+K+LR+ +  AG     V KN L  
Sbjct: 1   MARPDKEAAVAALADKFRQADAVLLTEYRGLSVAQLKELRRSL--AGNAEYTVVKNTLAA 58

Query: 60  IAIRDTSIRGISDLFVGQSLIVY-SDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQD 118
           IA R   +   +D   G S + + +  PV A K    F+ DN +  + GGV++  VL+ D
Sbjct: 59  IAARQVGLEDFADDLTGPSALTFVTGEPVEAAKALRDFAKDNQQLVIKGGVMDGAVLSAD 118

Query: 119 SIKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQ 170
            + ++ASL   E + A    AI+++ ++   L   P ++ VR + A  +K +
Sbjct: 119 GVDKLASLESREVLLAKTAGAIKASLSKAAYLFAAPASKAVRTVDALREKQE 170


>gi|326772040|ref|ZP_08231325.1| ribosomal protein L10 [Actinomyces viscosus C505]
 gi|326638173|gb|EGE39074.1| ribosomal protein L10 [Actinomyces viscosus C505]
          Length = 182

 Score = 89.0 bits (219), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 52/172 (30%), Positives = 91/172 (52%), Gaps = 4/172 (2%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGG-VKVAKNRLVK 59
           M R  K   ++ L+  F  + ++++  Y+G+SVAQ+K+LR+ +  AG     V KN L  
Sbjct: 10  MARPDKEAAVAALADKFRQADAVLLTEYRGLSVAQLKELRRSL--AGNAEYTVVKNTLAA 67

Query: 60  IAIRDTSIRGISDLFVGQSLIVY-SDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQD 118
           IA R   +   +D   G S + + +  PV A K    F+ DN +  + GGV++  VL+ D
Sbjct: 68  IAARQVGLEDFADDLTGPSALTFVTGEPVEAAKALRDFAKDNQQLVIKGGVMDGAVLSAD 127

Query: 119 SIKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQ 170
            + ++ASL   E + A    AI+++ ++   L   P ++ VR + A  +K +
Sbjct: 128 GVDKLASLESREVLFAKTAGAIKASLSKAAYLFAAPASKAVRTVDALREKQE 179


>gi|269219022|ref|ZP_06162876.1| ribosomal protein L10 [Actinomyces sp. oral taxon 848 str. F0332]
 gi|269212133|gb|EEZ78473.1| ribosomal protein L10 [Actinomyces sp. oral taxon 848 str. F0332]
          Length = 173

 Score = 89.0 bits (219), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 53/171 (30%), Positives = 90/171 (52%), Gaps = 2/171 (1%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M R  KS  I+EL K F SS ++++  Y+G++V Q+K LR+ +  A    KVAKN L KI
Sbjct: 1   MARTDKSAAIAELKKKFESSDAVLLTEYRGLTVMQLKTLRRAIG-ANAQFKVAKNTLAKI 59

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISV-SFSNDNNEFRVLGGVVEKGVLNQDS 119
           A ++  I G+ DL  G +   +    +     ++  F+ DN    V GGV+E  +L++D 
Sbjct: 60  AAKEAGIEGLDDLLTGPTAFAFVTGEIADTAKAIRDFAKDNPALLVKGGVLEGNLLSEDD 119

Query: 120 IKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQ 170
           +K++A L   E + +     +++   +   +   P ++ VR I A   K +
Sbjct: 120 VKKLADLESREVLLSKAAGVLKAALFQAAYVFQAPVSKTVRTIDALRAKEE 170


>gi|309389942|gb|ADO77822.1| LSU ribosomal protein L10P [Halanaerobium praevalens DSM 2228]
          Length = 171

 Score = 89.0 bits (219), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 46/152 (30%), Positives = 87/152 (57%), Gaps = 1/152 (0%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M R  K   + EL+  FSS+ S+VV  Y G+ VA++ +LR ++REAG   KV KN L  I
Sbjct: 1   MARPEKEAVVKELTDKFSSAKSLVVTDYLGLDVAEMTELRSQLREAGVEFKVVKNTLATI 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
           A  D  +  +++ F G + I + +   ++P K+ V F+ D+    +  G++   +++++ 
Sbjct: 61  AANDVEMEEMTEYFSGPTAIAFGEDDAVSPAKVLVEFAKDHEVLEIKAGLLNGEIISKEK 120

Query: 120 IKQIASLPDLEGIRAGIISAIQSNATRLVRLL 151
           ++ +A +P  E + A   +++++  T LV +L
Sbjct: 121 VESLAEIPSREELLAKAFASMKAPLTGLVNVL 152


>gi|284047644|ref|YP_003397983.1| ribosomal protein L10 [Acidaminococcus fermentans DSM 20731]
 gi|283951865|gb|ADB46668.1| ribosomal protein L10 [Acidaminococcus fermentans DSM 20731]
          Length = 177

 Score = 89.0 bits (219), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 53/170 (31%), Positives = 90/170 (52%), Gaps = 1/170 (0%)

Query: 3   RQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAI 62
           R  K+ +++EL  + SSS   V+  Y G++VA+  +LR KMREAG    VAKN  ++IA 
Sbjct: 5   RPEKAGKVAELKDLLSSSKGAVLVDYCGLTVAEDTELRSKMREAGVKYMVAKNTFIRIAA 64

Query: 63  RDTSIRGISDLFVGQSLIVYS-DSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSIK 121
           ++  I G+       + + +S + PV   KI   FS D+    +  G+++  V+  D +K
Sbjct: 65  KEAGIEGLDAYLEHNTAVAFSAEDPVAPAKILNDFSKDHKALEIKAGILDGKVIALDEVK 124

Query: 122 QIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQQ 171
            +A LP  E + A ++ ++Q+  + LV +L       V  + A   K +Q
Sbjct: 125 ALAELPSREELLAKLVGSMQAPISGLVNVLQGTIRNFVYTLEAVRQKKEQ 174


>gi|302390949|ref|YP_003826769.1| 50S ribosomal protein L10P [Acetohalobium arabaticum DSM 5501]
 gi|302203026|gb|ADL11704.1| LSU ribosomal protein L10P [Acetohalobium arabaticum DSM 5501]
          Length = 172

 Score = 88.6 bits (218), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 45/172 (26%), Positives = 90/172 (52%), Gaps = 1/172 (0%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M  + K + + EL+  FS++ S V+  Y G+ V  + +LR K+REAG   KV KN L ++
Sbjct: 1   MPTREKEIIVEELTDKFSNAKSAVLTDYCGLDVETMTELRAKLREAGVDYKVVKNTLARL 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
           A +      + D   G + I +SD   +AP K+   F+ ++ E  +  G+++  ++ Q+ 
Sbjct: 61  AAKKAEYDEVDDYLTGPTAIAFSDEDPVAPAKVLADFAEEHEELEIKAGILQGSLIGQEQ 120

Query: 120 IKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQQ 171
           +  +A +P  E + A ++  +++    LV  L  P   +   ++A  ++ ++
Sbjct: 121 LDSLADIPPREELIAQVLRKMKAPVNGLVNALNDPLKSLAHVLNAIKEEKEE 172


>gi|319950488|ref|ZP_08024401.1| 50S ribosomal protein L10 [Dietzia cinnamea P4]
 gi|319435847|gb|EFV91054.1| 50S ribosomal protein L10 [Dietzia cinnamea P4]
          Length = 170

 Score = 88.6 bits (218), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 54/169 (31%), Positives = 88/169 (52%), Gaps = 2/169 (1%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M +  K   + E+ + F +S + VV  Y+G+SV Q+ +LRK + +A     VAKN LVK 
Sbjct: 1   MAKPAKVQAVEEIKQHFQNSTTAVVTEYRGLSVPQVTELRKTLGDAAT-YTVAKNTLVKR 59

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVI-APKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
           A  +  + G+ DL  G + I +    V+ A K   +F+ DN    + GGV++   L+   
Sbjct: 60  AAEEAGVEGLDDLLSGPTAIAFVTGEVVDAAKALKNFAKDNKALVIKGGVMDGSPLSATE 119

Query: 120 IKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDK 168
           + +IA L   E + A +  A++ N T+   L   P +Q+ R  +A  DK
Sbjct: 120 LDKIADLESREVLLAKMAGALKGNQTKAAGLFNAPASQLARLFAALEDK 168


>gi|111018973|ref|YP_701945.1| 50S ribosomal protein L10 [Rhodococcus jostii RHA1]
 gi|226361068|ref|YP_002778846.1| 50S ribosomal protein L10 [Rhodococcus opacus B4]
 gi|123046427|sp|Q0SF99|RL10_RHOSR RecName: Full=50S ribosomal protein L10
 gi|254798396|sp|C1AYX3|RL10_RHOOB RecName: Full=50S ribosomal protein L10
 gi|110818503|gb|ABG93787.1| 50S ribosomal protein L10 [Rhodococcus jostii RHA1]
 gi|226239553|dbj|BAH49901.1| 50S ribosomal protein L10 [Rhodococcus opacus B4]
          Length = 186

 Score = 88.6 bits (218), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 53/166 (31%), Positives = 86/166 (51%), Gaps = 2/166 (1%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M +  K   ++E+++ F  S + V+  Y+G++V  I  LR+ + E G    VAKN LVK 
Sbjct: 1   MAKPEKVSAVAEITEQFKGSTAAVITEYRGLTVGNITTLRRALGE-GATYSVAKNTLVKR 59

Query: 61  AIRDTSIRGISDLFVGQSLIVY-SDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
           A  +  + G+ DLFVG + I +    PV A K   +F+ DN    + GG ++   L+ D 
Sbjct: 60  AAAEAGVEGLDDLFVGPTAIAFIKGEPVDAAKALKNFAKDNKALIIKGGYMDGAALSVDE 119

Query: 120 IKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAF 165
           + +IA L   E + A +  A++ N  +   L   P +QV R  +A 
Sbjct: 120 VNKIADLESREILLAKLAGAMKGNLAKAAGLFNAPASQVARLAAAL 165


>gi|312144257|ref|YP_003995703.1| ribosomal protein L10 [Halanaerobium sp. 'sapolanicus']
 gi|311904908|gb|ADQ15349.1| ribosomal protein L10 [Halanaerobium sp. 'sapolanicus']
          Length = 171

 Score = 88.6 bits (218), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 50/164 (30%), Positives = 90/164 (54%), Gaps = 12/164 (7%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M R  K   + EL+  FSS+ SIV+  Y G++VA++ +LR+++REAG   KV KN L  I
Sbjct: 1   MARPEKEAVVKELTDKFSSAKSIVITDYLGLNVAEMTELRRQLREAGVEFKVVKNTLATI 60

Query: 61  AIRDTSIRGISDLFVGQSLIVY-SDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
           A     +  +++ F G + I +  + PV   KI V F+ D++   +  G++   ++ ++ 
Sbjct: 61  AANQIEMEAMTEFFSGPTAIAFGEEDPVSPAKILVDFAKDHDVIEIKAGLLNGEIITKEK 120

Query: 120 IKQIASLPDLEGIRA-----------GIISAIQSNATRLVRLLG 152
           ++ +A +P  E + A           G+++ +Q N   LV++LG
Sbjct: 121 VQSLAKIPSREVLLAQAFANMKAPLTGLVNVLQGNIRGLVQVLG 164


>gi|256848152|ref|ZP_05553596.1| ribosomal protein L10 [Lactobacillus coleohominis 101-4-CHN]
 gi|256715212|gb|EEU30189.1| ribosomal protein L10 [Lactobacillus coleohominis 101-4-CHN]
          Length = 166

 Score = 88.2 bits (217), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 46/158 (29%), Positives = 86/158 (54%), Gaps = 12/158 (7%)

Query: 16  IFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRGISDLFV 75
           + + + S +V  Y+G++V ++ DLRK++R+AG  + V KN++++ A+  T    +  +FV
Sbjct: 19  LLTDAESAIVVDYRGLTVDEVTDLRKQLRDAGVKMVVIKNKILERAVDGTDYEDLKSVFV 78

Query: 76  GQSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASLPDLEGIRA 134
           G + + +S+   IAP KI   F+ D++   + GG +EK +   D I + A LP  + + +
Sbjct: 79  GPTAVAFSNEDPIAPAKIMKKFAEDHDALEIKGGFIEKDIKTLDEINEFAELPSRDDLLS 138

Query: 135 GIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQQG 172
            + SA+Q            P  ++ RA+ A  DK  + 
Sbjct: 139 MLASALQD-----------PMRKIARAVKAVADKADEA 165


>gi|310822262|ref|YP_003954620.1| 50S ribosomal protein L10 [Stigmatella aurantiaca DW4/3-1]
 gi|309395334|gb|ADO72793.1| 50S ribosomal protein L10 [Stigmatella aurantiaca DW4/3-1]
          Length = 173

 Score = 87.8 bits (216), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 57/173 (32%), Positives = 89/173 (51%), Gaps = 4/173 (2%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M +  K   I ELS  F  + + +VA +  + V  +  LR+K REA    KV KN L K 
Sbjct: 1   MQKSEKEEMIKELSDKFQRTQTAIVAEFSKLDVETVTKLRRKFREAKVDYKVIKNTLAKR 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
           A + TS+  I+D F G   +  S   VIAP KI   F  D    ++   VV+   +N + 
Sbjct: 61  AAKGTSVEVIADDFKGPVALAISYDDVIAPAKILTEFIKDLETIKIRSAVVQGKRINVEG 120

Query: 120 IKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQQG 172
           +K +A +P L  +R  ++  +   A++LVR L  P +Q+ R + A   +++QG
Sbjct: 121 VKALAKMPGLTELRGQLLGMLNQPASKLVRTLSAPGSQLARVLQA---RSEQG 170


>gi|161486834|ref|NP_783126.2| 50S ribosomal protein L10 [Clostridium tetani E88]
          Length = 166

 Score = 87.8 bits (216), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 47/151 (31%), Positives = 86/151 (56%), Gaps = 1/151 (0%)

Query: 2   NRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIA 61
           NRQ K  +++E+ +    +  IV+A Y+G++V +  +LRKKMRE G   KV KN L  +A
Sbjct: 4   NRQLKEAKVAEIKEKMEKAECIVLADYQGLTVEEATELRKKMREEGVEYKVFKNTLSILA 63

Query: 62  IRDTSIRGISDLFVGQSLIVYS-DSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
            ++    GI+DLF G   I +  + P    +I   F+ D+ +  + GG+V+  V ++D I
Sbjct: 64  AKELGYEGITDLFQGPISIAFGYEDPTAPARILNDFAKDHKKLELKGGMVQGEVYDEDKI 123

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLL 151
           K +A++P  + + A ++ + ++  +    L+
Sbjct: 124 KALAAIPPRDVLIAKLLGSFKAPVSNFAYLI 154


>gi|61215282|sp|Q890N3|RL10_CLOTE RecName: Full=50S ribosomal protein L10
 gi|28204626|gb|AAO37063.1| LSU ribosomal protein L10P [Clostridium tetani E88]
          Length = 172

 Score = 87.8 bits (216), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 47/151 (31%), Positives = 86/151 (56%), Gaps = 1/151 (0%)

Query: 2   NRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIA 61
           NRQ K  +++E+ +    +  IV+A Y+G++V +  +LRKKMRE G   KV KN L  +A
Sbjct: 10  NRQLKEAKVAEIKEKMEKAECIVLADYQGLTVEEATELRKKMREEGVEYKVFKNTLSILA 69

Query: 62  IRDTSIRGISDLFVGQSLIVY-SDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
            ++    GI+DLF G   I +  + P    +I   F+ D+ +  + GG+V+  V ++D I
Sbjct: 70  AKELGYEGITDLFQGPISIAFGYEDPTAPARILNDFAKDHKKLELKGGMVQGEVYDEDKI 129

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLL 151
           K +A++P  + + A ++ + ++  +    L+
Sbjct: 130 KALAAIPPRDVLIAKLLGSFKAPVSNFAYLI 160


>gi|91774626|ref|YP_544382.1| 50S ribosomal protein L10 [Methylobacillus flagellatus KT]
 gi|122400332|sp|Q1H4P6|RL10_METFK RecName: Full=50S ribosomal protein L10
 gi|91708613|gb|ABE48541.1| LSU ribosomal protein L10P [Methylobacillus flagellatus KT]
          Length = 174

 Score = 87.8 bits (216), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 50/170 (29%), Positives = 95/170 (55%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           +N + K   ++E+S+  + + +IV+A Y+GI V  +  LR + R++G  ++V KN LV+ 
Sbjct: 3   LNLEQKKAVVAEVSEQVAQAQAIVLAEYRGIEVGDMTKLRAEARKSGVYLRVLKNTLVRR 62

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A+  T   G+++  VG  +   S  PV A K+  +F+  N++F +  G +   VL+   +
Sbjct: 63  AVDGTQFSGLANDMVGPLVFGISADPVAAAKVLNNFAKANDKFVIKAGALPGKVLDAKGV 122

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQ 170
           + +A+LP  E + A ++  +Q+   + VR L    T+  R ++A  D+ Q
Sbjct: 123 QSLATLPSREELLAKLLGTMQAPVAQFVRTLNEVPTKFARGLAAVRDQKQ 172


>gi|15612684|ref|NP_240987.1| 50S ribosomal protein L10 [Bacillus halodurans C-125]
 gi|13959484|sp|Q9KGE4|RL10_BACHD RecName: Full=50S ribosomal protein L10
 gi|10172733|dbj|BAB03840.1| 50S ribosomal protein L10 [Bacillus halodurans C-125]
          Length = 165

 Score = 87.8 bits (216), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 44/134 (32%), Positives = 80/134 (59%), Gaps = 1/134 (0%)

Query: 10  ISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRG 69
           ++E++     S S VV  Y+G++VA++ +LRK++REAG   KV KN + + A     +  
Sbjct: 11  VTEIATKLKESQSTVVVDYRGLNVAEVTELRKQLREAGCEFKVYKNTMTRRAAEVAELTE 70

Query: 70  ISDLFVGQSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASLPD 128
           ++D+ VG + I + +   IAP KI  SF+ ++    +  GV+E  V + + +K +A LP 
Sbjct: 71  LNDVLVGPTAIAFHNEDAIAPAKIINSFAKEHEALEIKAGVIEGNVASVEEVKALAELPS 130

Query: 129 LEGIRAGIISAIQS 142
            EG+ + ++S +Q+
Sbjct: 131 REGLLSMLLSVLQA 144


>gi|81429279|ref|YP_396280.1| 50S ribosomal protein L10 [Lactobacillus sakei subsp. sakei 23K]
 gi|97181709|sp|Q38V10|RL10_LACSS RecName: Full=50S ribosomal protein L10
 gi|78610922|emb|CAI55974.1| 50S ribosomal protein L10 [Lactobacillus sakei subsp. sakei 23K]
          Length = 167

 Score = 87.8 bits (216), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 44/127 (34%), Positives = 78/127 (61%), Gaps = 1/127 (0%)

Query: 17  FSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRGISDLFVG 76
           F+++ SIVV  Y+G++V Q+ +LRK++REAG  ++V KN  ++ A       G+ D F G
Sbjct: 20  FNNAVSIVVMDYRGLTVEQVTELRKQLREAGVQMEVVKNTYLRRAADKAGYEGLDDTFTG 79

Query: 77  QSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASLPDLEGIRAG 135
            + + +S+  V+AP KI  +FS   +   + GG++E  V   D I  +A+LP  +G+ + 
Sbjct: 80  PTAVAFSNEDVVAPAKIIANFSKSADALEIKGGMIEGKVATLDEINALATLPSRDGLLSM 139

Query: 136 IISAIQS 142
           ++S +Q+
Sbjct: 140 LLSVLQA 146


>gi|297201710|ref|ZP_06919107.1| 50S ribosomal protein L10 [Streptomyces sviceus ATCC 29083]
 gi|197710917|gb|EDY54951.1| 50S ribosomal protein L10 [Streptomyces sviceus ATCC 29083]
          Length = 176

 Score = 87.4 bits (215), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 54/174 (31%), Positives = 94/174 (54%), Gaps = 3/174 (1%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M R  K+  ++EL++ F SS + V+  Y+G++VAQ+K LR+ + E      V KN L KI
Sbjct: 1   MARPDKAAAVAELTEQFRSSNAAVLTEYRGLTVAQLKTLRRSLGE-DAQYAVVKNTLTKI 59

Query: 61  AIRDTSIRGISDLFVGQSLIVY-SDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
           A  +  I  + DLF G + + + +  PV + K    F+ DN    + GGV++   L+ D 
Sbjct: 60  AANEAGISTLDDLFNGPTAVAFITGDPVTSAKGLRDFAKDNPNLVIKGGVLDGKALSADE 119

Query: 120 IKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAF-VDKNQQG 172
           IK++A L   E + A +  A +   T+  ++     +++VR + A    +++QG
Sbjct: 120 IKKLADLESREVLLAKLAGAFKGKQTQAAQVFQALPSKLVRTVDALRAKQDEQG 173


>gi|226305209|ref|YP_002765167.1| 50S ribosomal protein L10 [Rhodococcus erythropolis PR4]
 gi|229490741|ref|ZP_04384579.1| 50S ribosomal protein L10 [Rhodococcus erythropolis SK121]
 gi|259645490|sp|C0ZV33|RL10_RHOE4 RecName: Full=50S ribosomal protein L10
 gi|226184324|dbj|BAH32428.1| 50S ribosomal protein L10 [Rhodococcus erythropolis PR4]
 gi|229322561|gb|EEN88344.1| 50S ribosomal protein L10 [Rhodococcus erythropolis SK121]
          Length = 194

 Score = 87.4 bits (215), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 54/166 (32%), Positives = 86/166 (51%), Gaps = 2/166 (1%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M +  K   ++E+++ F  S + VV  Y+G+SV  I  LR+ + E G    VAKN LVK 
Sbjct: 1   MAKPEKVSAVAEITEQFKGSTAAVVTEYRGLSVGNITTLRRALGE-GATYSVAKNTLVKR 59

Query: 61  AIRDTSIRGISDLFVGQSLIVY-SDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
           A  +  I G+ DLFVG + I +    PV A K   +F+ DN    + GG ++   L+ + 
Sbjct: 60  AAAEAGIEGLDDLFVGPTAIAFIKGEPVDAAKALKNFAKDNKALIIKGGYMDGAALSVEE 119

Query: 120 IKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAF 165
           + +IA L   E + A +  A++ N  +   L   P +Q+ R  +A 
Sbjct: 120 VNKIADLESREILLAKLAGAMKGNLAKAAGLFNAPASQMARLAAAL 165


>gi|261409532|ref|YP_003245773.1| 50S ribosomal protein L10 [Paenibacillus sp. Y412MC10]
 gi|329925603|ref|ZP_08280444.1| ribosomal protein L10 [Paenibacillus sp. HGF5]
 gi|261285995|gb|ACX67966.1| ribosomal protein L10 [Paenibacillus sp. Y412MC10]
 gi|328939732|gb|EGG36074.1| ribosomal protein L10 [Paenibacillus sp. HGF5]
          Length = 167

 Score = 87.4 bits (215), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 52/170 (30%), Positives = 90/170 (52%), Gaps = 12/170 (7%)

Query: 4   QGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIR 63
           Q K   +  ++     S S VVA Y+G++VAQ+ +LRK++REAG   +V KN L++ A  
Sbjct: 8   QAKQEAVDVVAAKLRESVSTVVADYRGLNVAQVTELRKQLREAGVEFQVLKNTLLRRATA 67

Query: 64  DTSIRGISDLFVGQSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQ 122
              +  + ++  G + + +  +  +AP KI   F+  N+  ++ GGVVE  V+ +  IK 
Sbjct: 68  AAELTDLDEVLTGPTAVAFGTNDAVAPAKILNDFAKKNDALKLKGGVVEGRVIGESEIKA 127

Query: 123 IASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQQG 172
           +A LP  EG+ + ++S +Q+           P      A+ A  +K +QG
Sbjct: 128 LAELPSREGLLSMLLSVLQA-----------PVRNFALAVKAVAEKEEQG 166


>gi|228989308|ref|ZP_04149299.1| 50S ribosomal protein L10 [Bacillus pseudomycoides DSM 12442]
 gi|228770386|gb|EEM18959.1| 50S ribosomal protein L10 [Bacillus pseudomycoides DSM 12442]
          Length = 166

 Score = 87.4 bits (215), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 43/134 (32%), Positives = 79/134 (58%), Gaps = 1/134 (0%)

Query: 10  ISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRG 69
           ++E+++    S S +V  Y+G++VA+  +LRK +REAG   KV KN L + A     +  
Sbjct: 12  VTEIAEKLRESKSTIVVDYRGLTVAEATELRKNLREAGVEFKVYKNSLTRRAAESVEMAE 71

Query: 70  ISDLFVGQSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASLPD 128
           +++   G + I +S+  V+AP K+   F+ D+    +  GV+E  ++  D +K IA+LP 
Sbjct: 72  LNEFLTGPNAIAFSNEDVVAPAKVLNDFAKDHEALEIKAGVIEGKLVTLDEVKAIATLPS 131

Query: 129 LEGIRAGIISAIQS 142
            EG+ + ++S +Q+
Sbjct: 132 REGLLSMLLSVLQA 145


>gi|290958177|ref|YP_003489359.1| 50S ribosomal protein L10 [Streptomyces scabiei 87.22]
 gi|260647703|emb|CBG70808.1| 50S ribosomal protein L10 [Streptomyces scabiei 87.22]
          Length = 176

 Score = 87.4 bits (215), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 53/172 (30%), Positives = 92/172 (53%), Gaps = 2/172 (1%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M R  K+  ++EL++ F SS + V+  Y+G+SVAQ+K LR+ + E      V KN L KI
Sbjct: 1   MARPDKAAAVAELTEQFRSSNAAVLTEYRGLSVAQLKTLRRSLGE-DAQYAVVKNTLTKI 59

Query: 61  AIRDTSIRGISDLFVGQSLIVY-SDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
           A  +  I  + DLF G + + + +  PV + K    F+ DN    + GGV++   L+ D 
Sbjct: 60  AANEAGISTLDDLFNGPTAVAFITGDPVTSAKGLRDFAKDNPNLVIKGGVLDGKALSADE 119

Query: 120 IKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQQ 171
           IK++A L   E + + +  A +   ++  +L     +++VR + A   K ++
Sbjct: 120 IKKLADLESREVLLSKLAGAFKGKQSQAAQLFQALPSKLVRTVDALRAKQEE 171


>gi|325570749|ref|ZP_08146475.1| 50S ribosomal protein L10 [Enterococcus casseliflavus ATCC 12755]
 gi|325156595|gb|EGC68775.1| 50S ribosomal protein L10 [Enterococcus casseliflavus ATCC 12755]
          Length = 166

 Score = 87.0 bits (214), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 50/168 (29%), Positives = 92/168 (54%), Gaps = 12/168 (7%)

Query: 6   KSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDT 65
           KS  + E+S  FS++ S+VV  Y+G++V ++  LRK++R+A   +KV KN ++  A    
Sbjct: 9   KSAIVDEVSAKFSAAASVVVVDYRGLTVDEVTRLRKQLRDANVEMKVIKNSILSRAAEKA 68

Query: 66  SIRGISDLFVGQSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIA 124
            + G+ ++F G + + +S+  V+AP KI   F+ D     + GG++E  V + + I  +A
Sbjct: 69  GLEGLGEVFTGPTAVAFSNEDVVAPAKIINDFAKDAKALEIKGGIIEGKVSSLEEITALA 128

Query: 125 SLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQQG 172
            LP+ EG+ + ++S +Q+           P   V  A+ A  +K +  
Sbjct: 129 KLPNREGLLSMLLSVLQA-----------PIRNVAYAVKAVAEKEEDA 165


>gi|183601914|ref|ZP_02963283.1| 50S ribosomal protein L10 [Bifidobacterium animalis subsp. lactis
           HN019]
 gi|219682828|ref|YP_002469211.1| 50S ribosomal protein L10 [Bifidobacterium animalis subsp. lactis
           AD011]
 gi|241190404|ref|YP_002967798.1| 50S ribosomal protein L10 [Bifidobacterium animalis subsp. lactis
           Bl-04]
 gi|241195810|ref|YP_002969365.1| 50S ribosomal protein L10 [Bifidobacterium animalis subsp. lactis
           DSM 10140]
 gi|254798360|sp|B8DVY4|RL10_BIFA0 RecName: Full=50S ribosomal protein L10
 gi|183218799|gb|EDT89441.1| 50S ribosomal protein L10 [Bifidobacterium animalis subsp. lactis
           HN019]
 gi|219620478|gb|ACL28635.1| 50S ribosomal protein L10 [Bifidobacterium animalis subsp. lactis
           AD011]
 gi|240248796|gb|ACS45736.1| 50S ribosomal protein L10 [Bifidobacterium animalis subsp. lactis
           Bl-04]
 gi|240250364|gb|ACS47303.1| 50S ribosomal protein L10 [Bifidobacterium animalis subsp. lactis
           DSM 10140]
 gi|295793391|gb|ADG32926.1| 50S ribosomal protein L10 [Bifidobacterium animalis subsp. lactis
           V9]
          Length = 173

 Score = 87.0 bits (214), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 53/174 (30%), Positives = 91/174 (52%), Gaps = 4/174 (2%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKM-REAGGGVKVAKNRLVK 59
           M R  K   ++EL++ F ++ ++ +  Y+G++V QI DLR+K+ R+      VAKN L +
Sbjct: 1   MKRPEKEAVVAELTEQFRNASAVYLTEYRGLTVPQISDLREKLGRDTS--YTVAKNTLFR 58

Query: 60  IAIRDTSIRGISDLFVGQSLIVYSDSPVI-APKISVSFSNDNNEFRVLGGVVEKGVLNQD 118
           IA ++  I G+ ++  G S +V+ D   I A K+   F+  N    V GG  +  V + +
Sbjct: 59  IAAKEAGIEGLDEMLKGPSAVVFVDGDFIEAAKVLRDFAKTNKALIVKGGFADGTVYDAE 118

Query: 119 SIKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQQG 172
             KQ+A L     + A +  A++   ++   L     T+VVR I A  DK ++ 
Sbjct: 119 GAKQLADLKSRPELLAELAGALKGTMSKAAYLFNALPTKVVRTIDALRDKQEKA 172


>gi|227552585|ref|ZP_03982634.1| 50S ribosomal protein L10 [Enterococcus faecium TX1330]
 gi|257880344|ref|ZP_05659997.1| ribosomal protein L10 [Enterococcus faecium 1,230,933]
 gi|257882198|ref|ZP_05661851.1| ribosomal protein L10 [Enterococcus faecium 1,231,502]
 gi|257885391|ref|ZP_05665044.1| ribosomal protein L10 [Enterococcus faecium 1,231,501]
 gi|257888186|ref|ZP_05667839.1| ribosomal protein L10 [Enterococcus faecium 1,141,733]
 gi|257891003|ref|ZP_05670656.1| ribosomal protein L10 [Enterococcus faecium 1,231,410]
 gi|257894257|ref|ZP_05673910.1| ribosomal protein L10 [Enterococcus faecium 1,231,408]
 gi|257896923|ref|ZP_05676576.1| ribosomal protein L10 [Enterococcus faecium Com12]
 gi|257899616|ref|ZP_05679269.1| ribosomal protein L10 [Enterococcus faecium Com15]
 gi|258614705|ref|ZP_05712475.1| 50S ribosomal protein L10 [Enterococcus faecium DO]
 gi|260562352|ref|ZP_05832866.1| ribosomal protein L10 [Enterococcus faecium C68]
 gi|261209273|ref|ZP_05923665.1| ribosomal protein L10 [Enterococcus faecium TC 6]
 gi|289566022|ref|ZP_06446460.1| 50S ribosomal protein L10 [Enterococcus faecium D344SRF]
 gi|293379134|ref|ZP_06625285.1| ribosomal protein L10 [Enterococcus faecium PC4.1]
 gi|293557107|ref|ZP_06675662.1| 50S ribosomal protein L10 [Enterococcus faecium E1039]
 gi|293559855|ref|ZP_06676369.1| 50S ribosomal protein L10 [Enterococcus faecium E1162]
 gi|293568375|ref|ZP_06679696.1| 50S ribosomal protein L10 [Enterococcus faecium E1071]
 gi|293571545|ref|ZP_06682567.1| 50S ribosomal protein L10 [Enterococcus faecium E980]
 gi|294616174|ref|ZP_06695971.1| 50S ribosomal protein L10 [Enterococcus faecium E1636]
 gi|294618916|ref|ZP_06698423.1| 50S ribosomal protein L10 [Enterococcus faecium E1679]
 gi|294623142|ref|ZP_06702028.1| 50S ribosomal protein L10 [Enterococcus faecium U0317]
 gi|314937970|ref|ZP_07845281.1| ribosomal protein L10 [Enterococcus faecium TX0133a04]
 gi|314944020|ref|ZP_07850705.1| ribosomal protein L10 [Enterococcus faecium TX0133C]
 gi|314948410|ref|ZP_07851798.1| ribosomal protein L10 [Enterococcus faecium TX0082]
 gi|314951402|ref|ZP_07854454.1| ribosomal protein L10 [Enterococcus faecium TX0133A]
 gi|314991331|ref|ZP_07856810.1| ribosomal protein L10 [Enterococcus faecium TX0133B]
 gi|314995331|ref|ZP_07860437.1| ribosomal protein L10 [Enterococcus faecium TX0133a01]
 gi|227178211|gb|EEI59183.1| 50S ribosomal protein L10 [Enterococcus faecium TX1330]
 gi|257814572|gb|EEV43330.1| ribosomal protein L10 [Enterococcus faecium 1,230,933]
 gi|257817856|gb|EEV45184.1| ribosomal protein L10 [Enterococcus faecium 1,231,502]
 gi|257821247|gb|EEV48377.1| ribosomal protein L10 [Enterococcus faecium 1,231,501]
 gi|257824240|gb|EEV51172.1| ribosomal protein L10 [Enterococcus faecium 1,141,733]
 gi|257827363|gb|EEV53989.1| ribosomal protein L10 [Enterococcus faecium 1,231,410]
 gi|257830636|gb|EEV57243.1| ribosomal protein L10 [Enterococcus faecium 1,231,408]
 gi|257833488|gb|EEV59909.1| ribosomal protein L10 [Enterococcus faecium Com12]
 gi|257837528|gb|EEV62602.1| ribosomal protein L10 [Enterococcus faecium Com15]
 gi|260073276|gb|EEW61617.1| ribosomal protein L10 [Enterococcus faecium C68]
 gi|260076819|gb|EEW64554.1| ribosomal protein L10 [Enterococcus faecium TC 6]
 gi|289162220|gb|EFD10082.1| 50S ribosomal protein L10 [Enterococcus faecium D344SRF]
 gi|291291687|gb|ADD91678.1| 50S ribosomal protein L10 [Enterococcus faecium]
 gi|291588896|gb|EFF20723.1| 50S ribosomal protein L10 [Enterococcus faecium E1071]
 gi|291590929|gb|EFF22641.1| 50S ribosomal protein L10 [Enterococcus faecium E1636]
 gi|291594832|gb|EFF26202.1| 50S ribosomal protein L10 [Enterococcus faecium E1679]
 gi|291597511|gb|EFF28676.1| 50S ribosomal protein L10 [Enterococcus faecium U0317]
 gi|291600728|gb|EFF31025.1| 50S ribosomal protein L10 [Enterococcus faecium E1039]
 gi|291606191|gb|EFF35611.1| 50S ribosomal protein L10 [Enterococcus faecium E1162]
 gi|291608351|gb|EFF37651.1| 50S ribosomal protein L10 [Enterococcus faecium E980]
 gi|292642275|gb|EFF60434.1| ribosomal protein L10 [Enterococcus faecium PC4.1]
 gi|313590424|gb|EFR69269.1| ribosomal protein L10 [Enterococcus faecium TX0133a01]
 gi|313594104|gb|EFR72949.1| ribosomal protein L10 [Enterococcus faecium TX0133B]
 gi|313596460|gb|EFR75305.1| ribosomal protein L10 [Enterococcus faecium TX0133A]
 gi|313597365|gb|EFR76210.1| ribosomal protein L10 [Enterococcus faecium TX0133C]
 gi|313642645|gb|EFS07225.1| ribosomal protein L10 [Enterococcus faecium TX0133a04]
 gi|313645135|gb|EFS09715.1| ribosomal protein L10 [Enterococcus faecium TX0082]
          Length = 167

 Score = 87.0 bits (214), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 48/165 (29%), Positives = 93/165 (56%), Gaps = 12/165 (7%)

Query: 6   KSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDT 65
           K+  + E+S+ F+++ S+VV  Y+G++V ++  LRK++R+A   +KV KN ++  A +  
Sbjct: 9   KAAIVDEVSEKFTAAASVVVVDYRGLTVDEVTRLRKQLRDANVEMKVIKNSILSRAAKKA 68

Query: 66  SIRGISDLFVGQSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIA 124
            + G+ ++F G + + +S+  V+AP KI   F+ +     + GG++E  V + + I  +A
Sbjct: 69  GLEGMDEVFTGPTAVAFSNEDVVAPAKIMDEFAKEAKALEIKGGIIEGKVSSLEEITALA 128

Query: 125 SLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKN 169
            LP+ EG+ + ++S +Q+           P   V  A+ A  DK 
Sbjct: 129 KLPNREGLLSMLLSVLQA-----------PVRNVAYAVKAVADKE 162


>gi|289178126|gb|ADC85372.1| LSU ribosomal protein L10P [Bifidobacterium animalis subsp. lactis
           BB-12]
          Length = 214

 Score = 87.0 bits (214), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 58/177 (32%), Positives = 92/177 (51%), Gaps = 10/177 (5%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKM-REAGGGVKVAKNRLVK 59
           M R  K   ++EL++ F ++ ++ +  Y+G++V QI DLR+K+ R+      VAKN L +
Sbjct: 42  MKRPEKEAVVAELTEQFRNASAVYLTEYRGLTVPQISDLREKLGRDTS--YTVAKNTLFR 99

Query: 60  IAIRDTSIRGISDLFVGQSLIVYSDSPVI-APKISVSFSNDNNEFRVLGGVVEKGVLNQD 118
           IA ++  I G+ ++  G S +V+ D   I A K+   F+  N    V GG  +  V + +
Sbjct: 100 IAAKEAGIEGLDEMLKGPSAVVFVDGDFIEAAKVLRDFAKTNKALIVKGGFADGTVYDAE 159

Query: 119 SIKQIASL---PDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQQG 172
             KQ+A L   P+L    AG +    S A  L   L    T+VVR I A  DK ++ 
Sbjct: 160 GAKQLADLKSRPELLAELAGALKGTMSKAAYLFNAL---PTKVVRTIDALRDKQEKA 213


>gi|311029037|ref|ZP_07707127.1| 50S ribosomal protein L10 [Bacillus sp. m3-13]
          Length = 166

 Score = 87.0 bits (214), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 46/134 (34%), Positives = 77/134 (57%), Gaps = 1/134 (0%)

Query: 10  ISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRG 69
           + E++  F  S S +V  Y+G++VA++ +LRK++REAG   KV KN L + A     I G
Sbjct: 12  VGEIADKFKGSVSTIVVDYRGLNVAEVTELRKQLREAGVEFKVYKNSLTRRAAEAADING 71

Query: 70  ISDLFVGQSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASLPD 128
           ++D   G + I +S   V+AP KI   F+  +    +  GV+E  V   + +K +A LP 
Sbjct: 72  LNDALTGPNAIAFSTEDVVAPAKILNDFAKKHEALEIKAGVIEGNVATVEEVKALAELPS 131

Query: 129 LEGIRAGIISAIQS 142
            EG+ + ++S +Q+
Sbjct: 132 REGLLSMLLSVLQA 145


>gi|85058110|ref|YP_453812.1| 50S ribosomal protein L10 [Sodalis glossinidius str. 'morsitans']
 gi|97181986|sp|Q2NWR8|RL10_SODGM RecName: Full=50S ribosomal protein L10
 gi|84778630|dbj|BAE73407.1| 50S ribosomal protein L10 [Sodalis glossinidius str. 'morsitans']
          Length = 165

 Score = 87.0 bits (214), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 52/159 (32%), Positives = 92/159 (57%), Gaps = 2/159 (1%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           +N Q K   ++E+S++   + S VVA  +G++V ++ +LRK  REAG  ++V +N L++ 
Sbjct: 3   LNLQDKQAIVAEVSEVAKGALSAVVADSRGVTVDKMTELRKAGREAGVYMRVVRNTLMRR 62

Query: 61  AIRDTSIRGISDLFVGQSLIVYS-DSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
            +  T    + D FVG +LI +S + P  A ++  +F+ DN  F V     E  V++   
Sbjct: 63  VVEGTPFECLKDTFVGPTLIAFSNEHPGAAARLFKAFAKDNANFEVKAAAFEGEVISASQ 122

Query: 120 IKQIASLPDLEGIRAGIISAI-QSNATRLVRLLGTPQTQ 157
           I ++A+LP  E   A ++SA+ +++A +LVR L   + Q
Sbjct: 123 IDRLATLPTYEEAIARLMSAMKEASAGKLVRTLAALRDQ 161


>gi|125975204|ref|YP_001039114.1| 50S ribosomal protein L10P [Clostridium thermocellum ATCC 27405]
 gi|281419557|ref|ZP_06250568.1| ribosomal protein L10 [Clostridium thermocellum JW20]
 gi|125715429|gb|ABN53921.1| LSU ribosomal protein L10P [Clostridium thermocellum ATCC 27405]
 gi|281406779|gb|EFB37046.1| ribosomal protein L10 [Clostridium thermocellum JW20]
 gi|316939368|gb|ADU73402.1| ribosomal protein L10 [Clostridium thermocellum DSM 1313]
          Length = 178

 Score = 86.7 bits (213), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 53/163 (32%), Positives = 92/163 (56%), Gaps = 1/163 (0%)

Query: 10  ISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRG 69
           + +LS+   S+ +IV A Y+G++V Q  +LR K+R+AG   KV KN L K+A ++  +  
Sbjct: 14  VRQLSENMKSAKTIVFADYRGLTVEQDTELRNKLRKAGVEYKVVKNTLTKLAAKENGLEE 73

Query: 70  ISDLFVGQSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASLPD 128
           +   F G + + +SD  V+AP KI V ++       +  GVVE  V +  ++K IA+LP 
Sbjct: 74  LEPYFNGPTSMAFSDKDVVAPAKIMVEYAEKYENLELKVGVVEGKVCDLKTLKAIAALPP 133

Query: 129 LEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQQ 171
            E + A  + +++S    LV +L      +V A++A  +K ++
Sbjct: 134 KEELVAKALGSLKSPIAGLVNVLNGNIRGLVIALNAIAEKKKE 176


>gi|296112482|ref|YP_003626420.1| 50S ribosomal protein L10 [Moraxella catarrhalis RH4]
 gi|295920176|gb|ADG60527.1| 50S ribosomal protein L10 [Moraxella catarrhalis RH4]
 gi|326561522|gb|EGE11865.1| 50S ribosomal protein L10 [Moraxella catarrhalis 7169]
 gi|326564351|gb|EGE14580.1| 50S ribosomal protein L10 [Moraxella catarrhalis 46P47B1]
 gi|326566150|gb|EGE16306.1| 50S ribosomal protein L10 [Moraxella catarrhalis 103P14B1]
 gi|326566160|gb|EGE16315.1| 50S ribosomal protein L10 [Moraxella catarrhalis 12P80B1]
 gi|326567992|gb|EGE18084.1| 50S ribosomal protein L10 [Moraxella catarrhalis BC7]
 gi|326570706|gb|EGE20740.1| 50S ribosomal protein L10 [Moraxella catarrhalis BC1]
 gi|326571261|gb|EGE21284.1| 50S ribosomal protein L10 [Moraxella catarrhalis BC8]
 gi|326573057|gb|EGE23030.1| 50S ribosomal protein L10 [Moraxella catarrhalis CO72]
 gi|326577245|gb|EGE27138.1| 50S ribosomal protein L10 [Moraxella catarrhalis 101P30B1]
 gi|326577816|gb|EGE27684.1| 50S ribosomal protein L10 [Moraxella catarrhalis O35E]
          Length = 167

 Score = 86.7 bits (213), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 48/154 (31%), Positives = 92/154 (59%), Gaps = 2/154 (1%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           +N Q K   ++E+++    + S VVA  +G++VA++ +LRK  REAG  +++ +N L++ 
Sbjct: 3   LNLQDKQAIVAEVNETAKGALSAVVADSRGVTVAKMTELRKAAREAGVDMRIVRNTLLRR 62

Query: 61  AIRDTSIRGISDLFVGQSLIVYS-DSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
           A+ DTS   ++D+FVG +LI +S + P  A ++   F+  N++F + G   E   ++  S
Sbjct: 63  ALADTSFECMNDVFVGPTLIAFSNEHPGAAARLFKEFAKANDKFEIKGAAFEGEFIDAKS 122

Query: 120 IKQIASLPDLEGIRAGIISAI-QSNATRLVRLLG 152
           I ++A+LP  +   A ++  + ++ A +L R L 
Sbjct: 123 IDRLATLPTYDEAIARLMGTMKEAAAGKLARTLA 156


>gi|16799359|ref|NP_469627.1| 50S ribosomal protein L10 [Listeria innocua Clip11262]
 gi|16802296|ref|NP_463781.1| 50S ribosomal protein L10 [Listeria monocytogenes EGD-e]
 gi|224498904|ref|ZP_03667253.1| 50S ribosomal protein L10 [Listeria monocytogenes Finland 1988]
 gi|224502456|ref|ZP_03670763.1| 50S ribosomal protein L10 [Listeria monocytogenes FSL R2-561]
 gi|254828710|ref|ZP_05233397.1| ribosomal protein L10 [Listeria monocytogenes FSL N3-165]
 gi|254831925|ref|ZP_05236580.1| 50S ribosomal protein L10 [Listeria monocytogenes 10403S]
 gi|255018559|ref|ZP_05290685.1| 50S ribosomal protein L10 [Listeria monocytogenes FSL F2-515]
 gi|255024695|ref|ZP_05296681.1| 50S ribosomal protein L10 [Listeria monocytogenes FSL J1-208]
 gi|255026640|ref|ZP_05298626.1| 50S ribosomal protein L10 [Listeria monocytogenes FSL J2-003]
 gi|255030465|ref|ZP_05302416.1| 50S ribosomal protein L10 [Listeria monocytogenes LO28]
 gi|284800544|ref|YP_003412409.1| 50S ribosomal protein L10 [Listeria monocytogenes 08-5578]
 gi|284993730|ref|YP_003415498.1| 50S ribosomal protein L10 [Listeria monocytogenes 08-5923]
 gi|315275368|ref|ZP_07869507.1| 50S ribosomal protein L10 [Listeria marthii FSL S4-120]
 gi|54039080|sp|P66043|RL10_LISIN RecName: Full=50S ribosomal protein L10
 gi|54041810|sp|P66042|RL10_LISMO RecName: Full=50S ribosomal protein L10
 gi|16409615|emb|CAD00777.1| ribosomal protein L10 [Listeria monocytogenes EGD-e]
 gi|16412711|emb|CAC95515.1| ribosomal protein L10 [Listeria innocua Clip11262]
 gi|258601115|gb|EEW14440.1| ribosomal protein L10 [Listeria monocytogenes FSL N3-165]
 gi|284056106|gb|ADB67047.1| 50S ribosomal protein L10 [Listeria monocytogenes 08-5578]
 gi|284059197|gb|ADB70136.1| 50S ribosomal protein L10 [Listeria monocytogenes 08-5923]
 gi|313615693|gb|EFR88985.1| 50S ribosomal protein L10 [Listeria marthii FSL S4-120]
 gi|313620913|gb|EFR92090.1| 50S ribosomal protein L10 [Listeria innocua FSL S4-378]
 gi|313625363|gb|EFR95155.1| 50S ribosomal protein L10 [Listeria innocua FSL J1-023]
          Length = 166

 Score = 86.7 bits (213), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 46/140 (32%), Positives = 79/140 (56%), Gaps = 1/140 (0%)

Query: 4   QGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIR 63
           + K   + E+    S+S S V+  Y+G++V +I DLRK++R+AG   KV KN L + A+ 
Sbjct: 6   EAKQSAVEEIKTKLSASASTVIVDYRGLNVGEITDLRKQLRDAGIEFKVYKNSLTRRAVE 65

Query: 64  DTSIRGISDLFVGQSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQ 122
                G+     G + I +S+  V+AP KI   F+ D+    +  GV+E  V + + IK 
Sbjct: 66  ANGYEGLEGALTGPNAIAFSNEDVVAPAKILNDFAKDHEALEIKAGVIEGKVASLEEIKA 125

Query: 123 IASLPDLEGIRAGIISAIQS 142
           +A+LP  EG+ + + + +Q+
Sbjct: 126 LATLPSREGLLSMLCNVLQA 145


>gi|313679515|ref|YP_004057254.1| LSU ribosomal protein l10p [Oceanithermus profundus DSM 14977]
 gi|313152230|gb|ADR36081.1| LSU ribosomal protein L10P [Oceanithermus profundus DSM 14977]
          Length = 175

 Score = 86.7 bits (213), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 47/154 (30%), Positives = 89/154 (57%), Gaps = 2/154 (1%)

Query: 19  SSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRGISDLFVGQS 78
           ++GS  + +Y+G+   +   LR+++ +AGG + VAKN L++IA+RD  +  + ++  G S
Sbjct: 20  TNGSFFLVNYQGLDANEEFQLRRQVTQAGGRIFVAKNTLIRIAVRDLELPEVDEVLKGPS 79

Query: 79  LIVYSDSPVIAPKISVSFSNDNNE--FRVLGGVVEKGVLNQDSIKQIASLPDLEGIRAGI 136
            +V  D PV   K  V F+ +N++   ++  G ++   L  + +K IA LP L+ +RA +
Sbjct: 80  AVVIYDEPVAVAKALVQFAKENSKEIPQIKAGFLQGQKLAPEEVKAIAELPTLDELRAEL 139

Query: 137 ISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQ 170
           +  +Q+  + LV +L   Q + V  + A+V K +
Sbjct: 140 VGVLQAPMSELVGVLEGAQREFVGLLDAYVSKQE 173


>gi|227497157|ref|ZP_03927405.1| ribosomal protein L10 [Actinomyces urogenitalis DSM 15434]
 gi|226833414|gb|EEH65797.1| ribosomal protein L10 [Actinomyces urogenitalis DSM 15434]
          Length = 173

 Score = 86.7 bits (213), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 52/172 (30%), Positives = 92/172 (53%), Gaps = 4/172 (2%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGG-VKVAKNRLVK 59
           M R  K   ++EL+  F  SG++++  Y+G++VA++K+LR+ +  AG     V KN L  
Sbjct: 1   MARPDKEAAVAELAGKFRDSGAVLLTEYRGLTVAELKELRRSL--AGNAEYAVVKNTLAA 58

Query: 60  IAIRDTSIRGISDLFVGQSLIVY-SDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQD 118
           IA R   +   +D   G + + + S  PV A K    F+ DN +  V GGV++  VL+  
Sbjct: 59  IAARQVGLEAFADDLKGPTALTFVSGEPVEAAKALRDFAKDNAKLVVKGGVMDGNVLDAS 118

Query: 119 SIKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQ 170
            + ++ASL   E + A    A++++ ++   L   P ++ VR + A  +K +
Sbjct: 119 EVDKLASLESREVLLAKAAGAMKASLSKAAYLFVAPASKAVRTVDALREKQE 170


>gi|326693431|ref|ZP_08230436.1| 50S ribosomal protein L10 [Leuconostoc argentinum KCTC 3773]
          Length = 191

 Score = 86.7 bits (213), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 45/137 (32%), Positives = 83/137 (60%), Gaps = 1/137 (0%)

Query: 6   KSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDT 65
           K+ ++ E+++ F ++ S+VV   +G++VAQ  +LR+++RE G  ++V KN+++  A    
Sbjct: 9   KAQKVEEVAEQFKNAASVVVVDSRGLTVAQSTELRQQLREEGVSLEVIKNKILTRAAEKA 68

Query: 66  SIRGISDLFVGQSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIA 124
               ++D+FVG S + +S    IAP +I   F++ N +  + GGVV+  + N D I + A
Sbjct: 69  GFAELNDIFVGPSAVAFSSEDAIAPSRILKKFADANEKLEIKGGVVDGNIANLDDINKYA 128

Query: 125 SLPDLEGIRAGIISAIQ 141
           SLP  EG+   +++  Q
Sbjct: 129 SLPSREGLLGQLMAEFQ 145


>gi|111220534|ref|YP_711328.1| 50S ribosomal protein L10 [Frankia alni ACN14a]
 gi|123044859|sp|Q0RRT3|RL10_FRAAA RecName: Full=50S ribosomal protein L10
 gi|111148066|emb|CAJ59733.1| 50S ribosomal protein L10 [Frankia alni ACN14a]
          Length = 194

 Score = 86.7 bits (213), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 52/166 (31%), Positives = 88/166 (53%), Gaps = 2/166 (1%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M +  K+  ++E+++ F  + + V+  Y+G++V+Q+ +LR+ + E G    V KN L KI
Sbjct: 1   MAKPEKTAAVAEIAEEFRGATAAVLTEYRGLTVSQLTELRRTLGE-GARYAVVKNTLTKI 59

Query: 61  AIRDTSIRGISDLFVGQSLIVY-SDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
           A     + G+ DLFVG + + + +  PV A K    F+  N    V GGVVE   +  D 
Sbjct: 60  AAEQAGVTGLDDLFVGPTAVAFVTGDPVEAAKGLRDFARANPALVVKGGVVEGKAMTADE 119

Query: 120 IKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAF 165
           I+++A L   E + A +  A++ + +  V L   P +QV R   A 
Sbjct: 120 IRKLADLESREILLAKLAGAMKGSLSGAVGLFAAPLSQVARLAEAL 165


>gi|290890966|ref|ZP_06554030.1| hypothetical protein AWRIB429_1420 [Oenococcus oeni AWRIB429]
 gi|290479365|gb|EFD88025.1| hypothetical protein AWRIB429_1420 [Oenococcus oeni AWRIB429]
          Length = 197

 Score = 86.7 bits (213), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 48/138 (34%), Positives = 84/138 (60%), Gaps = 1/138 (0%)

Query: 6   KSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDT 65
           K+ ++ E++ +FS+S S VVA  +G++VAQ  DLR ++R+ G  +KV KN+++  A    
Sbjct: 9   KAQKVDEVADMFSNSVSAVVADVRGLTVAQADDLRAQLRDEGVSLKVIKNKILTRAAEKA 68

Query: 66  SIRGISDLFVGQSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIA 124
             + ++DLF G S I +S   V+AP +I   FS   +   + GGV+++ V + D+I + A
Sbjct: 69  GYQELNDLFKGPSAIAFSKEDVVAPARILKKFSGTADALELKGGVIDRKVADLDTINRYA 128

Query: 125 SLPDLEGIRAGIISAIQS 142
           +LP  E +   +++  QS
Sbjct: 129 ALPSKETLLQQLLAEFQS 146


>gi|315301182|ref|ZP_07872446.1| 50S ribosomal protein L10 [Listeria ivanovii FSL F6-596]
 gi|313630452|gb|EFR98321.1| 50S ribosomal protein L10 [Listeria ivanovii FSL F6-596]
          Length = 166

 Score = 86.7 bits (213), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 46/140 (32%), Positives = 79/140 (56%), Gaps = 1/140 (0%)

Query: 4   QGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIR 63
           + K   + E+    S+S S V+  Y+G++V +I DLRK++R+AG   KV KN L + A+ 
Sbjct: 6   EAKQSAVEEIKTKLSASASTVIVDYRGLNVGEITDLRKQLRDAGIEFKVYKNSLTRRAVE 65

Query: 64  DTSIRGISDLFVGQSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQ 122
                G+     G + I +S+  V+AP KI   F+ D+    +  GV+E  V + + IK 
Sbjct: 66  ANGFDGLEGALTGPNAIAFSNEDVVAPAKILNDFAKDHEALEIKAGVIEGKVASLEEIKA 125

Query: 123 IASLPDLEGIRAGIISAIQS 142
           +A+LP  EG+ + + + +Q+
Sbjct: 126 LATLPSREGLLSMLCNVLQA 145


>gi|223936437|ref|ZP_03628349.1| ribosomal protein L10 [bacterium Ellin514]
 gi|223894955|gb|EEF61404.1| ribosomal protein L10 [bacterium Ellin514]
          Length = 170

 Score = 86.7 bits (213), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 55/169 (32%), Positives = 93/169 (55%), Gaps = 2/169 (1%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M  + K++    LS++ +S   IVV +Y+G+ V  I DLRK++ +AG  V V KN L +I
Sbjct: 1   MRAEKKNITQEYLSRLNASPFFIVV-NYQGLKVGPITDLRKRLIKAGAEVHVVKNSLFRI 59

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPV-IAPKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
           A ++  +  ++    GQ  ++     V  A KI  +FS++  + +V  G +    L    
Sbjct: 60  AAKEAGVADLNGALTGQIAVITGQKDVSAAAKIVKTFSSEFEKLKVKFGYLNNNRLEASD 119

Query: 120 IKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDK 168
           +  +A LP +E +R  ++  +Q+ A+ LV LL TP +Q+ R + A VDK
Sbjct: 120 LSALADLPSIEVLRGKLLGVLQAPASTLVALLNTPGSQLARVLQARVDK 168


>gi|320009116|gb|ADW03966.1| ribosomal protein L10 [Streptomyces flavogriseus ATCC 33331]
          Length = 185

 Score = 86.7 bits (213), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 55/174 (31%), Positives = 91/174 (52%), Gaps = 3/174 (1%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M R  K+  ++EL+  F SS + V+  Y+G++VAQ+K LR+ + E      V KN L KI
Sbjct: 1   MARPDKAAAVAELTDQFRSSNAAVLTEYRGLTVAQLKTLRRSLGE-NAQYAVVKNTLTKI 59

Query: 61  AIRDTSIRGISDLFVGQSLIVY-SDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
           A  +  I  + DLF G + + + +  PV + K    F+ DN    + GGV++   L+ D 
Sbjct: 60  AANEAGIDTLDDLFAGPTAVAFITGDPVESAKGLRDFAKDNPNLIIKGGVLDGKALSADE 119

Query: 120 IKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAF-VDKNQQG 172
           IK++A L   E + A +  A++   T+  +L     ++ VR   A    + +QG
Sbjct: 120 IKKLADLESREVLLAKLAGAMKGKQTQAAQLFQALPSKFVRTAEALRAKRAEQG 173


>gi|299821046|ref|ZP_07052934.1| 50S ribosomal protein L10 [Listeria grayi DSM 20601]
 gi|299816711|gb|EFI83947.1| 50S ribosomal protein L10 [Listeria grayi DSM 20601]
          Length = 166

 Score = 86.7 bits (213), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 46/140 (32%), Positives = 81/140 (57%), Gaps = 1/140 (0%)

Query: 4   QGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIR 63
           + K   ++E+      S S V+  Y+G++VA++ +LRK++REAG   KV KN L + A+ 
Sbjct: 6   EAKQNAVNEIKTKIEESVSTVIVDYRGLNVAEVTELRKQLREAGIDFKVYKNSLTRRAVA 65

Query: 64  DTSIRGISDLFVGQSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQ 122
             S+ G+  +  G + I +S+  V+AP KI   FS D+    +  G++E  V + + IK 
Sbjct: 66  ANSLEGLDKVLTGPNAIAFSNEDVVAPAKILNDFSKDHEALEIKAGIIEGKVSSLEEIKA 125

Query: 123 IASLPDLEGIRAGIISAIQS 142
           +A LP  EG+ + + + +Q+
Sbjct: 126 LADLPSREGLLSMLCNVLQA 145


>gi|30018369|ref|NP_830000.1| 50S ribosomal protein L10 [Bacillus cereus ATCC 14579]
 gi|229125616|ref|ZP_04254648.1| 50S ribosomal protein L10 [Bacillus cereus BDRD-Cer4]
 gi|61215265|sp|Q81J51|RL10_BACCR RecName: Full=50S ribosomal protein L10
 gi|29893909|gb|AAP07201.1| LSU ribosomal protein L10P [Bacillus cereus ATCC 14579]
 gi|228657808|gb|EEL13614.1| 50S ribosomal protein L10 [Bacillus cereus BDRD-Cer4]
          Length = 166

 Score = 86.7 bits (213), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 42/134 (31%), Positives = 80/134 (59%), Gaps = 1/134 (0%)

Query: 10  ISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRG 69
           ++E++    +S S +V  Y+G++V++  +LRK++REAG   KV KN L + A     +  
Sbjct: 12  VTEIADKLRASKSTIVVDYRGLTVSEATELRKQLREAGVEFKVYKNSLTRRAAESAEMAE 71

Query: 70  ISDLFVGQSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASLPD 128
           +++   G + I +S+  V+AP K+   F+ D+    +  GV+E  ++  D +K IA+LP 
Sbjct: 72  LNEFLTGPNAIAFSNEDVVAPAKVLNDFAKDHEALEIKAGVIEGKLVTLDEVKAIATLPS 131

Query: 129 LEGIRAGIISAIQS 142
            EG+ + ++S +Q+
Sbjct: 132 REGLLSMLLSVLQA 145


>gi|90962212|ref|YP_536128.1| 50S ribosomal protein L10 [Lactobacillus salivarius UCC118]
 gi|227891218|ref|ZP_04009023.1| 50S ribosomal protein L10 [Lactobacillus salivarius ATCC 11741]
 gi|301299856|ref|ZP_07206090.1| ribosomal protein L10 [Lactobacillus salivarius ACS-116-V-Col5a]
 gi|122448742|sp|Q1WST4|RL10_LACS1 RecName: Full=50S ribosomal protein L10
 gi|90821406|gb|ABE00045.1| LSU ribosomal protein L10P [Lactobacillus salivarius UCC118]
 gi|227867092|gb|EEJ74513.1| 50S ribosomal protein L10 [Lactobacillus salivarius ATCC 11741]
 gi|300214877|gb|ADJ79293.1| 50S ribosomal protein L10 [Lactobacillus salivarius CECT 5713]
 gi|300852527|gb|EFK80177.1| ribosomal protein L10 [Lactobacillus salivarius ACS-116-V-Col5a]
          Length = 167

 Score = 86.3 bits (212), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 42/138 (30%), Positives = 81/138 (58%), Gaps = 1/138 (0%)

Query: 6   KSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDT 65
           K+  + E+ + F S+ S+VV  Y+G++V ++ DLRK++REAG  ++V KN  +K A    
Sbjct: 9   KAAIVEEVFEKFQSASSVVVVDYRGLTVEEVTDLRKQLREAGVEMRVIKNTFLKRAADKA 68

Query: 66  SIRGISDLFVGQSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIA 124
              G+ D F G + + +    + AP +I   F+ D+    + GG++E  + + + I  +A
Sbjct: 69  GYEGLDDTFSGPTAVAFGGEDITAPARIMAKFAEDHEALEIKGGMIEGKIASLEEINALA 128

Query: 125 SLPDLEGIRAGIISAIQS 142
            LP+ +G+ + ++S +Q+
Sbjct: 129 KLPNRDGLLSMLLSVLQA 146


>gi|197117314|ref|YP_002137741.1| 50S ribosomal protein L10 [Geobacter bemidjiensis Bem]
 gi|253701931|ref|YP_003023120.1| 50S ribosomal protein L10 [Geobacter sp. M21]
 gi|226699955|sp|B5EFP1|RL10_GEOBB RecName: Full=50S ribosomal protein L10
 gi|259645482|sp|C6E4R6|RL10_GEOSM RecName: Full=50S ribosomal protein L10
 gi|197086674|gb|ACH37945.1| ribosomal protein L10 [Geobacter bemidjiensis Bem]
 gi|251776781|gb|ACT19362.1| ribosomal protein L10 [Geobacter sp. M21]
          Length = 173

 Score = 86.3 bits (212), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 50/166 (30%), Positives = 91/166 (54%), Gaps = 2/166 (1%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           MN++ K   ++E+      + ++ +A ++G++V Q  +LR ++R+A    KV KN L++I
Sbjct: 1   MNKENKQELVAEMHDKLQRAQAVFLADFRGMNVGQATELRNELRKANAEYKVVKNTLLEI 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYS-DSPVIAPKISVSFSNDN-NEFRVLGGVVEKGVLNQD 118
           A + T   G++  + G + I    D PV A K+   F+ +N N F +  GV+    +N  
Sbjct: 61  ASKGTDKEGLNPYYAGPTAIALCYDDPVAAAKVLSRFNKENTNPFTLKAGVLTGKTINVA 120

Query: 119 SIKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISA 164
            I+ +A LP  E + A ++ ++Q+ A+  VR+L       VRA+ A
Sbjct: 121 DIQALADLPSREVLIAKMLGSMQAPASNFVRVLAAVPGGFVRALDA 166


>gi|118475868|ref|YP_893019.1| 50S ribosomal protein L10 [Bacillus thuringiensis str. Al Hakam]
 gi|118415093|gb|ABK83512.1| LSU ribosomal protein L10P [Bacillus thuringiensis str. Al Hakam]
          Length = 192

 Score = 86.3 bits (212), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 42/134 (31%), Positives = 80/134 (59%), Gaps = 1/134 (0%)

Query: 10  ISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRG 69
           ++E++    +S S +V  Y+G++V++  +LRK++REAG   KV KN L + A     +  
Sbjct: 38  VTEIADKLRASKSTIVVDYRGLTVSEATELRKQLREAGVEFKVYKNSLTRRAAESAEMAE 97

Query: 70  ISDLFVGQSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASLPD 128
           +++   G + I +S+  V+AP K+   F+ D+    +  GV+E  ++  D +K IA+LP 
Sbjct: 98  LNEFLTGPNAIAFSNEDVVAPAKVLNDFAKDHEALEIKAGVIEGKLVTLDEVKAIATLPS 157

Query: 129 LEGIRAGIISAIQS 142
            EG+ + ++S +Q+
Sbjct: 158 REGLLSMLLSVLQA 171


>gi|116491399|ref|YP_810943.1| 50S ribosomal protein L10P [Oenococcus oeni PSU-1]
 gi|122276419|sp|Q04E44|RL10_OENOB RecName: Full=50S ribosomal protein L10
 gi|116092124|gb|ABJ57278.1| LSU ribosomal protein L10P [Oenococcus oeni PSU-1]
          Length = 197

 Score = 86.3 bits (212), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 48/138 (34%), Positives = 84/138 (60%), Gaps = 1/138 (0%)

Query: 6   KSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDT 65
           K+ ++ E++ +FS+S S VVA  +G++VAQ  DLR ++R+ G  +KV KN+++  A    
Sbjct: 9   KAQKVDEVADMFSNSVSAVVADVRGLTVAQADDLRAQLRDEGVSLKVIKNKILTRAAEKA 68

Query: 66  SIRGISDLFVGQSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIA 124
             + ++DLF G S I +S   V+AP +I   FS   +   + GGV+++ V + D+I + A
Sbjct: 69  GYQELNDLFKGPSAIAFSKEDVVAPARILKKFSGTADALELKGGVIDRKVADLDTINRYA 128

Query: 125 SLPDLEGIRAGIISAIQS 142
           +LP  E +   +++  QS
Sbjct: 129 ALPSKETLLQQLLAEFQS 146


>gi|30260290|ref|NP_842667.1| 50S ribosomal protein L10 [Bacillus anthracis str. Ames]
 gi|42779180|ref|NP_976427.1| 50S ribosomal protein L10 [Bacillus cereus ATCC 10987]
 gi|47525354|ref|YP_016703.1| 50S ribosomal protein L10 [Bacillus anthracis str. 'Ames Ancestor']
 gi|49183133|ref|YP_026385.1| 50S ribosomal protein L10 [Bacillus anthracis str. Sterne]
 gi|49479290|ref|YP_034451.1| 50S ribosomal protein L10 [Bacillus thuringiensis serovar konkukian
           str. 97-27]
 gi|52145118|ref|YP_081710.1| 50S ribosomal protein L10 [Bacillus cereus E33L]
 gi|167636700|ref|ZP_02394987.1| ribosomal protein L10 [Bacillus anthracis str. A0442]
 gi|206972248|ref|ZP_03233195.1| 50S ribosomal protein L10 [Bacillus cereus AH1134]
 gi|217957674|ref|YP_002336218.1| 50S ribosomal protein L10 [Bacillus cereus AH187]
 gi|218232450|ref|YP_002364948.1| 50S ribosomal protein L10 [Bacillus cereus B4264]
 gi|218901302|ref|YP_002449136.1| ribosomal protein L10 [Bacillus cereus AH820]
 gi|222093869|ref|YP_002527919.1| 50S ribosomal protein l10 [Bacillus cereus Q1]
 gi|225862151|ref|YP_002747529.1| 50S ribosomal protein L10 [Bacillus cereus 03BB102]
 gi|227812772|ref|YP_002812781.1| 50S ribosomal protein L10 [Bacillus anthracis str. CDC 684]
 gi|228912838|ref|ZP_04076485.1| 50S ribosomal protein L10 [Bacillus thuringiensis serovar
           pulsiensis BGSC 4CC1]
 gi|228919049|ref|ZP_04082428.1| 50S ribosomal protein L10 [Bacillus thuringiensis serovar
           huazhongensis BGSC 4BD1]
 gi|228925352|ref|ZP_04088448.1| 50S ribosomal protein L10 [Bacillus thuringiensis serovar
           pondicheriensis BGSC 4BA1]
 gi|228931601|ref|ZP_04094507.1| 50S ribosomal protein L10 [Bacillus thuringiensis serovar
           andalousiensis BGSC 4AW1]
 gi|228943905|ref|ZP_04106290.1| 50S ribosomal protein L10 [Bacillus thuringiensis serovar monterrey
           BGSC 4AJ1]
 gi|228950647|ref|ZP_04112781.1| 50S ribosomal protein L10 [Bacillus thuringiensis serovar kurstaki
           str. T03a001]
 gi|228956540|ref|ZP_04118336.1| 50S ribosomal protein L10 [Bacillus thuringiensis serovar pakistani
           str. T13001]
 gi|228983354|ref|ZP_04143567.1| 50S ribosomal protein L10 [Bacillus thuringiensis serovar
           tochigiensis BGSC 4Y1]
 gi|229041004|ref|ZP_04189767.1| 50S ribosomal protein L10 [Bacillus cereus AH676]
 gi|229067864|ref|ZP_04201181.1| 50S ribosomal protein L10 [Bacillus cereus F65185]
 gi|229077396|ref|ZP_04210054.1| 50S ribosomal protein L10 [Bacillus cereus Rock4-2]
 gi|229089230|ref|ZP_04220511.1| 50S ribosomal protein L10 [Bacillus cereus Rock3-42]
 gi|229107785|ref|ZP_04237421.1| 50S ribosomal protein L10 [Bacillus cereus Rock1-15]
 gi|229119761|ref|ZP_04249022.1| 50S ribosomal protein L10 [Bacillus cereus 95/8201]
 gi|229136945|ref|ZP_04265572.1| 50S ribosomal protein L10 [Bacillus cereus BDRD-ST26]
 gi|229142905|ref|ZP_04271346.1| 50S ribosomal protein L10 [Bacillus cereus BDRD-ST24]
 gi|229148508|ref|ZP_04276764.1| 50S ribosomal protein L10 [Bacillus cereus m1550]
 gi|229153877|ref|ZP_04282007.1| 50S ribosomal protein L10 [Bacillus cereus ATCC 4342]
 gi|229176699|ref|ZP_04304103.1| 50S ribosomal protein L10 [Bacillus cereus 172560W]
 gi|229182493|ref|ZP_04309744.1| 50S ribosomal protein L10 [Bacillus cereus BGSC 6E1]
 gi|229188384|ref|ZP_04315432.1| 50S ribosomal protein L10 [Bacillus cereus ATCC 10876]
 gi|229194489|ref|ZP_04321292.1| 50S ribosomal protein L10 [Bacillus cereus m1293]
 gi|229602067|ref|YP_002864750.1| 50S ribosomal protein L10 [Bacillus anthracis str. A0248]
 gi|254684397|ref|ZP_05148257.1| 50S ribosomal protein L10 [Bacillus anthracis str. CNEVA-9066]
 gi|254733746|ref|ZP_05191461.1| 50S ribosomal protein L10 [Bacillus anthracis str. Western North
           America USA6153]
 gi|254739415|ref|ZP_05197115.1| 50S ribosomal protein L10 [Bacillus anthracis str. Kruger B]
 gi|254751212|ref|ZP_05203250.1| 50S ribosomal protein L10 [Bacillus anthracis str. Vollum]
 gi|254756811|ref|ZP_05208839.1| 50S ribosomal protein L10 [Bacillus anthracis str. Australia 94]
 gi|296500933|ref|YP_003662633.1| 50S ribosomal protein L10 [Bacillus thuringiensis BMB171]
 gi|300119590|ref|ZP_07057134.1| 50S ribosomal protein L10 [Bacillus cereus SJ1]
 gi|301051836|ref|YP_003790047.1| 50S ribosomal protein L10 [Bacillus anthracis CI]
 gi|61214844|sp|Q63HA1|RL10_BACCZ RecName: Full=50S ribosomal protein L10
 gi|61215018|sp|Q6HPR9|RL10_BACHK RecName: Full=50S ribosomal protein L10
 gi|61215105|sp|Q73FA7|RL10_BACC1 RecName: Full=50S ribosomal protein L10
 gi|61215266|sp|Q81VU1|RL10_BACAN RecName: Full=50S ribosomal protein L10
 gi|226699905|sp|B7JKA7|RL10_BACC0 RecName: Full=50S ribosomal protein L10
 gi|226699907|sp|B7HJ37|RL10_BACC4 RecName: Full=50S ribosomal protein L10
 gi|226699908|sp|B7HQT3|RL10_BACC7 RecName: Full=50S ribosomal protein L10
 gi|254798356|sp|C3P9P4|RL10_BACAA RecName: Full=50S ribosomal protein L10
 gi|254798357|sp|C3LJ71|RL10_BACAC RecName: Full=50S ribosomal protein L10
 gi|254798358|sp|C1ET28|RL10_BACC3 RecName: Full=50S ribosomal protein L10
 gi|254798359|sp|B9IZI3|RL10_BACCQ RecName: Full=50S ribosomal protein L10
 gi|30253611|gb|AAP24153.1| 50S ribosomal protein L10 [Bacillus anthracis str. Ames]
 gi|42735095|gb|AAS39035.1| ribosomal protein L10 [Bacillus cereus ATCC 10987]
 gi|47500502|gb|AAT29178.1| ribosomal protein L10 [Bacillus anthracis str. 'Ames Ancestor']
 gi|49177060|gb|AAT52436.1| ribosomal protein L10 [Bacillus anthracis str. Sterne]
 gi|49330846|gb|AAT61492.1| ribosomal protein L10 (50S ribosomal protein L10) [Bacillus
           thuringiensis serovar konkukian str. 97-27]
 gi|51978587|gb|AAU20137.1| ribosomal protein L10 (50S ribosomal protein L10) [Bacillus cereus
           E33L]
 gi|167527874|gb|EDR90701.1| ribosomal protein L10 [Bacillus anthracis str. A0442]
 gi|206732822|gb|EDZ49997.1| 50S ribosomal protein L10 [Bacillus cereus AH1134]
 gi|217064374|gb|ACJ78624.1| ribosomal protein L10 [Bacillus cereus AH187]
 gi|218160407|gb|ACK60399.1| ribosomal protein L10 [Bacillus cereus B4264]
 gi|218536959|gb|ACK89357.1| ribosomal protein L10 [Bacillus cereus AH820]
 gi|221237917|gb|ACM10627.1| ribosomal protein L10 (50S ribosomal protein L10) [Bacillus cereus
           Q1]
 gi|225787446|gb|ACO27663.1| 50S ribosomal protein L10 [Bacillus cereus 03BB102]
 gi|227003565|gb|ACP13308.1| 50S ribosomal protein L10 [Bacillus anthracis str. CDC 684]
 gi|228588955|gb|EEK46970.1| 50S ribosomal protein L10 [Bacillus cereus m1293]
 gi|228595058|gb|EEK52829.1| 50S ribosomal protein L10 [Bacillus cereus ATCC 10876]
 gi|228600948|gb|EEK58517.1| 50S ribosomal protein L10 [Bacillus cereus BGSC 6E1]
 gi|228606742|gb|EEK64159.1| 50S ribosomal protein L10 [Bacillus cereus 172560W]
 gi|228629558|gb|EEK86255.1| 50S ribosomal protein L10 [Bacillus cereus ATCC 4342]
 gi|228634924|gb|EEK91497.1| 50S ribosomal protein L10 [Bacillus cereus m1550]
 gi|228640526|gb|EEK96915.1| 50S ribosomal protein L10 [Bacillus cereus BDRD-ST24]
 gi|228646483|gb|EEL02690.1| 50S ribosomal protein L10 [Bacillus cereus BDRD-ST26]
 gi|228663662|gb|EEL19241.1| 50S ribosomal protein L10 [Bacillus cereus 95/8201]
 gi|228675634|gb|EEL30842.1| 50S ribosomal protein L10 [Bacillus cereus Rock1-15]
 gi|228694069|gb|EEL47751.1| 50S ribosomal protein L10 [Bacillus cereus Rock3-42]
 gi|228705915|gb|EEL58243.1| 50S ribosomal protein L10 [Bacillus cereus Rock4-2]
 gi|228715223|gb|EEL67082.1| 50S ribosomal protein L10 [Bacillus cereus F65185]
 gi|228727301|gb|EEL78495.1| 50S ribosomal protein L10 [Bacillus cereus AH676]
 gi|228776344|gb|EEM24697.1| 50S ribosomal protein L10 [Bacillus thuringiensis serovar
           tochigiensis BGSC 4Y1]
 gi|228803105|gb|EEM49927.1| 50S ribosomal protein L10 [Bacillus thuringiensis serovar pakistani
           str. T13001]
 gi|228808998|gb|EEM55483.1| 50S ribosomal protein L10 [Bacillus thuringiensis serovar kurstaki
           str. T03a001]
 gi|228815738|gb|EEM61974.1| 50S ribosomal protein L10 [Bacillus thuringiensis serovar monterrey
           BGSC 4AJ1]
 gi|228828029|gb|EEM73757.1| 50S ribosomal protein L10 [Bacillus thuringiensis serovar
           andalousiensis BGSC 4AW1]
 gi|228834274|gb|EEM79815.1| 50S ribosomal protein L10 [Bacillus thuringiensis serovar
           pondicheriensis BGSC 4BA1]
 gi|228840574|gb|EEM85836.1| 50S ribosomal protein L10 [Bacillus thuringiensis serovar
           huazhongensis BGSC 4BD1]
 gi|228846774|gb|EEM91779.1| 50S ribosomal protein L10 [Bacillus thuringiensis serovar
           pulsiensis BGSC 4CC1]
 gi|229266475|gb|ACQ48112.1| 50S ribosomal protein L10 [Bacillus anthracis str. A0248]
 gi|296321985|gb|ADH04913.1| 50S ribosomal protein L10 [Bacillus thuringiensis BMB171]
 gi|298723062|gb|EFI63960.1| 50S ribosomal protein L10 [Bacillus cereus SJ1]
 gi|300374005|gb|ADK02909.1| 50S ribosomal protein L10 [Bacillus cereus biovar anthracis str.
           CI]
 gi|324324089|gb|ADY19349.1| 50S ribosomal protein L10 [Bacillus thuringiensis serovar finitimus
           YBT-020]
          Length = 166

 Score = 86.3 bits (212), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 42/134 (31%), Positives = 80/134 (59%), Gaps = 1/134 (0%)

Query: 10  ISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRG 69
           ++E++    +S S +V  Y+G++V++  +LRK++REAG   KV KN L + A     +  
Sbjct: 12  VTEIADKLRASKSTIVVDYRGLTVSEATELRKQLREAGVEFKVYKNSLTRRAAESAEMAE 71

Query: 70  ISDLFVGQSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASLPD 128
           +++   G + I +S+  V+AP K+   F+ D+    +  GV+E  ++  D +K IA+LP 
Sbjct: 72  LNEFLTGPNAIAFSNEDVVAPAKVLNDFAKDHEALEIKAGVIEGKLVTLDEVKAIATLPS 131

Query: 129 LEGIRAGIISAIQS 142
            EG+ + ++S +Q+
Sbjct: 132 REGLLSMLLSVLQA 145


>gi|89893203|ref|YP_516690.1| 50S ribosomal protein L10 [Desulfitobacterium hafniense Y51]
 gi|219666476|ref|YP_002456911.1| 50S ribosomal protein L10 [Desulfitobacterium hafniense DCB-2]
 gi|89332651|dbj|BAE82246.1| 50S ribosomal protein L10 [Desulfitobacterium hafniense Y51]
 gi|219536736|gb|ACL18475.1| ribosomal protein L10 [Desulfitobacterium hafniense DCB-2]
          Length = 174

 Score = 86.3 bits (212), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 45/153 (29%), Positives = 84/153 (54%)

Query: 2   NRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIA 61
           N + K+  ++E+ + F +S  +V+A Y+G++VAQ+  LR ++R+AG    V KN +V+ A
Sbjct: 3   NIEEKAQVVAEIKERFQNSTGVVLADYRGLTVAQVTQLRAQLRQAGVEYHVLKNTMVRRA 62

Query: 62  IRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSIK 121
             +  I G+     G + + +S  PV   K+   F+  +  F +  GVVE  V+++  +K
Sbjct: 63  AHEVGIEGLDGYLEGPTAVAFSADPVAGAKVLADFAKTSKTFAIKAGVVEGKVVDEAGVK 122

Query: 122 QIASLPDLEGIRAGIISAIQSNATRLVRLLGTP 154
            +A LP  E + A ++  +Q+    +  +L  P
Sbjct: 123 ALAELPSREVLLAQVLRGMQAPLVGMANVLQGP 155


>gi|257876784|ref|ZP_05656437.1| ribosomal protein L10 [Enterococcus casseliflavus EC20]
 gi|257810950|gb|EEV39770.1| ribosomal protein L10 [Enterococcus casseliflavus EC20]
          Length = 166

 Score = 86.3 bits (212), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 49/168 (29%), Positives = 93/168 (55%), Gaps = 12/168 (7%)

Query: 6   KSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDT 65
           KS  + E+S+ FS++ S+VV  Y+G++V ++  LRK++R+A   +KV KN ++  A    
Sbjct: 9   KSAIVDEVSEKFSAAASVVVVDYRGLTVDEVTRLRKQLRDANVEMKVIKNSILSRAAEKA 68

Query: 66  SIRGISDLFVGQSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIA 124
            + G+ ++F G + + +S+  V+AP KI   F+ +     + GG++E  V + + I  +A
Sbjct: 69  GLEGLGEVFTGPTAVAFSNEDVVAPAKIINDFAKEAKALEIKGGIIEGKVSSLEEITALA 128

Query: 125 SLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQQG 172
            LP+ EG+ + ++S +Q+           P   V  A+ A  +K +  
Sbjct: 129 KLPNREGLLSMLLSVLQA-----------PIRNVAYAVKAVAEKEEDA 165


>gi|257063573|ref|YP_003143245.1| ribosomal protein L10 [Slackia heliotrinireducens DSM 20476]
 gi|256791226|gb|ACV21896.1| ribosomal protein L10 [Slackia heliotrinireducens DSM 20476]
          Length = 173

 Score = 85.9 bits (211), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 49/148 (33%), Positives = 84/148 (56%), Gaps = 2/148 (1%)

Query: 10  ISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRG 69
           + ++++   ++ ++ V  Y+G++V + + LR+ +REAGG + V KN LVK+A++      
Sbjct: 10  VEKITEELKAANAMWVVDYRGLTVKEAEVLRRAVREAGGHMNVHKNTLVKLALKGLDQPT 69

Query: 70  ISDLFVGQSLIVYSD-SPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASLPD 128
           + D+  G S  +++D  PV A K+   ++ DN +  + GGV+E   L  D ++ IASLP 
Sbjct: 70  LDDILAGPSAFIFADGDPVAAAKVVKEYAKDNEKMVIKGGVMEGSALTADDVEAIASLPS 129

Query: 129 LEGIRAGIISAIQSNATRL-VRLLGTPQ 155
            E +   I  AI   A  L V L G P+
Sbjct: 130 REQLYGQIAGAISGMARGLAVALSGLPR 157


>gi|296119184|ref|ZP_06837754.1| ribosomal protein L10 [Corynebacterium ammoniagenes DSM 20306]
 gi|295967810|gb|EFG81065.1| ribosomal protein L10 [Corynebacterium ammoniagenes DSM 20306]
          Length = 171

 Score = 85.9 bits (211), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 54/167 (32%), Positives = 87/167 (52%), Gaps = 6/167 (3%)

Query: 7   SVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVK--VAKNRLVKIAIRD 64
           + E++EL +  + S SIV+  Y+G+SVAQ+++LR  +   G  V   VAKN L KIA  +
Sbjct: 7   TAELAELKEKIAESSSIVITEYRGLSVAQLQELRTNL---GFDVDYSVAKNTLFKIAANE 63

Query: 65  TSIRGISDLFVGQSLIVY-SDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQI 123
             I G+ +   G +   +     V A K+   F++DN    V GG ++   L+ D +K I
Sbjct: 64  AGIEGLDEHLSGPTAFAFIKGEAVDAAKVMKKFADDNEALVVKGGYMDGSALSADQVKAI 123

Query: 124 ASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQ 170
           A L + E   A +  A++ N  +   L   P +QV R  +A  +K +
Sbjct: 124 ADLDNRETTLAKLAGAMKGNLAKAAGLFNAPASQVARLSAALQEKKE 170


>gi|167041787|gb|ABZ06529.1| putative ribosomal protein L10 [uncultured marine microorganism
           HF4000_093M11]
          Length = 174

 Score = 85.9 bits (211), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 50/172 (29%), Positives = 90/172 (52%), Gaps = 5/172 (2%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M R  K  ++SEL  IF+S  + V+  Y+GI   Q+ +LRK++ +    +KV KN L +I
Sbjct: 1   MERSQKEAQVSELRTIFNSMSAGVLVDYRGIEANQVVELRKQLNDVSSTMKVIKNSLARI 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVI-APKISVSFSNDNNEFRVLGGVV----EKGVL 115
           A  DT   G++D F     +VYS+   +   K+    +      ++L G++    +  +L
Sbjct: 61  AAEDTPFSGLADQFTQTRALVYSEGDAVQQAKVLSEAAQKLENLKILAGILIGENKTSIL 120

Query: 116 NQDSIKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVD 167
           N+  ++ ++ LP  E +   ++  +Q+ AT+ VR L     + VR ++A  D
Sbjct: 121 NRGEVEALSKLPSREELIVKLLFLMQAPATQFVRTLNAVPAKFVRTLAAIRD 172


>gi|20978573|sp|Q8XHR6|RL10_CLOPE RecName: Full=50S ribosomal protein L10
 gi|18146081|dbj|BAB82121.1| 50S ribosomal protein L10 [Clostridium perfringens str. 13]
          Length = 169

 Score = 85.9 bits (211), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 51/171 (29%), Positives = 90/171 (52%), Gaps = 12/171 (7%)

Query: 2   NRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIA 61
           NRQ K  +++E+ +    + S+V+A Y+G++V Q  +LRK +REAG   KV KN LV +A
Sbjct: 7   NRQLKEAKVAEIKEKLEKAQSVVLASYQGLTVEQDTNLRKSLREAGVEYKVYKNTLVTLA 66

Query: 62  IRDTSIRGISDLFVGQSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
            ++    GI +   G   I +      AP +I   F+ +N +  +   +VE  V N++  
Sbjct: 67  AKELGFDGIVEYLEGPVSIAFGYEDATAPARILNDFAKENKKLELKAAIVEGTVYNKEQT 126

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQQ 171
           +Q+A++P  E + A ++ +I+S           P +     +SA  DK ++
Sbjct: 127 EQLAAIPSREVLLAKLLGSIKS-----------PLSNFAYLLSAIADKKEE 166


>gi|110800500|ref|YP_697104.1| 50S ribosomal protein L10 [Clostridium perfringens ATCC 13124]
 gi|110802684|ref|YP_699673.1| 50S ribosomal protein L10 [Clostridium perfringens SM101]
 gi|161485640|ref|NP_563331.2| 50S ribosomal protein L10 [Clostridium perfringens str. 13]
 gi|169344023|ref|ZP_02865012.1| ribosomal protein L10 [Clostridium perfringens C str. JGS1495]
 gi|110675147|gb|ABG84134.1| 50S ribosomal protein L10 [Clostridium perfringens ATCC 13124]
 gi|110683185|gb|ABG86555.1| 50S ribosomal protein L10 [Clostridium perfringens SM101]
 gi|169297847|gb|EDS79943.1| ribosomal protein L10 [Clostridium perfringens C str. JGS1495]
          Length = 166

 Score = 85.9 bits (211), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 51/171 (29%), Positives = 90/171 (52%), Gaps = 12/171 (7%)

Query: 2   NRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIA 61
           NRQ K  +++E+ +    + S+V+A Y+G++V Q  +LRK +REAG   KV KN LV +A
Sbjct: 4   NRQLKEAKVAEIKEKLEKAQSVVLASYQGLTVEQDTNLRKSLREAGVEYKVYKNTLVTLA 63

Query: 62  IRDTSIRGISDLFVGQSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
            ++    GI +   G   I +      AP +I   F+ +N +  +   +VE  V N++  
Sbjct: 64  AKELGFDGIVEYLEGPVSIAFGYEDATAPARILNDFAKENKKLELKAAIVEGTVYNKEQT 123

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQQ 171
           +Q+A++P  E + A ++ +I+S           P +     +SA  DK ++
Sbjct: 124 EQLAAIPSREVLLAKLLGSIKS-----------PLSNFAYLLSAIADKKEE 163


>gi|56961921|ref|YP_173643.1| 50S ribosomal protein L10 [Bacillus clausii KSM-K16]
 gi|61214765|sp|Q5WLS3|RL10_BACSK RecName: Full=50S ribosomal protein L10
 gi|56908155|dbj|BAD62682.1| 50S ribosomal protein L10 [Bacillus clausii KSM-K16]
          Length = 166

 Score = 85.9 bits (211), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 45/134 (33%), Positives = 78/134 (58%), Gaps = 1/134 (0%)

Query: 10  ISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRG 69
           ++E++     S S V+  Y+G++VAQ+ +LRK++REAG   KV KN LV+ A  +  + G
Sbjct: 12  VAEVAAKLRDSKSTVIVDYRGLNVAQVTELRKQLREAGVEYKVYKNTLVRRATAEAGLTG 71

Query: 70  ISDLFVGQSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASLPD 128
           + +  VG + I +    VIAP K+   F+ +N    +  GV+E  +   D +K +A LP 
Sbjct: 72  LDEHLVGPTAIAFGVDDVIAPAKVLNEFAKNNEALTIKTGVIEGNISTADEVKALAELPS 131

Query: 129 LEGIRAGIISAIQS 142
            EG+ + + + +Q+
Sbjct: 132 REGLLSMLANVLQA 145


>gi|311896604|dbj|BAJ29012.1| putative ribosomal protein L10 [Kitasatospora setae KM-6054]
          Length = 184

 Score = 85.9 bits (211), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 51/175 (29%), Positives = 95/175 (54%), Gaps = 6/175 (3%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVA--KNRLV 58
           M R  K+ +++E++  F +S + V+  Y+G++V Q+K LR+ +   GG    A  KN L 
Sbjct: 1   MARPDKAADVAEITDKFRASSAAVLTEYRGLTVKQLKTLRRSL---GGNADYAVVKNTLT 57

Query: 59  KIAIRDTSIRGISDLFVGQSLIVY-SDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQ 117
           KIA  +  I  + DLF G + + + +  PV + K    F+ +N    + GGV++   L+ 
Sbjct: 58  KIAANEAGISELDDLFAGPTAVAFVTGDPVESAKALRDFAKENPALIIKGGVLDGKALSA 117

Query: 118 DSIKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQQG 172
           D IK++A L   E + A +  A+++  ++   +     +++VR + A  +K +QG
Sbjct: 118 DEIKKLADLESREVLLAKLAGALKAKPSQAAAVFQALPSKLVRTVEALREKVEQG 172


>gi|15673251|ref|NP_267425.1| 50S ribosomal protein L10 [Lactococcus lactis subsp. lactis Il1403]
 gi|281491789|ref|YP_003353769.1| 50S ribosomal protein L10P [Lactococcus lactis subsp. lactis KF147]
 gi|13959470|sp|Q9CG41|RL10_LACLA RecName: Full=50S ribosomal protein L10
 gi|12724244|gb|AAK05367.1|AE006359_5 50S ribosomal protein L10 [Lactococcus lactis subsp. lactis Il1403]
 gi|281375503|gb|ADA65013.1| LSU ribosomal protein L10P [Lactococcus lactis subsp. lactis KF147]
 gi|326406808|gb|ADZ63879.1| 50S ribosomal protein L10P [Lactococcus lactis subsp. lactis CV56]
          Length = 171

 Score = 85.9 bits (211), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 51/155 (32%), Positives = 85/155 (54%), Gaps = 12/155 (7%)

Query: 17  FSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRGISDLFVG 76
            + + SIVVA  +G+SV Q   LRK++REAG   KV KN +++ A     + G+S+ F G
Sbjct: 25  MTEAASIVVADSRGLSVDQDTQLRKQLREAGVEFKVVKNSVLRRAAEKAGLEGLSEAFSG 84

Query: 77  QSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASLPDLEGIRAG 135
            S + +S+  V+AP K+   F+ D     +  GV+E  V +++ I+ IASLP  +G+ + 
Sbjct: 85  PSAVAFSNEDVVAPAKVLADFAKDAENLEIKAGVIEGKVSSKEEIQAIASLPSRDGLLSM 144

Query: 136 IISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQ 170
           ++S +Q+           P   V  A+ A  +K +
Sbjct: 145 LLSVLQA-----------PVRNVALAVKAVAEKEE 168


>gi|115378465|ref|ZP_01465624.1| 50S ribosomal protein L10 [Stigmatella aurantiaca DW4/3-1]
 gi|115364527|gb|EAU63603.1| 50S ribosomal protein L10 [Stigmatella aurantiaca DW4/3-1]
          Length = 165

 Score = 85.9 bits (211), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 55/164 (33%), Positives = 86/164 (52%), Gaps = 4/164 (2%)

Query: 10  ISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRG 69
           I ELS  F  + + +VA +  + V  +  LR+K REA    KV KN L K A + TS+  
Sbjct: 2   IKELSDKFQRTQTAIVAEFSKLDVETVTKLRRKFREAKVDYKVIKNTLAKRAAKGTSVEV 61

Query: 70  ISDLFVGQSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASLPD 128
           I+D F G   +  S   VIAP KI   F  D    ++   VV+   +N + +K +A +P 
Sbjct: 62  IADDFKGPVALAISYDDVIAPAKILTEFIKDLETIKIRSAVVQGKRINVEGVKALAKMPG 121

Query: 129 LEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQQG 172
           L  +R  ++  +   A++LVR L  P +Q+ R + A   +++QG
Sbjct: 122 LTELRGQLLGMLNQPASKLVRTLSAPGSQLARVLQA---RSEQG 162


>gi|303239013|ref|ZP_07325543.1| ribosomal protein L10 [Acetivibrio cellulolyticus CD2]
 gi|302593351|gb|EFL63069.1| ribosomal protein L10 [Acetivibrio cellulolyticus CD2]
          Length = 177

 Score = 85.9 bits (211), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 53/160 (33%), Positives = 90/160 (56%), Gaps = 1/160 (0%)

Query: 10  ISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRG 69
           +SELS    ++ +IV A Y+G++V Q  +LR  +R+AG    V KN L K+A  +  +  
Sbjct: 14  VSELSDKIKNAKTIVFADYRGLTVEQDTELRNALRKAGVEYAVVKNTLTKLAANENGLNE 73

Query: 70  ISDLFVGQSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASLPD 128
           +   F G + +  SD+ VIAP KI   +S    + ++  GVVE  V +++SIK +A+LP 
Sbjct: 74  LEPYFNGPTAMAVSDNDVIAPAKILAEYSKKYEKLQIKAGVVEGKVFDENSIKALAALPP 133

Query: 129 LEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDK 168
            E + A  + ++++  T  V +L      +V A++A  +K
Sbjct: 134 KEELVAKALGSMKAPITGFVNVLNGNIRGLVVALNAIAEK 173


>gi|297571945|ref|YP_003697719.1| ribosomal protein L10 [Arcanobacterium haemolyticum DSM 20595]
 gi|296932292|gb|ADH93100.1| ribosomal protein L10 [Arcanobacterium haemolyticum DSM 20595]
          Length = 174

 Score = 85.9 bits (211), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 53/173 (30%), Positives = 94/173 (54%), Gaps = 2/173 (1%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M R  KS  I+EL ++FS S +++V  Y+G++VAQ+K LR+ M +    V VAKN L +I
Sbjct: 1   MARTDKSAAIAELKELFSGSSAVLVTEYRGLTVAQMKTLRRAMGQEATYV-VAKNTLARI 59

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVI-APKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
           A ++  I G+ D   G + + +    +  A K   +F+ DN    +  GV+E  VL  + 
Sbjct: 60  AAKEAGIEGLDDALAGPTALAFVTGDIASAAKAVKNFAKDNPALIIKSGVLEGNVLAAED 119

Query: 120 IKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQQG 172
           ++++A L   E + A    A++++  +   +   P T++VR + A   K ++ 
Sbjct: 120 VQKLADLESREVLLAKAAGALKASLHKAAYVFTAPATKLVRTVDALRAKQEEA 172


>gi|15923529|ref|NP_371063.1| 50S ribosomal protein L10 [Staphylococcus aureus subsp. aureus
           Mu50]
 gi|15926217|ref|NP_373750.1| 50S ribosomal protein L10 [Staphylococcus aureus subsp. aureus
           N315]
 gi|21282223|ref|NP_645311.1| 50S ribosomal protein L10 [Staphylococcus aureus subsp. aureus MW2]
 gi|49482769|ref|YP_039993.1| 50S ribosomal protein L10 [Staphylococcus aureus subsp. aureus
           MRSA252]
 gi|57651415|ref|YP_185471.1| 50S ribosomal protein L10 [Staphylococcus aureus subsp. aureus COL]
 gi|82750247|ref|YP_415988.1| 50S ribosomal protein L10 [Staphylococcus aureus RF122]
 gi|87160740|ref|YP_493227.1| 50S ribosomal protein L10 [Staphylococcus aureus subsp. aureus
           USA300_FPR3757]
 gi|88194301|ref|YP_499093.1| 50S ribosomal protein L10 [Staphylococcus aureus subsp. aureus NCTC
           8325]
 gi|148266999|ref|YP_001245942.1| 50S ribosomal protein L10 [Staphylococcus aureus subsp. aureus JH9]
 gi|150393046|ref|YP_001315721.1| 50S ribosomal protein L10 [Staphylococcus aureus subsp. aureus JH1]
 gi|151220713|ref|YP_001331535.1| 50S ribosomal protein L10 [Staphylococcus aureus subsp. aureus str.
           Newman]
 gi|156978868|ref|YP_001441127.1| 50S ribosomal protein L10 [Staphylococcus aureus subsp. aureus Mu3]
 gi|161508779|ref|YP_001574438.1| 50S ribosomal protein L10 [Staphylococcus aureus subsp. aureus
           USA300_TCH1516]
 gi|221141024|ref|ZP_03565517.1| 50S ribosomal protein L10 [Staphylococcus aureus subsp. aureus str.
           JKD6009]
 gi|253315649|ref|ZP_04838862.1| 50S ribosomal protein L10 [Staphylococcus aureus subsp. aureus str.
           CF-Marseille]
 gi|253731144|ref|ZP_04865309.1| 50S ribosomal protein L10 [Staphylococcus aureus subsp. aureus
           USA300_TCH959]
 gi|253732547|ref|ZP_04866712.1| 50S ribosomal protein L10 [Staphylococcus aureus subsp. aureus
           TCH130]
 gi|255005333|ref|ZP_05143934.2| 50S ribosomal protein L10 [Staphylococcus aureus subsp. aureus
           Mu50-omega]
 gi|257424653|ref|ZP_05601080.1| ribosomal protein L10 [Staphylococcus aureus subsp. aureus 55/2053]
 gi|257427321|ref|ZP_05603720.1| ribosomal protein L10 [Staphylococcus aureus subsp. aureus 65-1322]
 gi|257429957|ref|ZP_05606341.1| ribosomal protein L10 [Staphylococcus aureus subsp. aureus 68-397]
 gi|257432659|ref|ZP_05609019.1| 50S ribosomal protein L10 [Staphylococcus aureus subsp. aureus
           E1410]
 gi|257435563|ref|ZP_05611611.1| ribosomal protein L10 [Staphylococcus aureus subsp. aureus M876]
 gi|257795362|ref|ZP_05644341.1| 50S ribosomal protein L10 [Staphylococcus aureus A9781]
 gi|258408951|ref|ZP_05681232.1| 50S ribosomal protein L10 [Staphylococcus aureus A9763]
 gi|258420411|ref|ZP_05683354.1| ribosomal protein L10 [Staphylococcus aureus A9719]
 gi|258422614|ref|ZP_05685520.1| ribosomal protein L10 [Staphylococcus aureus A9635]
 gi|258439332|ref|ZP_05690264.1| ribosomal protein L10 [Staphylococcus aureus A9299]
 gi|258444072|ref|ZP_05692409.1| ribosomal protein L10 [Staphylococcus aureus A8115]
 gi|258446340|ref|ZP_05694498.1| ribosomal protein L10 [Staphylococcus aureus A6300]
 gi|258448433|ref|ZP_05696548.1| ribosomal protein L10 [Staphylococcus aureus A6224]
 gi|258452728|ref|ZP_05700726.1| ribosomal protein L10 [Staphylococcus aureus A5948]
 gi|258453789|ref|ZP_05701763.1| 50S ribosomal protein L10 [Staphylococcus aureus A5937]
 gi|262049582|ref|ZP_06022451.1| 50S ribosomal protein L10 [Staphylococcus aureus D30]
 gi|262052427|ref|ZP_06024627.1| 50S ribosomal protein L10 [Staphylococcus aureus 930918-3]
 gi|269202162|ref|YP_003281431.1| 50S ribosomal protein L10 [Staphylococcus aureus subsp. aureus
           ED98]
 gi|282894974|ref|ZP_06303197.1| large subunit ribosomal protein L10 [Staphylococcus aureus A8117]
 gi|282903127|ref|ZP_06311018.1| ribosomal protein L10 [Staphylococcus aureus subsp. aureus C160]
 gi|282904917|ref|ZP_06312775.1| large subunit ribosomal protein L10 [Staphylococcus aureus subsp.
           aureus Btn1260]
 gi|282907867|ref|ZP_06315702.1| ribosomal protein L10 [Staphylococcus aureus subsp. aureus
           WW2703/97]
 gi|282910180|ref|ZP_06317984.1| ribosomal protein L10 [Staphylococcus aureus subsp. aureus
           WBG10049]
 gi|282913372|ref|ZP_06321161.1| ribosomal protein L10 [Staphylococcus aureus subsp. aureus M899]
 gi|282915862|ref|ZP_06323627.1| 50S ribosomal protein L10 [Staphylococcus aureus subsp. aureus
           D139]
 gi|282918327|ref|ZP_06326064.1| 50S ribosomal protein L10 [Staphylococcus aureus subsp. aureus
           C427]
 gi|282923289|ref|ZP_06330969.1| large subunit ribosomal protein L10 [Staphylococcus aureus subsp.
           aureus C101]
 gi|282924453|ref|ZP_06332125.1| 50S ribosomal protein L10 [Staphylococcus aureus A9765]
 gi|282928876|ref|ZP_06336467.1| large subunit ribosomal protein L10 [Staphylococcus aureus A10102]
 gi|283769695|ref|ZP_06342587.1| large subunit ribosomal protein L10 [Staphylococcus aureus subsp.
           aureus H19]
 gi|283957337|ref|ZP_06374790.1| ribosomal protein L10 [Staphylococcus aureus subsp. aureus
           A017934/97]
 gi|284023549|ref|ZP_06377947.1| 50S ribosomal protein L10 [Staphylococcus aureus subsp. aureus 132]
 gi|293500418|ref|ZP_06666269.1| 50S ribosomal protein L10 [Staphylococcus aureus subsp. aureus
           58-424]
 gi|293509363|ref|ZP_06668074.1| 50S ribosomal protein L10 [Staphylococcus aureus subsp. aureus
           M809]
 gi|293523950|ref|ZP_06670637.1| ribosomal protein L10 [Staphylococcus aureus subsp. aureus M1015]
 gi|294850315|ref|ZP_06791049.1| large subunit ribosomal protein L10 [Staphylococcus aureus A9754]
 gi|295406916|ref|ZP_06816719.1| large subunit ribosomal protein L10 [Staphylococcus aureus A8819]
 gi|295427077|ref|ZP_06819713.1| large subunit ribosomal protein L10 [Staphylococcus aureus subsp.
           aureus EMRSA16]
 gi|296275785|ref|ZP_06858292.1| 50S ribosomal protein L10 [Staphylococcus aureus subsp. aureus MR1]
 gi|297246260|ref|ZP_06930109.1| 50S ribosomal protein L10 [Staphylococcus aureus A8796]
 gi|297590570|ref|ZP_06949209.1| 50S ribosomal protein L10 [Staphylococcus aureus subsp. aureus MN8]
 gi|300912837|ref|ZP_07130279.1| 50S ribosomal protein L10 [Staphylococcus aureus subsp. aureus
           TCH70]
 gi|304381862|ref|ZP_07364509.1| 50S ribosomal protein L10 [Staphylococcus aureus subsp. aureus ATCC
           BAA-39]
 gi|54039083|sp|P66049|RL10_STAAW RecName: Full=50S ribosomal protein L10
 gi|54039093|sp|P99155|RL10_STAAN RecName: Full=50S ribosomal protein L10
 gi|54041813|sp|P66048|RL10_STAAM RecName: Full=50S ribosomal protein L10
 gi|56749586|sp|Q6GJC9|RL10_STAAR RecName: Full=50S ribosomal protein L10
 gi|81695154|sp|Q5HID6|RL10_STAAC RecName: Full=50S ribosomal protein L10
 gi|97181995|sp|Q2FJA1|RL10_STAA3 RecName: Full=50S ribosomal protein L10
 gi|97181999|sp|Q2YSC2|RL10_STAAB RecName: Full=50S ribosomal protein L10
 gi|122540133|sp|Q2G0N9|RL10_STAA8 RecName: Full=50S ribosomal protein L10
 gi|166230076|sp|A7WYW2|RL10_STAA1 RecName: Full=50S ribosomal protein L10
 gi|172048776|sp|A6QEJ1|RL10_STAAE RecName: Full=50S ribosomal protein L10
 gi|189040938|sp|A6TZ16|RL10_STAA2 RecName: Full=50S ribosomal protein L10
 gi|189040939|sp|A5IQ93|RL10_STAA9 RecName: Full=50S ribosomal protein L10
 gi|189040940|sp|A8YZN7|RL10_STAAT RecName: Full=50S ribosomal protein L10
 gi|13700430|dbj|BAB41728.1| 50S ribosomal protein L10 [Staphylococcus aureus subsp. aureus
           N315]
 gi|14246307|dbj|BAB56701.1| 50S ribosomal protein L10 [Staphylococcus aureus subsp. aureus
           Mu50]
 gi|21203659|dbj|BAB94359.1| 50S ribosomal protein L10 [Staphylococcus aureus subsp. aureus MW2]
 gi|49240898|emb|CAG39565.1| 50S ribosomal protein L10 [Staphylococcus aureus subsp. aureus
           MRSA252]
 gi|57285601|gb|AAW37695.1| ribosomal protein L10 [Staphylococcus aureus subsp. aureus COL]
 gi|82655778|emb|CAI80178.1| 50S ribosomal protein L10 [Staphylococcus aureus RF122]
 gi|87126714|gb|ABD21228.1| ribosomal protein L10 [Staphylococcus aureus subsp. aureus
           USA300_FPR3757]
 gi|87201859|gb|ABD29669.1| ribosomal protein L10 [Staphylococcus aureus subsp. aureus NCTC
           8325]
 gi|147740068|gb|ABQ48366.1| LSU ribosomal protein L10P [Staphylococcus aureus subsp. aureus
           JH9]
 gi|149945498|gb|ABR51434.1| ribosomal protein L10 [Staphylococcus aureus subsp. aureus JH1]
 gi|150373513|dbj|BAF66773.1| 50S ribosomal protein L10 [Staphylococcus aureus subsp. aureus str.
           Newman]
 gi|156721003|dbj|BAF77420.1| 50S ribosomal protein L10 [Staphylococcus aureus subsp. aureus Mu3]
 gi|160367588|gb|ABX28559.1| ribosomal protein L10 [Staphylococcus aureus subsp. aureus
           USA300_TCH1516]
 gi|253725109|gb|EES93838.1| 50S ribosomal protein L10 [Staphylococcus aureus subsp. aureus
           USA300_TCH959]
 gi|253729476|gb|EES98205.1| 50S ribosomal protein L10 [Staphylococcus aureus subsp. aureus
           TCH130]
 gi|257272223|gb|EEV04346.1| ribosomal protein L10 [Staphylococcus aureus subsp. aureus 55/2053]
 gi|257275514|gb|EEV06987.1| ribosomal protein L10 [Staphylococcus aureus subsp. aureus 65-1322]
 gi|257279154|gb|EEV09755.1| ribosomal protein L10 [Staphylococcus aureus subsp. aureus 68-397]
 gi|257282074|gb|EEV12209.1| 50S ribosomal protein L10 [Staphylococcus aureus subsp. aureus
           E1410]
 gi|257284754|gb|EEV14873.1| ribosomal protein L10 [Staphylococcus aureus subsp. aureus M876]
 gi|257789334|gb|EEV27674.1| 50S ribosomal protein L10 [Staphylococcus aureus A9781]
 gi|257840302|gb|EEV64765.1| 50S ribosomal protein L10 [Staphylococcus aureus A9763]
 gi|257843601|gb|EEV68007.1| ribosomal protein L10 [Staphylococcus aureus A9719]
 gi|257847186|gb|EEV71194.1| ribosomal protein L10 [Staphylococcus aureus A9635]
 gi|257847669|gb|EEV71668.1| ribosomal protein L10 [Staphylococcus aureus A9299]
 gi|257850742|gb|EEV74687.1| ribosomal protein L10 [Staphylococcus aureus A8115]
 gi|257854934|gb|EEV77879.1| ribosomal protein L10 [Staphylococcus aureus A6300]
 gi|257858302|gb|EEV81189.1| ribosomal protein L10 [Staphylococcus aureus A6224]
 gi|257859601|gb|EEV82451.1| ribosomal protein L10 [Staphylococcus aureus A5948]
 gi|257864045|gb|EEV86799.1| 50S ribosomal protein L10 [Staphylococcus aureus A5937]
 gi|259159673|gb|EEW44717.1| 50S ribosomal protein L10 [Staphylococcus aureus 930918-3]
 gi|259162322|gb|EEW46895.1| 50S ribosomal protein L10 [Staphylococcus aureus D30]
 gi|262074452|gb|ACY10425.1| 50S ribosomal protein L10 [Staphylococcus aureus subsp. aureus
           ED98]
 gi|269940112|emb|CBI48488.1| 50S ribosomal protein L10 [Staphylococcus aureus subsp. aureus
           TW20]
 gi|282314157|gb|EFB44547.1| large subunit ribosomal protein L10 [Staphylococcus aureus subsp.
           aureus C101]
 gi|282317461|gb|EFB47833.1| 50S ribosomal protein L10 [Staphylococcus aureus subsp. aureus
           C427]
 gi|282320158|gb|EFB50503.1| 50S ribosomal protein L10 [Staphylococcus aureus subsp. aureus
           D139]
 gi|282322404|gb|EFB52726.1| ribosomal protein L10 [Staphylococcus aureus subsp. aureus M899]
 gi|282325572|gb|EFB55880.1| ribosomal protein L10 [Staphylococcus aureus subsp. aureus
           WBG10049]
 gi|282328251|gb|EFB58529.1| ribosomal protein L10 [Staphylococcus aureus subsp. aureus
           WW2703/97]
 gi|282331742|gb|EFB61253.1| large subunit ribosomal protein L10 [Staphylococcus aureus subsp.
           aureus Btn1260]
 gi|282589484|gb|EFB94573.1| large subunit ribosomal protein L10 [Staphylococcus aureus A10102]
 gi|282592864|gb|EFB97868.1| 50S ribosomal protein L10 [Staphylococcus aureus A9765]
 gi|282596082|gb|EFC01043.1| ribosomal protein L10 [Staphylococcus aureus subsp. aureus C160]
 gi|282762656|gb|EFC02793.1| large subunit ribosomal protein L10 [Staphylococcus aureus A8117]
 gi|283459842|gb|EFC06932.1| large subunit ribosomal protein L10 [Staphylococcus aureus subsp.
           aureus H19]
 gi|283469831|emb|CAQ49042.1| 50S ribosomal protein L10 [Staphylococcus aureus subsp. aureus
           ST398]
 gi|283790788|gb|EFC29603.1| ribosomal protein L10 [Staphylococcus aureus subsp. aureus
           A017934/97]
 gi|285816240|gb|ADC36727.1| LSU ribosomal protein L10p (P0) [Staphylococcus aureus 04-02981]
 gi|290920913|gb|EFD97974.1| ribosomal protein L10 [Staphylococcus aureus subsp. aureus M1015]
 gi|291095423|gb|EFE25684.1| 50S ribosomal protein L10 [Staphylococcus aureus subsp. aureus
           58-424]
 gi|291467460|gb|EFF09975.1| 50S ribosomal protein L10 [Staphylococcus aureus subsp. aureus
           M809]
 gi|294822827|gb|EFG39262.1| large subunit ribosomal protein L10 [Staphylococcus aureus A9754]
 gi|294968147|gb|EFG44173.1| large subunit ribosomal protein L10 [Staphylococcus aureus A8819]
 gi|295128865|gb|EFG58495.1| large subunit ribosomal protein L10 [Staphylococcus aureus subsp.
           aureus EMRSA16]
 gi|297176858|gb|EFH36116.1| 50S ribosomal protein L10 [Staphylococcus aureus A8796]
 gi|297576869|gb|EFH95584.1| 50S ribosomal protein L10 [Staphylococcus aureus subsp. aureus MN8]
 gi|298693870|gb|ADI97092.1| ribosomal protein L10 [Staphylococcus aureus subsp. aureus ED133]
 gi|300885941|gb|EFK81144.1| 50S ribosomal protein L10 [Staphylococcus aureus subsp. aureus
           TCH70]
 gi|302332252|gb|ADL22445.1| 50S ribosomal protein L10 [Staphylococcus aureus subsp. aureus
           JKD6159]
 gi|302750430|gb|ADL64607.1| 50S ribosomal protein L10 [Staphylococcus aureus subsp. aureus str.
           JKD6008]
 gi|304339648|gb|EFM05595.1| 50S ribosomal protein L10 [Staphylococcus aureus subsp. aureus ATCC
           BAA-39]
 gi|312439041|gb|ADQ78112.1| 50S ribosomal protein L10 [Staphylococcus aureus subsp. aureus
           TCH60]
 gi|312829035|emb|CBX33877.1| ribosomal protein L10 family protein [Staphylococcus aureus subsp.
           aureus ECT-R 2]
 gi|315128832|gb|EFT84831.1| 50S ribosomal protein L10 [Staphylococcus aureus subsp. aureus
           CGS03]
 gi|315193903|gb|EFU24297.1| 50S ribosomal protein L10 [Staphylococcus aureus subsp. aureus
           CGS00]
 gi|315196649|gb|EFU26996.1| 50S ribosomal protein L10 [Staphylococcus aureus subsp. aureus
           CGS01]
 gi|320141596|gb|EFW33435.1| ribosomal protein L10 [Staphylococcus aureus subsp. aureus MRSA131]
 gi|320141775|gb|EFW33603.1| ribosomal protein L10 [Staphylococcus aureus subsp. aureus MRSA177]
 gi|323439809|gb|EGA97526.1| 50S ribosomal protein L10 [Staphylococcus aureus O11]
 gi|323443089|gb|EGB00709.1| 50S ribosomal protein L10 [Staphylococcus aureus O46]
 gi|329313259|gb|AEB87672.1| 50S ribosomal protein L10 [Staphylococcus aureus subsp. aureus
           T0131]
 gi|329727937|gb|EGG64386.1| ribosomal protein L10 [Staphylococcus aureus subsp. aureus 21172]
 gi|329731022|gb|EGG67395.1| ribosomal protein L10 [Staphylococcus aureus subsp. aureus 21189]
          Length = 166

 Score = 85.9 bits (211), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 43/134 (32%), Positives = 79/134 (58%), Gaps = 1/134 (0%)

Query: 10  ISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRG 69
           + E++++ S+S S V+  Y+G++VA++ DLR ++REAG   KV KN +V+ A     I G
Sbjct: 12  VDEIAEVLSNSVSTVIVDYRGLTVAEVTDLRSQLREAGVEYKVYKNTMVRRAAEKAGIEG 71

Query: 70  ISDLFVGQSLIVY-SDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASLPD 128
           + +   G + I   S+  V A K+   F+ D+    +  GV+E  V+  + +K + SLP 
Sbjct: 72  LDEFLTGPTAIATSSEDAVAAAKVISGFAKDHEALEIKSGVMEGNVITAEEVKTVGSLPS 131

Query: 129 LEGIRAGIISAIQS 142
            +G+ + ++S +Q+
Sbjct: 132 HDGLVSMLLSVLQA 145


>gi|331268403|ref|YP_004394895.1| 50S ribosomal protein L10 [Clostridium botulinum BKT015925]
 gi|329124953|gb|AEB74898.1| ribosomal protein L10 [Clostridium botulinum BKT015925]
          Length = 170

 Score = 85.9 bits (211), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 48/151 (31%), Positives = 88/151 (58%), Gaps = 1/151 (0%)

Query: 2   NRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIA 61
           NRQ K  ++ E+ +    + S+V+A Y+G++V +  +LRK++REAG   KV KN LV +A
Sbjct: 8   NRQIKEAKVQEIREKLEKAQSVVLASYQGLNVEEDTELRKQLREAGVEYKVYKNTLVTLA 67

Query: 62  IRDTSIRGISDLFVGQ-SLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
            ++  + GI +   G  SL +  D      +I   F+ D+ +  +  GVVE  V ++ +I
Sbjct: 68  AKELGMEGIVEYLEGPVSLAIGYDDATAPARILNDFAKDHKKLELKAGVVEGKVFDEAAI 127

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLL 151
           K++A++P  E + A ++ ++++  +  V LL
Sbjct: 128 KELATIPPKEVLIAKLLGSLKAPMSNFVYLL 158


>gi|239943564|ref|ZP_04695501.1| 50S ribosomal protein L10 [Streptomyces roseosporus NRRL 15998]
 gi|239990017|ref|ZP_04710681.1| 50S ribosomal protein L10 [Streptomyces roseosporus NRRL 11379]
 gi|291447031|ref|ZP_06586421.1| ribosomal protein L10 [Streptomyces roseosporus NRRL 15998]
 gi|291349978|gb|EFE76882.1| ribosomal protein L10 [Streptomyces roseosporus NRRL 15998]
          Length = 185

 Score = 85.9 bits (211), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 54/174 (31%), Positives = 91/174 (52%), Gaps = 3/174 (1%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M R  K+  ++EL+  F SS + V+  Y+G++VAQ+K+LR+ + E      V KN L KI
Sbjct: 1   MARPDKAAAVAELTDQFRSSNAAVLTEYRGLTVAQLKELRRSLGE-NAQYAVVKNTLTKI 59

Query: 61  AIRDTSIRGISDLFVGQSLIVY-SDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
           A  +  I  + DLF G + + + +  PV + K    F+ DN    + GGV++   L+ D 
Sbjct: 60  AANEAGIDALDDLFSGPTAVAFVTGDPVESAKGLRDFAKDNPNLIIKGGVLDGKALSADE 119

Query: 120 IKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAF-VDKNQQG 172
           IK++A L   E + + +  A +   T+  ++     ++ VR   A    K +QG
Sbjct: 120 IKKLADLESREVLLSKLAGAFKGKQTQAAQVFQALPSKFVRTAEALRAKKEEQG 173


>gi|253682508|ref|ZP_04863305.1| 50S ribosomal protein L10 [Clostridium botulinum D str. 1873]
 gi|253562220|gb|EES91672.1| 50S ribosomal protein L10 [Clostridium botulinum D str. 1873]
          Length = 167

 Score = 85.9 bits (211), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 48/151 (31%), Positives = 88/151 (58%), Gaps = 1/151 (0%)

Query: 2   NRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIA 61
           NRQ K  ++ E+ +    + S+V+A Y+G++V +  +LRK++REAG   KV KN LV +A
Sbjct: 5   NRQIKEAKVQEIREKLEKAQSVVLASYQGLNVEEDTELRKQLREAGVEYKVYKNTLVTLA 64

Query: 62  IRDTSIRGISDLFVGQ-SLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
            ++  + GI +   G  SL +  D      +I   F+ D+ +  +  GVVE  V ++ +I
Sbjct: 65  AKELGMEGIVEYLEGPVSLAIGYDDATAPARILNDFAKDHKKLELKAGVVEGKVFDEAAI 124

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLL 151
           K++A++P  E + A ++ ++++  +  V LL
Sbjct: 125 KELATIPPKEVLIAKLLGSLKAPMSNFVYLL 155


>gi|49485404|ref|YP_042625.1| 50S ribosomal protein L10 [Staphylococcus aureus subsp. aureus
           MSSA476]
 gi|297208747|ref|ZP_06925175.1| 50S ribosomal protein L10 [Staphylococcus aureus subsp. aureus ATCC
           51811]
 gi|56749539|sp|Q6GBU8|RL10_STAAS RecName: Full=50S ribosomal protein L10
 gi|49243847|emb|CAG42272.1| 50S ribosomal protein L10 [Staphylococcus aureus subsp. aureus
           MSSA476]
 gi|296886692|gb|EFH25597.1| 50S ribosomal protein L10 [Staphylococcus aureus subsp. aureus ATCC
           51811]
 gi|329731945|gb|EGG68301.1| ribosomal protein L10 [Staphylococcus aureus subsp. aureus 21193]
          Length = 166

 Score = 85.9 bits (211), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 43/134 (32%), Positives = 79/134 (58%), Gaps = 1/134 (0%)

Query: 10  ISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRG 69
           + E++++ S+S S V+  Y+G++VA++ DLR ++REAG   KV KN +V+ A     I G
Sbjct: 12  VDEIAEVLSNSVSTVIVDYRGLTVAEVTDLRSQLREAGVEYKVYKNTMVRRAAEKAGIEG 71

Query: 70  ISDLFVGQSLIVY-SDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASLPD 128
           + +   G + I   S+  V A K+   F+ D+    +  GV+E  V+  + +K + SLP 
Sbjct: 72  LDEFLTGPTAIATSSEDAVAAAKVISGFAKDHEALEIKSGVMEGNVITAEEVKTVGSLPS 131

Query: 129 LEGIRAGIISAIQS 142
            +G+ + ++S +Q+
Sbjct: 132 HDGLVSMLLSVLQA 145


>gi|256003134|ref|ZP_05428126.1| ribosomal protein L10 [Clostridium thermocellum DSM 2360]
 gi|255992825|gb|EEU02915.1| ribosomal protein L10 [Clostridium thermocellum DSM 2360]
          Length = 178

 Score = 85.9 bits (211), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 53/163 (32%), Positives = 91/163 (55%), Gaps = 1/163 (0%)

Query: 10  ISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRG 69
           + +LS+   S+ +IV A Y+G++V Q  +LR K+R+AG   KV KN L K+A ++  +  
Sbjct: 14  VRQLSENMKSAKTIVFADYRGLTVEQDTELRNKLRKAGVEYKVVKNTLTKLAAKENGLEE 73

Query: 70  ISDLFVGQSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASLPD 128
           +   F G + + +SD  V+AP KI V ++       +  GVVE  V +  ++K IA+LP 
Sbjct: 74  LEPYFNGPTSMAFSDKDVVAPAKIMVEYAEKYENLELKVGVVEGKVCDLKTLKAIAALPP 133

Query: 129 LEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQQ 171
            E + A  +  ++S    LV +L      +V A++A  +K ++
Sbjct: 134 KEELVAKALGILKSPIAGLVNVLNGNIRGLVIALNAIAEKKKE 176


>gi|295397931|ref|ZP_06807988.1| 50S ribosomal protein L10 [Aerococcus viridans ATCC 11563]
 gi|294973816|gb|EFG49586.1| 50S ribosomal protein L10 [Aerococcus viridans ATCC 11563]
          Length = 167

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 45/138 (32%), Positives = 85/138 (61%), Gaps = 1/138 (0%)

Query: 6   KSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDT 65
           K  E++E+ +  +++ S+VV  Y G+SVA++ +LRK++REAG   KV KN +++ A+   
Sbjct: 9   KQQEVNEVVEKMNAANSLVVVDYLGLSVAEVTELRKQLREAGVEFKVIKNTIMRRALDSQ 68

Query: 66  SIRGISDLFVGQSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIA 124
            +    ++F G + + +     +AP KI   F+       + GG++E  VL+++ I+QIA
Sbjct: 69  ELEYHEEVFQGPTAVAFGMEDAVAPAKILSDFAKKAEALELKGGILEGKVLSKEEIQQIA 128

Query: 125 SLPDLEGIRAGIISAIQS 142
            LP+ EG+ + ++S +Q+
Sbjct: 129 KLPNREGLLSMLLSVLQA 146


>gi|282860796|ref|ZP_06269862.1| ribosomal protein L10 [Streptomyces sp. ACTE]
 gi|282564532|gb|EFB70068.1| ribosomal protein L10 [Streptomyces sp. ACTE]
          Length = 185

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 54/174 (31%), Positives = 91/174 (52%), Gaps = 3/174 (1%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M R  K+  ++EL+  F SS + V+  Y+G++VAQ+K+LR+ + E      V KN L KI
Sbjct: 1   MARPDKAAAVAELTDQFRSSNAAVLTEYRGLTVAQLKELRRSLGE-NAQYAVVKNTLTKI 59

Query: 61  AIRDTSIRGISDLFVGQSLIVY-SDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
           A  +  I  + DLF G + + + +  PV + K    F+ DN    + GGV++   L+ D 
Sbjct: 60  AANEAGINALDDLFSGPTAVAFVTGDPVESAKGLRDFAKDNPNLIIKGGVLDGKALSADE 119

Query: 120 IKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAF-VDKNQQG 172
           IK++A L   E + + +  A++   ++   L     ++ VR   A    K +QG
Sbjct: 120 IKKLADLESREVLLSKLAGAMKGKQSQAAALFQALPSKFVRTAEALRAKKEEQG 173


>gi|260584404|ref|ZP_05852151.1| 50S ribosomal protein L10 [Granulicatella elegans ATCC 700633]
 gi|260157922|gb|EEW92991.1| 50S ribosomal protein L10 [Granulicatella elegans ATCC 700633]
          Length = 167

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 45/138 (32%), Positives = 84/138 (60%), Gaps = 1/138 (0%)

Query: 6   KSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDT 65
           K+ ++SE+++ F ++ S+VV  Y GI+V Q  +LR ++R AG    V KN ++  A ++ 
Sbjct: 9   KAQQVSEVAEQFKNATSVVVVDYLGITVEQATNLRTELRNAGVQFAVVKNSILSRAAKEA 68

Query: 66  SIRGISDLFVGQSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIA 124
            + G+ D+F G S + +S+  V+AP KI   F+       +  GV+E  V +++ I+ +A
Sbjct: 69  GLEGMDDIFKGPSAVAFSNDDVVAPAKILADFAKKVEALEIKAGVIEGKVSSKEEIEALA 128

Query: 125 SLPDLEGIRAGIISAIQS 142
            LP+ EG+ + ++S +Q+
Sbjct: 129 KLPNREGLLSMLLSVLQA 146


>gi|29831455|ref|NP_826089.1| 50S ribosomal protein L10 [Streptomyces avermitilis MA-4680]
 gi|61215269|sp|Q82DQ7|RL10_STRAW RecName: Full=50S ribosomal protein L10
 gi|29608570|dbj|BAC72624.1| putative ribosomal protein L10 [Streptomyces avermitilis MA-4680]
          Length = 176

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 55/174 (31%), Positives = 90/174 (51%), Gaps = 3/174 (1%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M R  K+  ++EL+  F SS + V+  Y+G++VAQ+K LR+ + E      V KN L KI
Sbjct: 1   MARPDKAAAVAELADQFRSSNAAVLTEYRGLTVAQLKTLRRSLGE-DAQYAVVKNTLTKI 59

Query: 61  AIRDTSIRGISDLFVGQSLIVY-SDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
           A  +  I  + DLF G + + + +  PV++ K    F+ DN    + GGV++   L+ D 
Sbjct: 60  AANEAGINTLDDLFNGPTAVAFITGDPVVSAKGLRDFAKDNPNLVIKGGVLDGKALSADE 119

Query: 120 IKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAF-VDKNQQG 172
           IK++A L   E + A +  A +   ++   L     ++ VR   A    K +QG
Sbjct: 120 IKKLADLESREVLLAKLAGAFKGKQSQAASLFQALPSKFVRTAEALRAKKAEQG 173


>gi|116493229|ref|YP_804964.1| 50S ribosomal protein L10P [Pediococcus pentosaceus ATCC 25745]
 gi|122265307|sp|Q03E50|RL10_PEDPA RecName: Full=50S ribosomal protein L10
 gi|116103379|gb|ABJ68522.1| LSU ribosomal protein L10P [Pediococcus pentosaceus ATCC 25745]
          Length = 168

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 50/167 (29%), Positives = 90/167 (53%), Gaps = 12/167 (7%)

Query: 6   KSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDT 65
           K+  + E+++    S S +V   +G++VA++ DLRK++R+AG  ++V KN+++  A    
Sbjct: 9   KAAIVDEVAEQLKESVSAIVVDSRGLTVAEVTDLRKQLRDAGIKLRVIKNKVLTRAAEKA 68

Query: 66  SIRGISDLFVGQSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIA 124
              G+ D+FVG S + +S+   +AP KI  +F++ N+   + GG++E  V + D+I   A
Sbjct: 69  GFEGMDDVFVGPSAVAFSEEDAVAPAKILKTFADSNDNLSIKGGIIEGEVADIDTINTFA 128

Query: 125 SLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQQ 171
           +LP  E + A + +   S           P   V  A+ A  DK  +
Sbjct: 129 TLPSREDLLAMLANEFMS-----------PVRDVAYALKAVADKKSE 164


>gi|311070751|ref|YP_003975674.1| 50S ribosomal protein L10 [Bacillus atrophaeus 1942]
 gi|310871268|gb|ADP34743.1| 50S ribosomal protein L10 [Bacillus atrophaeus 1942]
          Length = 166

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 43/140 (30%), Positives = 80/140 (57%), Gaps = 1/140 (0%)

Query: 4   QGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIR 63
           + K V + E++     S S ++  Y+G+SVA++ +LRK++REA    KV KN + + A+ 
Sbjct: 6   ETKKVVVEEIASKLKESKSTIIVDYRGLSVAEVTELRKQLREANVEFKVYKNSMTRRAVE 65

Query: 64  DTSIRGISDLFVGQSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQ 122
              + G++D+  G + I +S   VIAP K+   F+  +    +  GV+E  V   + +K 
Sbjct: 66  QVELTGLNDVLTGPNAIAFSTEDVIAPAKVINEFAKTHEALEIKAGVIEGNVSTVEEVKA 125

Query: 123 IASLPDLEGIRAGIISAIQS 142
           +A LP  +G+ + ++S +Q+
Sbjct: 126 LAELPSRDGLLSMLLSVLQA 145


>gi|52783960|ref|YP_089789.1| 50S ribosomal protein L10 [Bacillus licheniformis ATCC 14580]
 gi|161760692|ref|YP_077389.2| 50S ribosomal protein L10 [Bacillus licheniformis ATCC 14580]
 gi|319649127|ref|ZP_08003335.1| 50S ribosomal protein L10 [Bacillus sp. BT1B_CT2]
 gi|81609335|sp|Q65PB8|RL10_BACLD RecName: Full=50S ribosomal protein L10
 gi|52346462|gb|AAU39096.1| RplJ [Bacillus licheniformis ATCC 14580]
 gi|145902691|gb|AAU21751.2| ribosomal protein L10 (BL5) [Bacillus licheniformis ATCC 14580]
 gi|317388827|gb|EFV69646.1| 50S ribosomal protein L10 [Bacillus sp. BT1B_CT2]
          Length = 166

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 42/140 (30%), Positives = 79/140 (56%), Gaps = 1/140 (0%)

Query: 4   QGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIR 63
           + K V + E++     S S ++  Y+G++VA++ +LRK++REA    KV KN + + A+ 
Sbjct: 6   ETKKVVVEEITSKLKESKSTIIVDYRGLNVAEVTELRKQLREANVEFKVYKNTMTRRAVE 65

Query: 64  DTSIRGISDLFVGQSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQ 122
              + G++D   G + I +S   V+AP K+   F+  +    +  GV+E  V   + +K 
Sbjct: 66  QAELDGLNDFLTGPNAIAFSTEDVVAPAKVLNEFAKKHEALEIKAGVIEGKVSTVEEVKA 125

Query: 123 IASLPDLEGIRAGIISAIQS 142
           +A LP  EG+ + ++S +Q+
Sbjct: 126 LAELPSREGLLSMLLSVLQA 145


>gi|163791694|ref|ZP_02186088.1| 50S ribosomal protein L10 [Carnobacterium sp. AT7]
 gi|159873042|gb|EDP67152.1| 50S ribosomal protein L10 [Carnobacterium sp. AT7]
          Length = 166

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 43/127 (33%), Positives = 78/127 (61%), Gaps = 1/127 (0%)

Query: 17  FSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRGISDLFVG 76
           F  + S+VV  Y+G++V ++ +LRK++R+AG  +KV KN ++  A     + G+ D+F G
Sbjct: 20  FKEAASVVVMDYRGLTVEEVTNLRKQLRDAGIQMKVIKNSVLSRAAEAAGLEGMDDVFKG 79

Query: 77  QSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASLPDLEGIRAG 135
            + I +S+  V+AP KI   F+ +     + GGV+E  V +   I  +A+LPD +G+ + 
Sbjct: 80  PTAIAFSNDDVVAPAKIIAEFAKEAAALEIKGGVIEGRVSSATEINALATLPDRDGLLSM 139

Query: 136 IISAIQS 142
           ++S +Q+
Sbjct: 140 LLSVLQA 146


>gi|302543376|ref|ZP_07295718.1| ribosomal protein L10 [Streptomyces hygroscopicus ATCC 53653]
 gi|302460994|gb|EFL24087.1| ribosomal protein L10 [Streptomyces himastatinicus ATCC 53653]
          Length = 186

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 49/163 (30%), Positives = 86/163 (52%), Gaps = 2/163 (1%)

Query: 10  ISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRG 69
           + E+ + F +S   VV  Y G++VAQ+++LR+ + E     +V KN L KIA  +  I  
Sbjct: 10  VDEMREKFRTSNGAVVTAYTGLTVAQLQELRRSLGE-NAQYRVVKNTLTKIAANEAGINQ 68

Query: 70  ISDLFVGQSLIVY-SDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASLPD 128
           + DLF G S + + +  PV+A K    F+ DN    + GGV++   L+ D IK++A L  
Sbjct: 69  LDDLFTGSSAVAFVTGDPVVAAKGLRDFAKDNPALEIKGGVLDGKALSADEIKKLADLES 128

Query: 129 LEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQQ 171
            E + + +  A+++  ++   L   P ++ +R   A   K  +
Sbjct: 129 REVLLSKLAGAMKAKQSQAAALFQAPLSKFIRTAEALRQKQSE 171


>gi|323141139|ref|ZP_08076042.1| ribosomal protein L10 [Phascolarctobacterium sp. YIT 12067]
 gi|322414405|gb|EFY05221.1| ribosomal protein L10 [Phascolarctobacterium sp. YIT 12067]
          Length = 175

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 53/163 (32%), Positives = 89/163 (54%), Gaps = 1/163 (0%)

Query: 3   RQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAI 62
           R  K  +++E+ ++ S+S   ++  + G++VAQ  +LR+KMREAG    V KN L++IA 
Sbjct: 5   RPEKVAKVAEIQELLSNSKCTILVDFCGLTVAQDTELRRKMREAGVHYNVVKNTLLRIAA 64

Query: 63  RDTSIRGIS-DLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSIK 121
               I G+   L    ++ V  + PV   KI   F+ +N E +V  GV++  V+  D IK
Sbjct: 65  EQAGIEGLEPSLEKNTAIAVSPEDPVAVAKIVCEFAKENKELKVKVGVLDGKVIGADEIK 124

Query: 122 QIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISA 164
            +ASLP  E + A ++ ++ +  +  V +L      VV A+ A
Sbjct: 125 ALASLPPKEVLIAKMLGSMNAPISGFVNVLQGTIRNVVYALEA 167


>gi|291280157|ref|YP_003496992.1| 50S ribosomal protein L10 [Deferribacter desulfuricans SSM1]
 gi|290754859|dbj|BAI81236.1| 50S ribosomal protein L10 [Deferribacter desulfuricans SSM1]
          Length = 173

 Score = 85.5 bits (210), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 43/173 (24%), Positives = 96/173 (55%), Gaps = 1/173 (0%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M +Q K   + +L++  S + ++ +A+YKG++  ++ ++R+ ++E G   +V KNRL+KI
Sbjct: 1   MKKQDKIALVGDLTEKISKANALYLANYKGLTYHELNNIRQALKEMGNDFRVVKNRLLKI 60

Query: 61  AIRDTSIRGISDLFVGQSLI-VYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
           A+++ +I  + ++ V Q+ I +  D P  A K    F+ +   F + GG ++   L+++ 
Sbjct: 61  ALKNNNIENLDEILVDQTAIAIVFDEPTTAAKEFKKFNKEYKNFEIKGGYLDGQALSKED 120

Query: 120 IKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQQG 172
           +  +A +P  E + A ++ ++ + A   V LL      ++  ++A  +K +  
Sbjct: 121 VIALADIPSREELLARMLGSMSAPARNFVSLLANIPRSLLNVLNAIKEKKENN 173


>gi|317126845|ref|YP_004093127.1| ribosomal protein L10 [Bacillus cellulosilyticus DSM 2522]
 gi|315471793|gb|ADU28396.1| ribosomal protein L10 [Bacillus cellulosilyticus DSM 2522]
          Length = 166

 Score = 85.5 bits (210), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 43/134 (32%), Positives = 81/134 (60%), Gaps = 1/134 (0%)

Query: 10  ISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRG 69
           + E+++   +S S +V  Y+G++V+++ +LRK++REAG   KV KN L + A     +  
Sbjct: 12  VDEIAEKLQASQSTIVVDYRGLNVSEVTELRKQLREAGVDFKVYKNTLARRATEKAGLTE 71

Query: 70  ISDLFVGQSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASLPD 128
           + +  VG + I +S+  VIAP K+   F+  ++   +  GV+E  V++ D ++ IA LP 
Sbjct: 72  LDENLVGPTAIAFSNDDVIAPAKVLAGFAKKHDALEIKAGVIEGKVVSLDEVRAIAELPS 131

Query: 129 LEGIRAGIISAIQS 142
            EG+ + ++S +Q+
Sbjct: 132 REGLLSMLLSVMQA 145


>gi|161621791|ref|YP_056567.2| 50S ribosomal protein L10 [Propionibacterium acnes KPA171202]
 gi|61214911|sp|Q6A6K4|RL10_PROAC RecName: Full=50S ribosomal protein L10
 gi|315106010|gb|EFT77986.1| ribosomal protein L10 [Propionibacterium acnes HL030PA1]
          Length = 204

 Score = 85.5 bits (210), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 51/169 (30%), Positives = 93/169 (55%), Gaps = 2/169 (1%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M R  K   ++EL + FSS+G+ V+  Y+G+SV+ +KDLR+ +  +     VAKN L +I
Sbjct: 1   MARPDKVAAVAELKEKFSSAGATVLTEYRGLSVSALKDLRRSLG-SDATYAVAKNTLTRI 59

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIA-PKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
           A ++  I G+ D  VG + + + +  V +  K   +F+ DN    + GGV++  VL+ D 
Sbjct: 60  AAKEAGIEGLDDQLVGPTALAFINGDVASVAKGLKNFAKDNPLLVIKGGVMDGNVLDADQ 119

Query: 120 IKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDK 168
           +K++A L   E + A +   +++N T+   +     ++  R + A  +K
Sbjct: 120 VKKLADLESREVLLAKLAGGLKANLTKAAVVFNALPSKAARGLGALQEK 168


>gi|50840942|gb|AAT83609.1| 50S ribosomal protein L10 [Propionibacterium acnes KPA171202]
          Length = 243

 Score = 85.5 bits (210), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 51/169 (30%), Positives = 93/169 (55%), Gaps = 2/169 (1%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M R  K   ++EL + FSS+G+ V+  Y+G+SV+ +KDLR+ +  +     VAKN L +I
Sbjct: 40  MARPDKVAAVAELKEKFSSAGATVLTEYRGLSVSALKDLRRSLG-SDATYAVAKNTLTRI 98

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIA-PKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
           A ++  I G+ D  VG + + + +  V +  K   +F+ DN    + GGV++  VL+ D 
Sbjct: 99  AAKEAGIEGLDDQLVGPTALAFINGDVASVAKGLKNFAKDNPLLVIKGGVMDGNVLDADQ 158

Query: 120 IKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDK 168
           +K++A L   E + A +   +++N T+   +     ++  R + A  +K
Sbjct: 159 VKKLADLESREVLLAKLAGGLKANLTKAAVVFNALPSKAARGLGALQEK 207


>gi|327327974|gb|EGE69744.1| ribosomal protein L10 [Propionibacterium acnes HL096PA3]
          Length = 204

 Score = 85.5 bits (210), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 51/169 (30%), Positives = 93/169 (55%), Gaps = 2/169 (1%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M R  K   ++EL + FSS+G+ V+  Y+G+SV+ +KDLR+ +  +     VAKN L +I
Sbjct: 1   MARPDKVAAVAELKEKFSSAGATVLTEYRGLSVSALKDLRRSLG-SDATYAVAKNTLTRI 59

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIA-PKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
           A ++  I G+ D  VG + + + +  V +  K   +F+ DN    + GGV++  VL+ D 
Sbjct: 60  AAKEAGIEGLDDQLVGPTALAFINGDVASVAKGLKNFAKDNPLLVIKGGVMDGNVLDADQ 119

Query: 120 IKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDK 168
           +K++A L   E + A +   +++N T+   +     ++  R + A  +K
Sbjct: 120 VKKLADLESREVLLAKLAGGLKANLTKAAVVFNALPSKAARGLGALQEK 168


>gi|270284480|ref|ZP_05966194.2| ribosomal protein L10 [Bifidobacterium gallicum DSM 20093]
 gi|270276977|gb|EFA22831.1| ribosomal protein L10 [Bifidobacterium gallicum DSM 20093]
          Length = 199

 Score = 85.5 bits (210), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 59/177 (33%), Positives = 92/177 (51%), Gaps = 10/177 (5%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKM-REAGGGVKVAKNRLVK 59
           M R  K V ++EL+++F ++ +I +  Y+G++V QI DLR+K+ R+      VAKN L +
Sbjct: 27  MKRPEKEVVVAELTELFRNADAIYLTEYRGLTVPQISDLREKLGRDT--SYTVAKNTLFR 84

Query: 60  IAIRDTSIRGISDLFVGQSLIVYSDSPVI-APKISVSFSNDNNEFRVLGGVVEKGVLNQD 118
           IA ++  I G+ DL  G S +V+     I A K    F+  N    + GG  +  V + +
Sbjct: 85  IAAKEAGIEGLDDLLKGPSAVVFVKGDFIDAAKTLRDFAKTNKALIIKGGFADGTVYDAE 144

Query: 119 SIKQIASL---PDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQQG 172
             KQ+A L   P+L    AG I A  + A  L   L    T+ VR I A  +K ++ 
Sbjct: 145 GAKQLADLKSRPELLAEFAGDIKASMAKAAYLFNAL---PTKAVRTIDALREKQEKA 198


>gi|289424824|ref|ZP_06426606.1| ribosomal protein L10 [Propionibacterium acnes SK187]
 gi|289427732|ref|ZP_06429444.1| ribosomal protein L10 [Propionibacterium acnes J165]
 gi|295131411|ref|YP_003582074.1| ribosomal protein L10 [Propionibacterium acnes SK137]
 gi|289154787|gb|EFD03470.1| ribosomal protein L10 [Propionibacterium acnes SK187]
 gi|289159223|gb|EFD07415.1| ribosomal protein L10 [Propionibacterium acnes J165]
 gi|291376775|gb|ADE00630.1| ribosomal protein L10 [Propionibacterium acnes SK137]
 gi|313763074|gb|EFS34438.1| ribosomal protein L10 [Propionibacterium acnes HL013PA1]
 gi|313773032|gb|EFS38998.1| ribosomal protein L10 [Propionibacterium acnes HL074PA1]
 gi|313794081|gb|EFS42103.1| ribosomal protein L10 [Propionibacterium acnes HL110PA1]
 gi|313802427|gb|EFS43652.1| ribosomal protein L10 [Propionibacterium acnes HL110PA2]
 gi|313807840|gb|EFS46324.1| ribosomal protein L10 [Propionibacterium acnes HL087PA2]
 gi|313812048|gb|EFS49762.1| ribosomal protein L10 [Propionibacterium acnes HL083PA1]
 gi|313812126|gb|EFS49840.1| ribosomal protein L10 [Propionibacterium acnes HL025PA1]
 gi|313816872|gb|EFS54586.1| ribosomal protein L10 [Propionibacterium acnes HL059PA1]
 gi|313819208|gb|EFS56922.1| ribosomal protein L10 [Propionibacterium acnes HL046PA2]
 gi|313819753|gb|EFS57467.1| ribosomal protein L10 [Propionibacterium acnes HL036PA1]
 gi|313823870|gb|EFS61584.1| ribosomal protein L10 [Propionibacterium acnes HL036PA2]
 gi|313827231|gb|EFS64945.1| ribosomal protein L10 [Propionibacterium acnes HL063PA1]
 gi|313828439|gb|EFS66153.1| ribosomal protein L10 [Propionibacterium acnes HL063PA2]
 gi|313831103|gb|EFS68817.1| ribosomal protein L10 [Propionibacterium acnes HL007PA1]
 gi|313833493|gb|EFS71207.1| ribosomal protein L10 [Propionibacterium acnes HL056PA1]
 gi|313838127|gb|EFS75841.1| ribosomal protein L10 [Propionibacterium acnes HL086PA1]
 gi|314914567|gb|EFS78398.1| ribosomal protein L10 [Propionibacterium acnes HL005PA4]
 gi|314919189|gb|EFS83020.1| ribosomal protein L10 [Propionibacterium acnes HL050PA1]
 gi|314920623|gb|EFS84454.1| ribosomal protein L10 [Propionibacterium acnes HL050PA3]
 gi|314925714|gb|EFS89545.1| ribosomal protein L10 [Propionibacterium acnes HL036PA3]
 gi|314931467|gb|EFS95298.1| ribosomal protein L10 [Propionibacterium acnes HL067PA1]
 gi|314957027|gb|EFT01133.1| ribosomal protein L10 [Propionibacterium acnes HL027PA1]
 gi|314957841|gb|EFT01944.1| ribosomal protein L10 [Propionibacterium acnes HL002PA1]
 gi|314960682|gb|EFT04783.1| ribosomal protein L10 [Propionibacterium acnes HL002PA2]
 gi|314963362|gb|EFT07462.1| ribosomal protein L10 [Propionibacterium acnes HL082PA1]
 gi|314969743|gb|EFT13841.1| ribosomal protein L10 [Propionibacterium acnes HL037PA1]
 gi|314974286|gb|EFT18382.1| ribosomal protein L10 [Propionibacterium acnes HL053PA1]
 gi|314976944|gb|EFT21039.1| ribosomal protein L10 [Propionibacterium acnes HL045PA1]
 gi|314979902|gb|EFT23996.1| ribosomal protein L10 [Propionibacterium acnes HL072PA2]
 gi|314985800|gb|EFT29892.1| ribosomal protein L10 [Propionibacterium acnes HL005PA1]
 gi|314988417|gb|EFT32508.1| ribosomal protein L10 [Propionibacterium acnes HL005PA2]
 gi|314988841|gb|EFT32932.1| ribosomal protein L10 [Propionibacterium acnes HL005PA3]
 gi|315077096|gb|EFT49171.1| ribosomal protein L10 [Propionibacterium acnes HL053PA2]
 gi|315079788|gb|EFT51764.1| ribosomal protein L10 [Propionibacterium acnes HL078PA1]
 gi|315084904|gb|EFT56880.1| ribosomal protein L10 [Propionibacterium acnes HL027PA2]
 gi|315087228|gb|EFT59204.1| ribosomal protein L10 [Propionibacterium acnes HL002PA3]
 gi|315088961|gb|EFT60937.1| ribosomal protein L10 [Propionibacterium acnes HL072PA1]
 gi|315096808|gb|EFT68784.1| ribosomal protein L10 [Propionibacterium acnes HL038PA1]
 gi|315100106|gb|EFT72082.1| ribosomal protein L10 [Propionibacterium acnes HL059PA2]
 gi|315100569|gb|EFT72545.1| ribosomal protein L10 [Propionibacterium acnes HL046PA1]
 gi|315109365|gb|EFT81341.1| ribosomal protein L10 [Propionibacterium acnes HL030PA2]
 gi|327325650|gb|EGE67448.1| ribosomal protein L10 [Propionibacterium acnes HL096PA2]
 gi|327445320|gb|EGE91974.1| ribosomal protein L10 [Propionibacterium acnes HL043PA1]
 gi|327446961|gb|EGE93615.1| ribosomal protein L10 [Propionibacterium acnes HL043PA2]
 gi|327449043|gb|EGE95697.1| ribosomal protein L10 [Propionibacterium acnes HL013PA2]
 gi|327451389|gb|EGE98043.1| ribosomal protein L10 [Propionibacterium acnes HL092PA1]
 gi|327452612|gb|EGE99266.1| ribosomal protein L10 [Propionibacterium acnes HL087PA3]
 gi|327457654|gb|EGF04309.1| ribosomal protein L10 [Propionibacterium acnes HL083PA2]
 gi|328751905|gb|EGF65521.1| ribosomal protein L10 [Propionibacterium acnes HL087PA1]
 gi|328756949|gb|EGF70565.1| ribosomal protein L10 [Propionibacterium acnes HL020PA1]
 gi|328759038|gb|EGF72654.1| ribosomal protein L10 [Propionibacterium acnes HL025PA2]
 gi|328762261|gb|EGF75753.1| ribosomal protein L10 [Propionibacterium acnes HL099PA1]
          Length = 204

 Score = 85.1 bits (209), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 51/169 (30%), Positives = 93/169 (55%), Gaps = 2/169 (1%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M R  K   ++EL + FSS+G+ V+  Y+G+SV+ +KDLR+ +  +     VAKN L +I
Sbjct: 1   MARPDKVAAVAELKEKFSSAGATVLTEYRGLSVSALKDLRRSLG-SDATYAVAKNTLTRI 59

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIA-PKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
           A ++  I G+ D  VG + + + +  V +  K   +F+ DN    + GGV++  VL+ D 
Sbjct: 60  AAKEAGIEGLDDQLVGPTALAFINGDVASVAKGLKNFAKDNPLLVIKGGVMDGNVLDADQ 119

Query: 120 IKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDK 168
           +K++A L   E + A +   +++N T+   +     ++  R + A  +K
Sbjct: 120 VKKLADLESREVLLAKLAGGLKANLTKAAVVFNALPSKAARGLGALQEK 168


>gi|297192716|ref|ZP_06910114.1| 50S ribosomal protein L10 [Streptomyces pristinaespiralis ATCC
           25486]
 gi|197721628|gb|EDY65536.1| 50S ribosomal protein L10 [Streptomyces pristinaespiralis ATCC
           25486]
          Length = 176

 Score = 85.1 bits (209), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 54/174 (31%), Positives = 91/174 (52%), Gaps = 3/174 (1%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M R  K+  ++EL++ F SS + V+  Y+G++VAQ+K+LR+ + E      V KN L KI
Sbjct: 1   MARPDKAAAVAELTESFRSSNAAVLTEYRGLTVAQLKELRRSLGE-NAQYAVVKNTLTKI 59

Query: 61  AIRDTSIRGISDLFVGQSLIVY-SDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
           A  +  I  + D F G + + + +  PV + K    F+ DN    + GGV++   L+ D 
Sbjct: 60  AANEAGINSLDDHFTGPTAVAFITGDPVESAKGLRDFAKDNPNLIIKGGVLDGKALSADE 119

Query: 120 IKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAF-VDKNQQG 172
           IK++A L   E + A +  A++   ++   L     ++ VR   A    K +QG
Sbjct: 120 IKKLADLESREVLLAKLAGAMKGKQSQAAALFQALPSKFVRTAEALRAKKAEQG 173


>gi|152973946|ref|YP_001373463.1| 50S ribosomal protein L10 [Bacillus cereus subsp. cytotoxis NVH
           391-98]
 gi|189040904|sp|A7GK10|RL10_BACCN RecName: Full=50S ribosomal protein L10
 gi|152022698|gb|ABS20468.1| ribosomal protein L10 [Bacillus cytotoxicus NVH 391-98]
          Length = 166

 Score = 85.1 bits (209), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 42/134 (31%), Positives = 78/134 (58%), Gaps = 1/134 (0%)

Query: 10  ISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRG 69
           ++E++     S S +V  Y+G++V++  +LRK +REAG   KV KN L + A     +  
Sbjct: 12  VTEIADKLRESKSTIVVDYRGLTVSEATELRKNLREAGVEFKVYKNSLTRRAAESVEMAE 71

Query: 70  ISDLFVGQSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASLPD 128
           +++   G + I +S+  V+AP K+   F+ D+    +  GV+E  ++  D +K IA+LP 
Sbjct: 72  LNEFLTGPNAIAFSNEDVVAPAKVLNDFAKDHEALEIKAGVIEGKLVTLDEVKAIATLPS 131

Query: 129 LEGIRAGIISAIQS 142
            EG+ + ++S +Q+
Sbjct: 132 REGLLSMLLSVLQA 145


>gi|229015501|ref|ZP_04172499.1| 50S ribosomal protein L10 [Bacillus cereus AH1273]
 gi|229021710|ref|ZP_04178292.1| 50S ribosomal protein L10 [Bacillus cereus AH1272]
 gi|228739578|gb|EEL89992.1| 50S ribosomal protein L10 [Bacillus cereus AH1272]
 gi|228745788|gb|EEL95792.1| 50S ribosomal protein L10 [Bacillus cereus AH1273]
          Length = 166

 Score = 85.1 bits (209), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 41/134 (30%), Positives = 79/134 (58%), Gaps = 1/134 (0%)

Query: 10  ISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRG 69
           ++E+++    S S +V  Y+G++V+++ +LRK +REAG   KV KN L + A     +  
Sbjct: 12  VTEIAEKLRESKSTIVVDYRGLTVSEVTELRKNLREAGVEFKVYKNSLTRRAAESAEMAE 71

Query: 70  ISDLFVGQSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASLPD 128
           +++   G + I +S+  V+AP K+   F+  +    +  GV+E  ++  D +K IA+LP 
Sbjct: 72  LNEFLTGPNAIAFSNEDVVAPAKVLNDFATKHEALEIKAGVIEGKLVTLDEVKAIATLPS 131

Query: 129 LEGIRAGIISAIQS 142
            EG+ + ++S +Q+
Sbjct: 132 REGLLSMLLSVLQA 145


>gi|46906483|ref|YP_012872.1| 50S ribosomal protein L10 [Listeria monocytogenes str. 4b F2365]
 gi|47094527|ref|ZP_00232194.1| ribosomal protein L10 [Listeria monocytogenes str. 4b H7858]
 gi|47096504|ref|ZP_00234095.1| ribosomal protein L10 [Listeria monocytogenes str. 1/2a F6854]
 gi|116871633|ref|YP_848414.1| 50S ribosomal protein L10 [Listeria welshimeri serovar 6b str.
           SLCC5334]
 gi|217965663|ref|YP_002351341.1| 50S ribosomal protein L10 [Listeria monocytogenes HCC23]
 gi|226222878|ref|YP_002756985.1| ribosomal protein L10 [Listeria monocytogenes Clip81459]
 gi|254825706|ref|ZP_05230707.1| rplJ [Listeria monocytogenes FSL J1-194]
 gi|254853483|ref|ZP_05242831.1| rplJ [Listeria monocytogenes FSL R2-503]
 gi|254900569|ref|ZP_05260493.1| 50S ribosomal protein L10 [Listeria monocytogenes J0161]
 gi|254913480|ref|ZP_05263492.1| 50S ribosomal protein L10 [Listeria monocytogenes J2818]
 gi|254932469|ref|ZP_05265828.1| rplJ [Listeria monocytogenes HPB2262]
 gi|254937939|ref|ZP_05269636.1| rplJ [Listeria monocytogenes F6900]
 gi|254991750|ref|ZP_05273940.1| 50S ribosomal protein L10 [Listeria monocytogenes FSL J2-064]
 gi|255520306|ref|ZP_05387543.1| 50S ribosomal protein L10 [Listeria monocytogenes FSL J1-175]
 gi|290892609|ref|ZP_06555602.1| ribosomal protein L10 [Listeria monocytogenes FSL J2-071]
 gi|300764625|ref|ZP_07074617.1| ribosomal protein L10 [Listeria monocytogenes FSL N1-017]
 gi|61215092|sp|Q724G2|RL10_LISMF RecName: Full=50S ribosomal protein L10
 gi|123465955|sp|A0AF49|RL10_LISW6 RecName: Full=50S ribosomal protein L10
 gi|254798385|sp|B8DF05|RL10_LISMH RecName: Full=50S ribosomal protein L10
 gi|259645486|sp|C1KYI2|RL10_LISMC RecName: Full=50S ribosomal protein L10
 gi|46879747|gb|AAT03049.1| ribosomal protein L10 [Listeria monocytogenes serotype 4b str.
           F2365]
 gi|47015095|gb|EAL06037.1| ribosomal protein L10 [Listeria monocytogenes str. 1/2a F6854]
 gi|47017099|gb|EAL07965.1| ribosomal protein L10 [Listeria monocytogenes str. 4b H7858]
 gi|116740511|emb|CAK19631.1| ribosomal protein L10 [Listeria welshimeri serovar 6b str.
           SLCC5334]
 gi|217334933|gb|ACK40727.1| 50S ribosomal protein L10 [Listeria monocytogenes HCC23]
 gi|225875340|emb|CAS04037.1| ribosomal protein L10 [Listeria monocytogenes serotype 4b str. CLIP
           80459]
 gi|258606855|gb|EEW19463.1| rplJ [Listeria monocytogenes FSL R2-503]
 gi|258610548|gb|EEW23156.1| rplJ [Listeria monocytogenes F6900]
 gi|290557918|gb|EFD91439.1| ribosomal protein L10 [Listeria monocytogenes FSL J2-071]
 gi|293584025|gb|EFF96057.1| rplJ [Listeria monocytogenes HPB2262]
 gi|293591488|gb|EFF99822.1| 50S ribosomal protein L10 [Listeria monocytogenes J2818]
 gi|293594950|gb|EFG02711.1| rplJ [Listeria monocytogenes FSL J1-194]
 gi|300514732|gb|EFK41787.1| ribosomal protein L10 [Listeria monocytogenes FSL N1-017]
 gi|307569789|emb|CAR82968.1| rplJ [Listeria monocytogenes L99]
 gi|313611159|gb|EFR85985.1| 50S ribosomal protein L10 [Listeria monocytogenes FSL F2-208]
 gi|328467859|gb|EGF38899.1| 50S ribosomal protein L10 [Listeria monocytogenes 1816]
 gi|328476088|gb|EGF46797.1| 50S ribosomal protein L10 [Listeria monocytogenes 220]
          Length = 166

 Score = 85.1 bits (209), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 45/140 (32%), Positives = 79/140 (56%), Gaps = 1/140 (0%)

Query: 4   QGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIR 63
           + K   + E+    S+S S V+  Y+G++V +I +LRK++R+AG   KV KN L + A+ 
Sbjct: 6   EAKQSAVEEIKTKLSASASTVIVDYRGLNVGEITELRKQLRDAGIEFKVYKNSLTRRAVE 65

Query: 64  DTSIRGISDLFVGQSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQ 122
                G+     G + I +S+  V+AP KI   F+ D+    +  GV+E  V + + IK 
Sbjct: 66  ANGYEGLEGALTGPNAIAFSNEDVVAPAKILNDFAKDHEALEIKAGVIEGKVASLEEIKA 125

Query: 123 IASLPDLEGIRAGIISAIQS 142
           +A+LP  EG+ + + + +Q+
Sbjct: 126 LATLPSREGLLSMLCNVLQA 145


>gi|227494535|ref|ZP_03924851.1| 50S ribosomal protein L10 [Actinomyces coleocanis DSM 15436]
 gi|226832269|gb|EEH64652.1| 50S ribosomal protein L10 [Actinomyces coleocanis DSM 15436]
          Length = 210

 Score = 85.1 bits (209), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 52/174 (29%), Positives = 92/174 (52%), Gaps = 4/174 (2%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGG-VKVAKNRLVK 59
           M R  K   ++EL ++F SSG++V+  Y+G+SVAQI  LR+ +  AG     VAKN L K
Sbjct: 38  MARPDKEAAVAELVELFRSSGAVVLTEYRGLSVAQITQLRRAL--AGNAQYTVAKNTLAK 95

Query: 60  IAIRDTSIRGISDLFVGQSLIVYSDSPVI-APKISVSFSNDNNEFRVLGGVVEKGVLNQD 118
           IA ++  +  +++   G + I + +  V+ A K    F+ +N    +  G +E   L+ D
Sbjct: 96  IAAKEAGLDFLAENLNGPTAIAFVNGEVVDAAKALRDFAKENPALVLKAGAMEGAALSAD 155

Query: 119 SIKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQQG 172
            +K++A L   E + A     +++  ++   L   P ++ VR I A  +K ++ 
Sbjct: 156 DVKKLADLESREVLLAKTAGVLKAGLSKAAFLFAAPASKAVRTIDALREKQEKA 209


>gi|182436664|ref|YP_001824383.1| 50S ribosomal protein L10 [Streptomyces griseus subsp. griseus NBRC
           13350]
 gi|326777286|ref|ZP_08236551.1| 50S ribosomal protein L10 [Streptomyces cf. griseus XylebKG-1]
 gi|548738|sp|P36257|RL10_STRGR RecName: Full=50S ribosomal protein L10
 gi|226700007|sp|B1W444|RL10_STRGG RecName: Full=50S ribosomal protein L10
 gi|288464|emb|CAA51300.1| ribosomal protein L10 [Streptomyces griseus]
 gi|178465180|dbj|BAG19700.1| putative 50S ribosomal protein L10 [Streptomyces griseus subsp.
           griseus NBRC 13350]
 gi|326657619|gb|EGE42465.1| 50S ribosomal protein L10 [Streptomyces cf. griseus XylebKG-1]
          Length = 185

 Score = 85.1 bits (209), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 54/174 (31%), Positives = 91/174 (52%), Gaps = 3/174 (1%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M R  K+  ++EL+  F SS + V+  Y+G++VAQ+K+LR+ + E      V KN L KI
Sbjct: 1   MARPDKAAAVAELTDQFRSSNAAVLTEYRGLTVAQLKELRRSLGE-NAQYAVVKNTLTKI 59

Query: 61  AIRDTSIRGISDLFVGQSLIVY-SDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
           A  +  I  + DLF G + + + +  PV + K    F+ DN    + GGV++   L+ D 
Sbjct: 60  AANEAGIDTLDDLFSGPTAVAFVTGDPVESAKGLRDFAKDNPNLIIKGGVLDGKALSADE 119

Query: 120 IKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAF-VDKNQQG 172
           IK++A L   E + + +  A +   T+  ++     ++ VR   A    K +QG
Sbjct: 120 IKKLADLESREVLLSKLAGAFKGKQTQAAQVFQALPSKFVRTAEALRAKKEEQG 173


>gi|229159272|ref|ZP_04287296.1| 50S ribosomal protein L10 [Bacillus cereus R309803]
 gi|228624164|gb|EEK80966.1| 50S ribosomal protein L10 [Bacillus cereus R309803]
          Length = 166

 Score = 85.1 bits (209), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 41/134 (30%), Positives = 79/134 (58%), Gaps = 1/134 (0%)

Query: 10  ISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRG 69
           ++E+++    S S +V  Y+G++V+++ +LRK +REAG   KV KN L + A     +  
Sbjct: 12  VTEIAEKLRESKSTIVVDYRGLTVSEVTELRKNLREAGVEFKVYKNSLTRRAAESAEMAE 71

Query: 70  ISDLFVGQSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASLPD 128
           +++   G + I +S+  V+AP K+   F+  +    +  GV+E  ++  D +K IA+LP 
Sbjct: 72  LNEFLTGPNAIAFSNEDVVAPAKVLNDFATKHEALEIKAGVIEGKLVTLDEVKAIATLPS 131

Query: 129 LEGIRAGIISAIQS 142
            EG+ + ++S +Q+
Sbjct: 132 REGLLSMLLSVLQA 145


>gi|254391407|ref|ZP_05006610.1| 50S ribosomal protein L10 [Streptomyces clavuligerus ATCC 27064]
 gi|294814457|ref|ZP_06773100.1| 50S ribosomal protein L10 [Streptomyces clavuligerus ATCC 27064]
 gi|326442846|ref|ZP_08217580.1| 50S ribosomal protein L10 [Streptomyces clavuligerus ATCC 27064]
 gi|109942289|emb|CAJ84545.1| L10 ribosomal protein [Streptomyces clavuligerus ATCC 27064]
 gi|197705097|gb|EDY50909.1| 50S ribosomal protein L10 [Streptomyces clavuligerus ATCC 27064]
 gi|294327056|gb|EFG08699.1| 50S ribosomal protein L10 [Streptomyces clavuligerus ATCC 27064]
          Length = 176

 Score = 85.1 bits (209), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 53/174 (30%), Positives = 92/174 (52%), Gaps = 3/174 (1%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M R  K+  ++EL+  F SS + V+  Y+G++VAQ+K LR+ + E      V KN L KI
Sbjct: 1   MARPDKAAAVAELADQFRSSNAAVLTEYRGLTVAQLKTLRRSLGE-NAQYAVVKNTLTKI 59

Query: 61  AIRDTSIRGISDLFVGQSLIVY-SDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
           A  +  I  + D F G + + + +  PV + K    F+ DN    + GGV++   L+ D 
Sbjct: 60  AANEAGITSLDDQFTGPTAVAFITGDPVESAKGLRDFAKDNPNLIIKGGVLDGKALSPDE 119

Query: 120 IKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAF-VDKNQQG 172
           IK++A L   E + A +  A++   ++   L     +++VR + A    +++QG
Sbjct: 120 IKKLADLESREVLLAKLAGAMKGKQSQAASLFQALPSKLVRTVDALRAKRDEQG 173


>gi|221307916|ref|ZP_03589763.1| 50S ribosomal protein L10 [Bacillus subtilis subsp. subtilis str.
           168]
 gi|221312237|ref|ZP_03594042.1| 50S ribosomal protein L10 [Bacillus subtilis subsp. subtilis str.
           NCIB 3610]
 gi|221317171|ref|ZP_03598465.1| 50S ribosomal protein L10 [Bacillus subtilis subsp. subtilis str.
           JH642]
 gi|221321434|ref|ZP_03602728.1| 50S ribosomal protein L10 [Bacillus subtilis subsp. subtilis str.
           SMY]
 gi|255767021|ref|NP_387985.2| 50S ribosomal protein L10 [Bacillus subtilis subsp. subtilis str.
           168]
 gi|321313775|ref|YP_004206062.1| 50S ribosomal protein L10 [Bacillus subtilis BSn5]
 gi|239938931|sp|P42923|RL10_BACSU RecName: Full=50S ribosomal protein L10; AltName: Full=BL5;
           AltName: Full=Cold acclimatization protein; Short=CAP;
           AltName: Full=Vegetative protein 300; Short=VEG300
 gi|225184648|emb|CAB11880.2| ribosomal protein L10 (BL5) [Bacillus subtilis subsp. subtilis str.
           168]
 gi|320020049|gb|ADV95035.1| 50S ribosomal protein L10 [Bacillus subtilis BSn5]
          Length = 166

 Score = 85.1 bits (209), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 41/140 (29%), Positives = 80/140 (57%), Gaps = 1/140 (0%)

Query: 4   QGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIR 63
           + K V + E++     S S ++  Y+G++V+++ +LRK++REA    KV KN + + A+ 
Sbjct: 6   ETKKVVVEEIASKLKESKSTIIVDYRGLNVSEVTELRKQLREANVEFKVYKNTMTRRAVE 65

Query: 64  DTSIRGISDLFVGQSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQ 122
              + G++D   G + I +S   V+AP K+   F+ ++    +  GV+E  V   + +K 
Sbjct: 66  QAELNGLNDFLTGPNAIAFSTEDVVAPAKVLNDFAKNHEALEIKAGVIEGKVSTVEEVKA 125

Query: 123 IASLPDLEGIRAGIISAIQS 142
           +A LP  EG+ + ++S +Q+
Sbjct: 126 LAELPSREGLLSMLLSVLQA 145


>gi|291482476|dbj|BAI83551.1| 50S ribosomal protein L10 [Bacillus subtilis subsp. natto BEST195]
          Length = 166

 Score = 84.7 bits (208), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 41/140 (29%), Positives = 80/140 (57%), Gaps = 1/140 (0%)

Query: 4   QGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIR 63
           + K V + E++     S S ++  Y+G++V+++ +LRK++REA    KV KN + + A+ 
Sbjct: 6   ETKKVVVEEIASKLKESKSTIIVDYRGLNVSEVTELRKQLREANVEFKVYKNTMTRRAVE 65

Query: 64  DTSIRGISDLFVGQSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQ 122
              + G++D   G + I +S   V+AP K+   F+ ++    +  GV+E  V   + +K 
Sbjct: 66  QAELNGLNDFLTGPNAIAFSTEDVVAPAKVLNDFAKNHEALEIKAGVIEGKVSTVEEVKA 125

Query: 123 IASLPDLEGIRAGIISAIQS 142
           +A LP  EG+ + ++S +Q+
Sbjct: 126 LAELPSREGLLSMLLSVLQA 145


>gi|319654857|ref|ZP_08008932.1| 50S ribosomal protein L10 [Bacillus sp. 2_A_57_CT2]
 gi|317393420|gb|EFV74183.1| 50S ribosomal protein L10 [Bacillus sp. 2_A_57_CT2]
          Length = 166

 Score = 84.7 bits (208), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 45/134 (33%), Positives = 78/134 (58%), Gaps = 1/134 (0%)

Query: 10  ISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRG 69
           + E++    SS S VV  Y+G++VA++ +LRK++REAG   KV KN + + A     + G
Sbjct: 12  VEEIADKLKSSLSTVVVDYRGLTVAEVTELRKQLREAGVEFKVYKNSMTRRAAEAAELSG 71

Query: 70  ISDLFVGQSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASLPD 128
           +++   G + I +S   V+AP KI   F+  +    +  GV+E  V + + IK +A LP 
Sbjct: 72  LNEALTGPNAIAFSTEDVVAPAKILNDFAKKHEALEIKAGVIEGNVASVEDIKALAELPS 131

Query: 129 LEGIRAGIISAIQS 142
            EG+ + ++S +Q+
Sbjct: 132 REGLLSMLLSVLQA 145


>gi|118443640|ref|YP_877188.1| 50S ribosomal protein L10 [Clostridium novyi NT]
 gi|118134096|gb|ABK61140.1| 50S ribosomal protein L10 [Clostridium novyi NT]
          Length = 167

 Score = 84.7 bits (208), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 51/152 (33%), Positives = 90/152 (59%), Gaps = 3/152 (1%)

Query: 2   NRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIA 61
           NRQ K  ++ E+ +    + S+V+A Y+G++V +  +LRK++REAG   KV KN LV +A
Sbjct: 5   NRQLKEAKVQEIREKLEKAQSVVLASYQGLNVEEDTELRKQLREAGVEYKVYKNTLVTLA 64

Query: 62  IRDTSIRGISDLFVGQ-SLIV-YSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
            ++  + GI +   G  SL + Y D+   A +I   F+ D+ +  +  GVVE  V +Q  
Sbjct: 65  AKELGMDGIVEYLEGPVSLAIGYEDATAPA-RILNDFAKDHKKLELKAGVVEGKVFDQAE 123

Query: 120 IKQIASLPDLEGIRAGIISAIQSNATRLVRLL 151
           IK++A++P  E + A ++ ++++  +  V LL
Sbjct: 124 IKELATIPPKEVLIAKLLGSLKAPMSNFVYLL 155


>gi|302523954|ref|ZP_07276296.1| RplJ protein [Streptomyces sp. AA4]
 gi|302432849|gb|EFL04665.1| RplJ protein [Streptomyces sp. AA4]
          Length = 184

 Score = 84.7 bits (208), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 53/171 (30%), Positives = 88/171 (51%), Gaps = 2/171 (1%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M +  K   ++E+++ F SS + VV  Y G+SV Q+  LR+ +  +    +VAKN LVK 
Sbjct: 1   MAKPDKVAAVAEIAESFRSSSATVVTEYTGLSVTQLSQLRRALGTSAK-YRVAKNTLVKR 59

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVI-APKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
           A  D  + G+ DLFVG + I +     + A K    F+ +NN   + GG ++   L+ D 
Sbjct: 60  AAEDAGLEGVEDLFVGPTAIAFVHGEAVDAAKALRDFAKENNALVIKGGYMDGKSLSVDE 119

Query: 120 IKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQ 170
           I +IA L   E + +    A ++  ++   L   P +QV R  +A  +K +
Sbjct: 120 ITKIADLDSREVLLSKAAGAFKAKLSQAAALFQAPASQVARLAAALEEKQR 170


>gi|259047734|ref|ZP_05738135.1| 50S ribosomal protein L10 [Granulicatella adiacens ATCC 49175]
 gi|259035925|gb|EEW37180.1| 50S ribosomal protein L10 [Granulicatella adiacens ATCC 49175]
          Length = 167

 Score = 84.7 bits (208), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 45/138 (32%), Positives = 84/138 (60%), Gaps = 1/138 (0%)

Query: 6   KSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDT 65
           K+ +++E+++ F ++ S+VV  Y GI+V Q  +LR ++R+AG    V KN ++  A ++ 
Sbjct: 9   KAQQVAEVAEQFKNASSVVVVDYLGITVEQATNLRSELRKAGVQFAVVKNSILSRAAKEA 68

Query: 66  SIRGISDLFVGQSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIA 124
            + G+ D+F G S + +S+  V+AP KI   F+       +  GVVE  V +++ I+ +A
Sbjct: 69  GLEGMDDVFKGPSAVAFSNEDVVAPAKILADFAKKVEALEIKAGVVEGKVSSKEEIEALA 128

Query: 125 SLPDLEGIRAGIISAIQS 142
            LP  EG+ + ++S +Q+
Sbjct: 129 KLPSREGLLSMLLSVLQA 146


>gi|315639702|ref|ZP_07894841.1| 50S ribosomal protein L10 [Enterococcus italicus DSM 15952]
 gi|315484479|gb|EFU74936.1| 50S ribosomal protein L10 [Enterococcus italicus DSM 15952]
          Length = 167

 Score = 84.7 bits (208), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 47/161 (29%), Positives = 90/161 (55%), Gaps = 12/161 (7%)

Query: 10  ISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRG 69
           + E+++ F ++ S+VV  Y+G++V ++  LRK++R+A   +KV KN ++  A +   + G
Sbjct: 13  VEEVTEKFKTASSVVVVDYRGLTVDEVTRLRKQLRDANVEMKVIKNSILTRAAKAAGLEG 72

Query: 70  ISDLFVGQSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASLPD 128
           + ++F G + + +S+  V+AP KI   F+ D     + GG++E  V + + I  +A LP 
Sbjct: 73  LEEVFTGPTAVAFSNEDVVAPAKIIDEFAQDAKALEIKGGIIEGKVSSVEEITALAKLPS 132

Query: 129 LEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKN 169
            EG+ + ++S +Q+           P   V  AI+A  +K 
Sbjct: 133 REGLLSMLLSVLQA-----------PVRNVAYAINAVAEKE 162


>gi|227502620|ref|ZP_03932669.1| 50S ribosomal protein L10 [Corynebacterium accolens ATCC 49725]
 gi|306835187|ref|ZP_07468223.1| 50S ribosomal protein L10 [Corynebacterium accolens ATCC 49726]
 gi|227076660|gb|EEI14623.1| 50S ribosomal protein L10 [Corynebacterium accolens ATCC 49725]
 gi|304568942|gb|EFM44471.1| 50S ribosomal protein L10 [Corynebacterium accolens ATCC 49726]
          Length = 173

 Score = 84.7 bits (208), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 51/173 (29%), Positives = 90/173 (52%), Gaps = 6/173 (3%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVK--VAKNRLV 58
           M     + +++EL +  + S S+V+  Y+G++V+Q+++LR  +   G  V   VAKN L 
Sbjct: 1   MANPKNTADLAELKEKLADSSSVVLTEYRGLTVSQLQELRNNL---GFDVDYSVAKNTLF 57

Query: 59  KIAIRDTSIRGISDLFVGQSLIVY-SDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQ 117
           KIA  +  I G+ DL  G + I +     V A KI   F++DN    + GG ++   L+ 
Sbjct: 58  KIAANEAGIEGLDDLLTGPTAIAFIKGEAVDAAKIITKFADDNKALVIKGGYMDGDALSA 117

Query: 118 DSIKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQ 170
           + ++ IA L + E   A +  A++ +  +   +   P T+ VR + A  DK +
Sbjct: 118 EQVQAIAKLDNRETTLAKLAGAMKGSMAKAAAVFNAPATKAVRTVVALQDKKE 170


>gi|116512111|ref|YP_809327.1| 50S ribosomal protein L10 [Lactococcus lactis subsp. cremoris SK11]
 gi|125624035|ref|YP_001032518.1| 50S ribosomal protein L10 [Lactococcus lactis subsp. cremoris
           MG1363]
 gi|122940146|sp|Q02YR7|RL10_LACLS RecName: Full=50S ribosomal protein L10
 gi|166229737|sp|A2RKI8|RL10_LACLM RecName: Full=50S ribosomal protein L10
 gi|116107765|gb|ABJ72905.1| LSU ribosomal protein L10P [Lactococcus lactis subsp. cremoris
           SK11]
 gi|124492843|emb|CAL97799.1| 50S ribosomal protein L10 [Lactococcus lactis subsp. cremoris
           MG1363]
 gi|300070806|gb|ADJ60206.1| 50S ribosomal protein L10 [Lactococcus lactis subsp. cremoris
           NZ9000]
          Length = 171

 Score = 84.7 bits (208), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 45/127 (35%), Positives = 77/127 (60%), Gaps = 1/127 (0%)

Query: 17  FSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRGISDLFVG 76
            + + SIVVA  +G+SV +   LRK++REAG   KV KN +++ A     + G+S+ F G
Sbjct: 25  MTEAASIVVADSRGLSVDEDTQLRKQLREAGVEFKVVKNSILRRAAEKAGLEGLSEAFSG 84

Query: 77  QSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASLPDLEGIRAG 135
            S + +S+  V+AP K+   F+ D     +  GV+E  V +++ I+ IASLP  +G+ + 
Sbjct: 85  PSAVAFSNEDVVAPAKVLADFAKDAENLEIKAGVIEGKVSSKEEIQAIASLPSRDGLLSM 144

Query: 136 IISAIQS 142
           ++S +Q+
Sbjct: 145 LLSVLQA 151


>gi|30249988|ref|NP_842058.1| 50S ribosomal protein L10 [Nitrosomonas europaea ATCC 19718]
 gi|61215270|sp|Q82T73|RL10_NITEU RecName: Full=50S ribosomal protein L10
 gi|30139095|emb|CAD85959.1| Ribosomal protein L10 [Nitrosomonas europaea ATCC 19718]
          Length = 171

 Score = 84.7 bits (208), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 50/168 (29%), Positives = 86/168 (51%)

Query: 2   NRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIA 61
           N +GK   ++E+S   + + +IV+A Y+G+ V Q   LR K RE+G   +V KN   + A
Sbjct: 4   NLEGKKAIVAEVSSQVAKAQAIVIAEYRGLGVDQFTRLRVKARESGIYFRVIKNTFARRA 63

Query: 62  IRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSIK 121
           + DT   G+++  VG         PV   KI   F+ DN+ F +  G +   V++   + 
Sbjct: 64  VADTPFSGLAESMVGPLAYGIGSDPVATAKILHEFAKDNDRFVIKAGAMAGIVMSDKDVA 123

Query: 122 QIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKN 169
            +A LP  E + + ++  +Q+   + VR L    ++ VR ++A  DK 
Sbjct: 124 ALAVLPSREELLSKLLGTMQAPIAKFVRTLNEVPSKFVRGLAAVRDKK 171


>gi|116333239|ref|YP_794766.1| ribosomal protein L10 [Lactobacillus brevis ATCC 367]
 gi|122270073|sp|Q03ST7|RL10_LACBA RecName: Full=50S ribosomal protein L10
 gi|116098586|gb|ABJ63735.1| LSU ribosomal protein L10P [Lactobacillus brevis ATCC 367]
          Length = 168

 Score = 84.7 bits (208), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 50/168 (29%), Positives = 91/168 (54%), Gaps = 12/168 (7%)

Query: 6   KSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDT 65
           K+  + ++ + F+++ S +V  Y+G++V Q+ DLRK++REAG  + V KN+++  A    
Sbjct: 9   KAQHVEDVVEKFNNATSAIVVDYRGLTVEQVTDLRKQLREAGVQMNVIKNKILTRAAEKA 68

Query: 66  SIRGISDLFVGQSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIA 124
               ++D+F G + + +S+   IAP K+   F++  +   + GG +E  +++ D I   A
Sbjct: 69  GYGDLNDVFAGPTAVAFSNEDPIAPAKVLKKFADSVDALEIKGGYIEGNIVSIDEINVYA 128

Query: 125 SLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQQG 172
           +LP  E + A + S +Q+           P   V  AI A VDK  +G
Sbjct: 129 TLPSREELLATLASQLQA-----------PVRNVAYAIKAIVDKGDEG 165


>gi|163938107|ref|YP_001642991.1| 50S ribosomal protein L10 [Bacillus weihenstephanensis KBAB4]
 gi|229009608|ref|ZP_04166834.1| 50S ribosomal protein L10 [Bacillus mycoides DSM 2048]
 gi|229053945|ref|ZP_04195379.1| 50S ribosomal protein L10 [Bacillus cereus AH603]
 gi|229131106|ref|ZP_04260018.1| 50S ribosomal protein L10 [Bacillus cereus BDRD-ST196]
 gi|229165087|ref|ZP_04292882.1| 50S ribosomal protein L10 [Bacillus cereus AH621]
 gi|226699909|sp|A9VNB2|RL10_BACWK RecName: Full=50S ribosomal protein L10
 gi|163860304|gb|ABY41363.1| ribosomal protein L10 [Bacillus weihenstephanensis KBAB4]
 gi|228618350|gb|EEK75380.1| 50S ribosomal protein L10 [Bacillus cereus AH621]
 gi|228652319|gb|EEL08244.1| 50S ribosomal protein L10 [Bacillus cereus BDRD-ST196]
 gi|228721363|gb|EEL72884.1| 50S ribosomal protein L10 [Bacillus cereus AH603]
 gi|228751630|gb|EEM01430.1| 50S ribosomal protein L10 [Bacillus mycoides DSM 2048]
          Length = 166

 Score = 84.7 bits (208), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 41/134 (30%), Positives = 80/134 (59%), Gaps = 1/134 (0%)

Query: 10  ISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRG 69
           ++E+++   +S S +V  Y+G++V++  +LRK +REAG   KV KN L + A     +  
Sbjct: 12  VTEIAEKLRASKSTIVVDYRGLTVSEATELRKNLREAGVEFKVYKNSLTRRAAESAEMAE 71

Query: 70  ISDLFVGQSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASLPD 128
           +++   G + I +S+  V+AP K+   F+ ++    +  GV+E  ++  D +K IA+LP 
Sbjct: 72  LNEFLTGPNAIAFSNEDVVAPAKVLNDFAKNHEALEIKAGVIEGKLVTLDEVKAIATLPS 131

Query: 129 LEGIRAGIISAIQS 142
            EG+ + ++S +Q+
Sbjct: 132 REGLLSMLLSVLQA 145


>gi|229830150|ref|ZP_04456219.1| hypothetical protein GCWU000342_02257 [Shuttleworthia satelles DSM
           14600]
 gi|229791448|gb|EEP27562.1| hypothetical protein GCWU000342_02257 [Shuttleworthia satelles DSM
           14600]
          Length = 214

 Score = 84.3 bits (207), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 46/143 (32%), Positives = 81/143 (56%), Gaps = 1/143 (0%)

Query: 10  ISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRG 69
           + E++     + S+VV  Y+G++VA+  +LRK +REAG   KV KN +V+ AI+DT   G
Sbjct: 11  VQEIADSIQDAASVVVVDYRGLTVAEDTELRKDLREAGVTYKVYKNTMVRFAIKDTDFAG 70

Query: 70  ISDLFVGQSLIVYS-DSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASLPD 128
           ++D   G + I  S D    A ++  +F+    +  +  GVVE    + + I+ IAS+P 
Sbjct: 71  LADALEGPNAIAISRDDATAAARVLANFAKKAPKLELKAGVVEGKFCDAEEIQAIASVPS 130

Query: 129 LEGIRAGIISAIQSNATRLVRLL 151
            + + + ++ + Q+  T L R+L
Sbjct: 131 RDELISRLLGSFQAPVTNLARVL 153


>gi|300779863|ref|ZP_07089719.1| 50S ribosomal protein L10 [Corynebacterium genitalium ATCC 33030]
 gi|300533973|gb|EFK55032.1| 50S ribosomal protein L10 [Corynebacterium genitalium ATCC 33030]
          Length = 174

 Score = 84.3 bits (207), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 49/169 (28%), Positives = 88/169 (52%), Gaps = 7/169 (4%)

Query: 7   SVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVK--VAKNRLVKIAIRD 64
           + E++EL + F  S ++ +  Y+G++V+Q++ LR ++   G  V+  VAKN LVKIA  +
Sbjct: 7   TAELAELKEKFEGSSAVFLTEYRGLTVSQLQQLRGEL---GFDVELHVAKNTLVKIAANE 63

Query: 65  TSIRGISDLFVGQSLIVY--SDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQ 122
             I G+ D   G + + +   D+ V A K    F+ DN+ F V GG ++   L+   +  
Sbjct: 64  HGIEGLDDYLTGPTAVAFIKGDATVDAAKTMKKFAKDNDLFIVKGGYMDGNALDASQVAA 123

Query: 123 IASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQQ 171
           +A + + E   A +  A Q +  +   L   P ++  R ++A  DK  +
Sbjct: 124 VAEMDNRETTLAKLAGAFQGSLAKAAGLFQAPASKTARLVAALQDKQDE 172


>gi|315649714|ref|ZP_07902798.1| ribosomal protein L10 [Paenibacillus vortex V453]
 gi|315274902|gb|EFU38278.1| ribosomal protein L10 [Paenibacillus vortex V453]
          Length = 167

 Score = 84.3 bits (207), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 50/170 (29%), Positives = 89/170 (52%), Gaps = 12/170 (7%)

Query: 4   QGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIR 63
           Q K   +  ++     S S VVA Y+G++VAQ+ +LRK++REAG   +V KN L++ A  
Sbjct: 8   QAKQEAVDVVAAKLRESVSTVVADYRGLNVAQVTELRKQLREAGVEFQVLKNTLLRRATA 67

Query: 64  DTSIRGISDLFVGQSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQ 122
              +  + ++  G + + +  +  +AP K+   F+  N+  ++ G VVE  V+ +  IK 
Sbjct: 68  AADLTELDEVLTGPTAVAFGTNDAVAPAKVLNDFAKKNDALKLKGAVVEGRVIGESEIKA 127

Query: 123 IASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQQG 172
           +A LP  EG+ + ++S +Q+           P      A+ A  +K +QG
Sbjct: 128 LAELPSREGLLSMLLSVLQA-----------PVRNFALAVKAVAEKEEQG 166


>gi|257869770|ref|ZP_05649423.1| ribosomal protein L10 [Enterococcus gallinarum EG2]
 gi|257803934|gb|EEV32756.1| ribosomal protein L10 [Enterococcus gallinarum EG2]
          Length = 166

 Score = 84.3 bits (207), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 46/164 (28%), Positives = 90/164 (54%), Gaps = 12/164 (7%)

Query: 10  ISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRG 69
           + E+S+ F ++ S+VV  Y+G++V ++  LRK++R+A   +KV KN ++  A     + G
Sbjct: 13  VDEVSEKFKAAASVVVVDYRGLTVDEVTRLRKQLRDANVEMKVIKNSILSRAAEQAGLEG 72

Query: 70  ISDLFVGQSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASLPD 128
           + ++F G + + +S+  V+AP KI   F+ +     + GG++E  V + + I  +A LP+
Sbjct: 73  LGEVFTGPTAVAFSNEDVVAPAKIMNDFAKEAKALEIKGGIIEGKVSSLEEITALAKLPN 132

Query: 129 LEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQQG 172
            EG+ + ++S +Q+           P   V  A+ A  +K +  
Sbjct: 133 REGLLSMLLSVLQA-----------PIRNVAYAVKAVAEKEEDA 165


>gi|187931081|ref|YP_001891065.1| 50S ribosomal protein L10 [Francisella tularensis subsp.
           mediasiatica FSC147]
 gi|226699954|sp|B2SFD4|RL10_FRATM RecName: Full=50S ribosomal protein L10
 gi|187711990|gb|ACD30287.1| 50S ribosomal protein L10 [Francisella tularensis subsp.
           mediasiatica FSC147]
          Length = 172

 Score = 84.3 bits (207), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 49/165 (29%), Positives = 89/165 (53%), Gaps = 1/165 (0%)

Query: 4   QGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIR 63
           + K   ++E+++  SS+ S  VA Y+G++V ++  LRK+ RE+G  ++V +N L ++AI+
Sbjct: 6   EDKKAIVAEVAEQMSSALSAAVADYRGLTVNEMTSLRKQARESGVYLRVVRNNLARLAIK 65

Query: 64  DTSIRGISDLFVGQSLIVYS-DSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQ 122
            T    ++D   G  ++  S D+P  A K+  +F  D+N F V    +   +   + +  
Sbjct: 66  GTEFECLADALKGPLVLALSKDAPGAAAKLFKNFQKDHNAFEVKNLAMSGELFGPEKLDD 125

Query: 123 IASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVD 167
            A LP  E   A +++ +Q+  T+ VR L    +Q VR  +A  D
Sbjct: 126 FAKLPTREEALATLLNVMQAPVTKFVRTLNEIPSQAVRVFAAVGD 170


>gi|289433604|ref|YP_003463476.1| hypothetical protein lse_0235 [Listeria seeligeri serovar 1/2b str.
           SLCC3954]
 gi|289169848|emb|CBH26386.1| rplJ [Listeria seeligeri serovar 1/2b str. SLCC3954]
 gi|313635078|gb|EFS01428.1| 50S ribosomal protein L10 [Listeria seeligeri FSL N1-067]
 gi|313639744|gb|EFS04499.1| 50S ribosomal protein L10 [Listeria seeligeri FSL S4-171]
          Length = 166

 Score = 84.3 bits (207), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 45/140 (32%), Positives = 79/140 (56%), Gaps = 1/140 (0%)

Query: 4   QGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIR 63
           + K   + E+    S+S S V+  Y+G++V +I +LRK++R+AG   KV KN L + A+ 
Sbjct: 6   EAKQSAVEEIKGKLSASASTVIVDYRGLNVGEITELRKQLRDAGIEFKVYKNSLTRRAVE 65

Query: 64  DTSIRGISDLFVGQSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQ 122
                G+     G + I +S+  V+AP KI   F+ D+    +  GV+E  V + + IK 
Sbjct: 66  ANGYEGLEGALTGPNAIAFSNEDVVAPAKILNDFAKDHEALEIKAGVIEGKVASLEEIKA 125

Query: 123 IASLPDLEGIRAGIISAIQS 142
           +A+LP  EG+ + + + +Q+
Sbjct: 126 LATLPSREGLLSMLCNVLQA 145


>gi|82701890|ref|YP_411456.1| 50S ribosomal protein L10 [Nitrosospira multiformis ATCC 25196]
 gi|97181782|sp|Q2YB07|RL10_NITMU RecName: Full=50S ribosomal protein L10
 gi|82409955|gb|ABB74064.1| LSU ribosomal protein L10P [Nitrosospira multiformis ATCC 25196]
          Length = 174

 Score = 84.3 bits (207), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 49/170 (28%), Positives = 86/170 (50%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           +N   K   ++E+S   + + +I++A Y+G+ V  +  LR K R++G   +V KN L + 
Sbjct: 3   LNLDEKKAVVAEVSAQVAKAQAIIIAEYRGLGVGHMTQLRAKARQSGIYFRVLKNSLARR 62

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A+ DT   G+S+  VG         PV A K+   FS  N++  +  G +   V++   I
Sbjct: 63  AVSDTPFSGLSEHMVGPLAYGIGSDPVAAAKVLHEFSKGNDKLVIKAGAMANHVISSSEI 122

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQ 170
             +ASLP  E + A ++  +Q+     VR L     + VR ++A  D+ +
Sbjct: 123 ASLASLPSREELLAKLLGTMQAPVANFVRTLNEVPARFVRGLAAVRDQKE 172


>gi|75763954|ref|ZP_00743582.1| LSU ribosomal protein L10P [Bacillus thuringiensis serovar
           israelensis ATCC 35646]
 gi|218895234|ref|YP_002443645.1| ribosomal protein L10 [Bacillus cereus G9842]
 gi|228898852|ref|ZP_04063134.1| 50S ribosomal protein L10 [Bacillus thuringiensis IBL 4222]
 gi|228905896|ref|ZP_04069793.1| 50S ribosomal protein L10 [Bacillus thuringiensis IBL 200]
 gi|228963199|ref|ZP_04124368.1| 50S ribosomal protein L10 [Bacillus thuringiensis serovar sotto
           str. T04001]
 gi|226699906|sp|B7IT08|RL10_BACC2 RecName: Full=50S ribosomal protein L10
 gi|74488556|gb|EAO52144.1| LSU ribosomal protein L10P [Bacillus thuringiensis serovar
           israelensis ATCC 35646]
 gi|218544126|gb|ACK96520.1| ribosomal protein L10 [Bacillus cereus G9842]
 gi|228796457|gb|EEM43896.1| 50S ribosomal protein L10 [Bacillus thuringiensis serovar sotto
           str. T04001]
 gi|228853711|gb|EEM98471.1| 50S ribosomal protein L10 [Bacillus thuringiensis IBL 200]
 gi|228860752|gb|EEN05130.1| 50S ribosomal protein L10 [Bacillus thuringiensis IBL 4222]
          Length = 166

 Score = 84.3 bits (207), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 41/134 (30%), Positives = 80/134 (59%), Gaps = 1/134 (0%)

Query: 10  ISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRG 69
           ++E++    +S S +V  Y+G++V++  +LRK++REAG   KV KN L + A     +  
Sbjct: 12  VTEIADKLRASKSTIVVDYRGLTVSEATELRKQLREAGVEFKVYKNSLTRRAAESAEMAE 71

Query: 70  ISDLFVGQSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASLPD 128
           +++   G + I +S+  V+AP K+   F+ ++    +  GV+E  ++  D +K IA+LP 
Sbjct: 72  LNEFLTGPNAIAFSNEDVVAPAKVLNDFAKNHEALEIKAGVIEGKLVTLDEVKAIATLPS 131

Query: 129 LEGIRAGIISAIQS 142
            EG+ + ++S +Q+
Sbjct: 132 REGLLSMLLSVLQA 145


>gi|328958742|ref|YP_004376128.1| 50S ribosomal protein L10 [Carnobacterium sp. 17-4]
 gi|328675066|gb|AEB31112.1| 50S ribosomal protein L10 [Carnobacterium sp. 17-4]
          Length = 166

 Score = 84.3 bits (207), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 43/127 (33%), Positives = 78/127 (61%), Gaps = 1/127 (0%)

Query: 17  FSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRGISDLFVG 76
           F  + S+VV  Y+G++V ++ +LRK++R+AG  +KV KN ++  A     + G++D+F G
Sbjct: 20  FKEAASVVVMDYRGLTVEEVTNLRKQLRDAGIEMKVIKNSVLSRAAEAAGLEGMNDVFKG 79

Query: 77  QSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASLPDLEGIRAG 135
            + I +S+  V+AP KI   F+       + GGV+E  V +   I  +A+LPD +G+ + 
Sbjct: 80  PTAIAFSNDDVVAPAKIIAEFAKGAAALEIKGGVIEGRVSSATEINALATLPDRDGLLSM 139

Query: 136 IISAIQS 142
           ++S +Q+
Sbjct: 140 LLSVLQA 146


>gi|227510704|ref|ZP_03940753.1| ribosomal protein L10 [Lactobacillus brevis subsp. gravesensis ATCC
           27305]
 gi|227189825|gb|EEI69892.1| ribosomal protein L10 [Lactobacillus brevis subsp. gravesensis ATCC
           27305]
          Length = 174

 Score = 84.3 bits (207), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 49/167 (29%), Positives = 87/167 (52%), Gaps = 12/167 (7%)

Query: 6   KSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDT 65
           K+ ++ E ++   ++ SIVV  Y+G++VA++ DLRK++R+ G  ++V KN+++  A    
Sbjct: 12  KAKKVEEATESIKAASSIVVVDYRGLTVAEVTDLRKQLRDEGVKMQVIKNKVLVRAAEKA 71

Query: 66  SIRGISDLFVGQSLIVY-SDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIA 124
            +  + D F G + +V+ S+ PV  PKI  +F+  N+   + GGV++  V   D I   A
Sbjct: 72  GLDDLKDTFAGPTAVVFSSEDPVAGPKIVHNFAKSNDALELKGGVIDGKVATLDEINAYA 131

Query: 125 SLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQQ 171
           +LP  E +            + L  +L  P       + A  DK Q+
Sbjct: 132 ALPSREEL-----------LSTLANILQAPVRNFAYGVKAIADKKQE 167


>gi|229818376|ref|ZP_04448657.1| hypothetical protein BIFANG_03678 [Bifidobacterium angulatum DSM
           20098]
 gi|229784246|gb|EEP20360.1| hypothetical protein BIFANG_03678 [Bifidobacterium angulatum DSM
           20098]
          Length = 173

 Score = 84.3 bits (207), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 58/177 (32%), Positives = 90/177 (50%), Gaps = 10/177 (5%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKM-REAGGGVKVAKNRLVK 59
           M R  K   +++L+  F S+ +I +  Y+G++V QI DLR+K+ R+      VAKN L +
Sbjct: 1   MKRPEKEAVVAQLTDEFRSADAIYLTEYRGLTVPQISDLREKLGRDTS--YTVAKNTLAR 58

Query: 60  IAIRDTSIRGISDLFVGQSLIVYSDSPVI-APKISVSFSNDNNEFRVLGGVVEKGVLNQD 118
           IA ++  I G+ ++  G + I +     I A K+   F+NDN    + GG  +  V + +
Sbjct: 59  IAAKEAGIEGLDEILSGPTAITFVHGDFIEAAKVIRDFANDNKALVIKGGFADGTVYDAE 118

Query: 119 SIKQIASL---PDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQQG 172
             KQ+A L   P L    AG I A  S A  L   L    T+ VR I A  +K ++ 
Sbjct: 119 GAKQLADLKSRPQLLAEFAGDIKATMSKAAYLFNAL---PTKAVRTIDALREKQEKA 172


>gi|160947268|ref|ZP_02094435.1| hypothetical protein PEPMIC_01201 [Parvimonas micra ATCC 33270]
 gi|158446402|gb|EDP23397.1| hypothetical protein PEPMIC_01201 [Parvimonas micra ATCC 33270]
          Length = 172

 Score = 84.3 bits (207), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 43/143 (30%), Positives = 84/143 (58%), Gaps = 1/143 (0%)

Query: 10  ISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRG 69
           ISE+ +   +SGS+V+  Y+G++V Q+ DLRKK REAG   KV KN ++K+A ++     
Sbjct: 18  ISEIREKIENSGSLVLVDYRGLTVEQVTDLRKKYREAGVQYKVYKNTMMKLAFKELGFED 77

Query: 70  ISDLFVGQSLIVYS-DSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASLPD 128
            +    G S + +S +    A +I+  F+  N +  +  G++E  +L+ + +K +A++P 
Sbjct: 78  FNQYLEGPSAVAFSGEDLTAAARITNEFAKSNEKLVIKAGILEGKILDTNGVKAVANIPS 137

Query: 129 LEGIRAGIISAIQSNATRLVRLL 151
            E + A ++ ++++  +  V +L
Sbjct: 138 REVLIAKLLGSLKAPVSNFVYML 160


>gi|258513630|ref|YP_003189852.1| 50S ribosomal protein L10 [Desulfotomaculum acetoxidans DSM 771]
 gi|257777335|gb|ACV61229.1| ribosomal protein L10 [Desulfotomaculum acetoxidans DSM 771]
          Length = 175

 Score = 84.0 bits (206), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 44/125 (35%), Positives = 72/125 (57%), Gaps = 1/125 (0%)

Query: 19  SSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRGISDLFVGQS 78
           S  S ++A Y+G++V+ + +LR K+RE+   +KVAKN L+KIA+    I G+     G +
Sbjct: 20  SCKSAILADYRGLTVSAVTELRNKLRESNSDLKVAKNTLIKIAVDKIGIEGLDPYLEGPT 79

Query: 79  LIVYS-DSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASLPDLEGIRAGII 137
            I +  D PV   KI   F+  N +  + GGV+E  V+  D +K +ASLP  E +   ++
Sbjct: 80  AIAFGYDDPVAPAKILSEFARTNKDLEIKGGVLEGRVITADGVKGLASLPSREVLLGKVL 139

Query: 138 SAIQS 142
             +Q+
Sbjct: 140 GGMQA 144


>gi|254720820|ref|ZP_05182612.1| 50S ribosomal protein L10 [Bacillus anthracis str. A1055]
          Length = 166

 Score = 84.0 bits (206), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 42/134 (31%), Positives = 79/134 (58%), Gaps = 1/134 (0%)

Query: 10  ISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRG 69
           ++E++    +S S +V  Y+G++V++  +LRK++REAG   KV KN L + A     +  
Sbjct: 12  VTEIADKLRASKSTIVVDYRGLTVSEATELRKQLREAGVEFKVYKNSLTRRAAESAEMAE 71

Query: 70  ISDLFVGQSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASLPD 128
           +++   G + I +S+  V+AP K+   F+ D+    +  GV+E  ++  D +K IA LP 
Sbjct: 72  LNEFLTGPNAIAFSNEDVVAPAKVLNDFAKDHEALEIKAGVIEGKLVTLDEVKAIAILPS 131

Query: 129 LEGIRAGIISAIQS 142
            EG+ + ++S +Q+
Sbjct: 132 REGLLSMLLSVLQA 145


>gi|229027947|ref|ZP_04184100.1| 50S ribosomal protein L10 [Bacillus cereus AH1271]
 gi|228733335|gb|EEL84164.1| 50S ribosomal protein L10 [Bacillus cereus AH1271]
          Length = 166

 Score = 84.0 bits (206), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 41/134 (30%), Positives = 78/134 (58%), Gaps = 1/134 (0%)

Query: 10  ISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRG 69
           ++E++     S S +V  Y+G++V+++ +LRK +REAG   KV KN L + A     +  
Sbjct: 12  VTEIADKLRESKSTIVVDYRGLTVSEVTELRKNLREAGVEFKVYKNSLTRRAAESAEMAE 71

Query: 70  ISDLFVGQSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASLPD 128
           +++   G + I +S+  V+AP K+   F+  +    +  GV+E  ++  D +K IA+LP 
Sbjct: 72  LNEFLTGPNAIAFSNEDVVAPAKVLNDFATKHEALEIKAGVIEGKLVTLDEVKAIATLPS 131

Query: 129 LEGIRAGIISAIQS 142
            EG+ + ++S +Q+
Sbjct: 132 REGLLSMLLSVLQA 145


>gi|282855230|ref|ZP_06264562.1| ribosomal protein L10 [Propionibacterium acnes J139]
 gi|282581818|gb|EFB87203.1| ribosomal protein L10 [Propionibacterium acnes J139]
 gi|314924092|gb|EFS87923.1| ribosomal protein L10 [Propionibacterium acnes HL001PA1]
 gi|314965014|gb|EFT09113.1| ribosomal protein L10 [Propionibacterium acnes HL082PA2]
 gi|314983136|gb|EFT27228.1| ribosomal protein L10 [Propionibacterium acnes HL110PA3]
 gi|315090633|gb|EFT62609.1| ribosomal protein L10 [Propionibacterium acnes HL110PA4]
 gi|315093815|gb|EFT65791.1| ribosomal protein L10 [Propionibacterium acnes HL060PA1]
 gi|315104030|gb|EFT76006.1| ribosomal protein L10 [Propionibacterium acnes HL050PA2]
 gi|327326456|gb|EGE68245.1| ribosomal protein L10 [Propionibacterium acnes HL103PA1]
          Length = 204

 Score = 84.0 bits (206), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 51/170 (30%), Positives = 93/170 (54%), Gaps = 4/170 (2%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M R  K   ++EL + FSS+ + V+  Y+G+SV+ +KDLR+ +  +     VAKN L +I
Sbjct: 1   MARPDKVAAVAELKEKFSSADATVLTEYRGLSVSALKDLRRSLG-SDATYAVAKNTLTRI 59

Query: 61  AIRDTSIRGISDLFVGQSLI--VYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQD 118
           A R+  I G+ D  VG + +  ++ D   +A  +  +F+ DN    + GGV++  VL+ D
Sbjct: 60  AAREAGIEGLDDQLVGPTALAFIHGDVASVAKGLK-NFAKDNPLLVIKGGVMDGNVLDAD 118

Query: 119 SIKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDK 168
            +K++A L   E + A +   +++N T+   +     ++  R + A  +K
Sbjct: 119 QVKKLADLESREVLLAKLAGGLKANLTKAAVVFNALPSKAARGLGALQEK 168


>gi|254427246|ref|ZP_05040953.1| ribosomal protein L10, putative [Alcanivorax sp. DG881]
 gi|196193415|gb|EDX88374.1| ribosomal protein L10, putative [Alcanivorax sp. DG881]
          Length = 176

 Score = 84.0 bits (206), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 53/177 (29%), Positives = 96/177 (54%), Gaps = 9/177 (5%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           +N + K   ++ ++ + + + S VVA Y+G++V+Q+ +LR K RE G  +KV +N L K 
Sbjct: 3   LNLEDKRAIVASVNAVATEALSAVVADYRGLTVSQMTELRSKARETGVYLKVVRNTLAKF 62

Query: 61  AIRDTSIRGISDLFVGQSLIVYS-DSPVIAPKISVSFSNDNNEFRV----LGGVVEKGVL 115
           A++DT    ++D  VG +++ +S D P  A ++   F+ D++   V    +GGV      
Sbjct: 63  AVKDTEFECLNDALVGPTVLAFSQDDPGAAARLIKDFAKDHDALEVKALAVGGVTYGA-- 120

Query: 116 NQDSIKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQQG 172
            QD I  +A LP  +   + ++S +Q+   + VR L     + VR ++A  D+ Q  
Sbjct: 121 -QD-IDILAKLPTRDEAISQLMSVMQAPVAKFVRTLNEVPGKFVRTVAAVKDQKQSA 175


>gi|89257015|ref|YP_514377.1| 50S ribosomal protein L10 [Francisella tularensis subsp. holarctica
           LVS]
 gi|115315376|ref|YP_764099.1| 50S ribosomal protein L10 [Francisella tularensis subsp. holarctica
           OSU18]
 gi|156503216|ref|YP_001429281.1| 50S ribosomal protein L10 [Francisella tularensis subsp. holarctica
           FTNF002-00]
 gi|167009396|ref|ZP_02274327.1| 50S ribosomal protein L10 [Francisella tularensis subsp. holarctica
           FSC200]
 gi|254368267|ref|ZP_04984287.1| 50S ribosomal protein L10 [Francisella tularensis subsp. holarctica
           257]
 gi|290954465|ref|ZP_06559086.1| 50S ribosomal protein L10 [Francisella tularensis subsp. holarctica
           URFT1]
 gi|295312070|ref|ZP_06802883.1| 50S ribosomal protein L10 [Francisella tularensis subsp. holarctica
           URFT1]
 gi|122324637|sp|Q0BKC2|RL10_FRATO RecName: Full=50S ribosomal protein L10
 gi|122500257|sp|Q2A1M5|RL10_FRATH RecName: Full=50S ribosomal protein L10
 gi|166229726|sp|A7NEC2|RL10_FRATF RecName: Full=50S ribosomal protein L10
 gi|89144846|emb|CAJ80185.1| 50S ribosomal protein L10 [Francisella tularensis subsp. holarctica
           LVS]
 gi|115130275|gb|ABI83462.1| ribosomal protein L10 [Francisella tularensis subsp. holarctica
           OSU18]
 gi|134254077|gb|EBA53171.1| 50S ribosomal protein L10 [Francisella tularensis subsp. holarctica
           257]
 gi|156253819|gb|ABU62325.1| ribosomal protein L10 [Francisella tularensis subsp. holarctica
           FTNF002-00]
          Length = 172

 Score = 84.0 bits (206), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 50/165 (30%), Positives = 88/165 (53%), Gaps = 1/165 (0%)

Query: 4   QGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIR 63
           + K   ++E+++  SS+ S  VA Y+G++V Q+  LRK+ RE+G  ++V +N L ++AI+
Sbjct: 6   EDKKAIVAEVAEQVSSALSAAVADYRGLTVNQMTSLRKQARESGVYLRVVRNNLARLAIK 65

Query: 64  DTSIRGISDLFVGQSLIVYS-DSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQ 122
            T    ++D   G  ++  S D P  A K+  +F  D+N F V    +   +   + +  
Sbjct: 66  GTEFECLADALKGPLVLALSKDEPGAAAKLFKNFQKDHNAFEVKNLAMSGELFGPEKLDD 125

Query: 123 IASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVD 167
            A LP  E   A +++ +Q+  T+ VR L    +Q VR  +A  D
Sbjct: 126 FAKLPTREEALATLLNIMQAPVTKFVRTLNEIPSQAVRVFAAVGD 170


>gi|110833237|ref|YP_692096.1| 50S ribosomal protein L10 [Alcanivorax borkumensis SK2]
 gi|123050737|sp|Q0VSM4|RL10_ALCBS RecName: Full=50S ribosomal protein L10
 gi|110646348|emb|CAL15824.1| 50S ribosomal protein L10 [Alcanivorax borkumensis SK2]
          Length = 176

 Score = 84.0 bits (206), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 53/177 (29%), Positives = 96/177 (54%), Gaps = 9/177 (5%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           +N + K   ++ ++ + + + S VVA Y+G++V+Q+ +LR K RE G  +KV +N L K 
Sbjct: 3   LNLEDKRAIVASVNAVAAEALSAVVADYRGLTVSQMTELRSKARETGVYLKVVRNTLAKF 62

Query: 61  AIRDTSIRGISDLFVGQSLIVYS-DSPVIAPKISVSFSNDNNEFRV----LGGVVEKGVL 115
           A++DT    ++D  VG +++ +S D P  A ++   F+ D++   V    +GGV      
Sbjct: 63  AVKDTEFECLNDALVGPTVLAFSKDDPGAAARLIKDFAKDHDALEVKALAVGGVTYGA-- 120

Query: 116 NQDSIKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQQG 172
            QD I  +A LP  +   + ++S +Q+   + VR L     + VR ++A  D+ Q  
Sbjct: 121 -QD-IDVLAKLPTRDEAISQLMSVMQAPVAKFVRTLNEVPGKFVRTVAAVKDQKQSA 175


>gi|296100613|ref|YP_003610759.1| 50S ribosomal protein L10 [Enterobacter cloacae subsp. cloacae ATCC
           13047]
 gi|295055072|gb|ADF59810.1| 50S ribosomal protein L10 [Enterobacter cloacae subsp. cloacae ATCC
           13047]
          Length = 165

 Score = 84.0 bits (206), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 50/154 (32%), Positives = 89/154 (57%), Gaps = 2/154 (1%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           +N Q K   ++E+S++   + S VVA  +G++V ++ +LRK  REAG  ++V +N L++ 
Sbjct: 3   LNLQDKQAIVAEVSEVAKGALSAVVADSRGVTVDKMTELRKAGREAGVYMRVVRNTLLRR 62

Query: 61  AIRDTSIRGISDLFVGQSLIVYS-DSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
           A+  TS   + D FVG +LI YS + P  A ++   F+  N +F V     E  ++    
Sbjct: 63  AVEGTSFECLKDTFVGPTLIAYSMEHPGAAARLFKEFAKANAKFEVKAAAFEGELIPASQ 122

Query: 120 IKQIASLPDLEGIRAGIISAI-QSNATRLVRLLG 152
           I ++A+LP  E   A +++ + +++A +LVR L 
Sbjct: 123 IDRLATLPTYEEAIARLMATMKEASAGKLVRTLA 156


>gi|312880649|ref|ZP_07740449.1| LSU ribosomal protein L10P [Aminomonas paucivorans DSM 12260]
 gi|310783940|gb|EFQ24338.1| LSU ribosomal protein L10P [Aminomonas paucivorans DSM 12260]
          Length = 176

 Score = 84.0 bits (206), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 49/175 (28%), Positives = 94/175 (53%), Gaps = 3/175 (1%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M  + K  +I+EL+++   S ++ +  Y+G++V ++ DLR ++R+AGG +KVAKN L+++
Sbjct: 1   MPTEAKREKIAELAEMLGKSEAVFICEYRGLTVKKVTDLRARIRKAGGEMKVAKNTLMRL 60

Query: 61  AIRDTSIRGISDLFVGQS--LIVYSDSPVIAPKISVSFSNDNNEFRVL-GGVVEKGVLNQ 117
           A++   +        G +   +VY D   +A  +        NE  +L GGV+ K +LN+
Sbjct: 61  ALQQAGLPTADPYETGPNAYTLVYGDIAAVAKALRDYSKEKGNEALILKGGVMGKDLLNK 120

Query: 118 DSIKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQQG 172
           + +  +A LP  + + A ++  I +     V +L  P   +V  +S   DK ++ 
Sbjct: 121 EQVLALADLPSRDVLLAQVVGTIAAPLRSFVTVLSGPARGLVTCLSQIQDKKEKA 175


>gi|296333101|ref|ZP_06875555.1| 50S ribosomal protein L10 [Bacillus subtilis subsp. spizizenii ATCC
           6633]
 gi|305672803|ref|YP_003864474.1| 50S ribosomal protein L10 [Bacillus subtilis subsp. spizizenii str.
           W23]
 gi|296149717|gb|EFG90612.1| 50S ribosomal protein L10 [Bacillus subtilis subsp. spizizenii ATCC
           6633]
 gi|305411046|gb|ADM36164.1| 50S ribosomal protein L10 [Bacillus subtilis subsp. spizizenii str.
           W23]
          Length = 166

 Score = 84.0 bits (206), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 41/140 (29%), Positives = 80/140 (57%), Gaps = 1/140 (0%)

Query: 4   QGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIR 63
           + K V + E++     S S ++  Y+G++V+++ +LRK++REA    KV KN + + A+ 
Sbjct: 6   ETKKVVVEEITSKLKESKSTIIVDYRGLNVSEVTELRKQLREANVEFKVYKNTMTRRAVE 65

Query: 64  DTSIRGISDLFVGQSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQ 122
              + G++D+  G + I +S   V+AP K+   F+  +    +  GV+E  V   + +K 
Sbjct: 66  QAELDGLNDVLTGPNAIAFSTEDVVAPAKVLNEFAKQHEALEIKAGVIEGKVSTVEEVKA 125

Query: 123 IASLPDLEGIRAGIISAIQS 142
           +A LP  EG+ + ++S +Q+
Sbjct: 126 LAELPSREGLLSMLLSVLQA 145


>gi|229917369|ref|YP_002886015.1| ribosomal protein L10 [Exiguobacterium sp. AT1b]
 gi|229468798|gb|ACQ70570.1| ribosomal protein L10 [Exiguobacterium sp. AT1b]
          Length = 168

 Score = 84.0 bits (206), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 46/138 (33%), Positives = 82/138 (59%), Gaps = 1/138 (0%)

Query: 6   KSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDT 65
           KS  + E+++   +S   VV  Y+G++V ++  LRK +R+AG   KV KN L++ A   +
Sbjct: 10  KSALVDEIAEKMQASVGTVVVDYRGLTVEEVTTLRKSLRDAGIEFKVYKNGLLRRAATQS 69

Query: 66  SIRGISDLFVGQSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIA 124
           +  G+ ++F G + I +S   VIAP KI   FS ++    + GG++E  V + + IK +A
Sbjct: 70  NFEGLDEVFTGPTAIAFSKEDVIAPAKILNDFSKEHKALELKGGIIEGKVSSLEEIKALA 129

Query: 125 SLPDLEGIRAGIISAIQS 142
            LP  +G+ + ++S +Q+
Sbjct: 130 ELPSRDGLLSMLLSVLQA 147


>gi|300782530|ref|YP_003762821.1| 50S ribosomal protein L10 [Amycolatopsis mediterranei U32]
 gi|299792044|gb|ADJ42419.1| large subunit ribosomal protein L10 [Amycolatopsis mediterranei
           U32]
          Length = 184

 Score = 84.0 bits (206), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 55/171 (32%), Positives = 90/171 (52%), Gaps = 2/171 (1%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M +  K   ++E+++ F +S + VV  Y G+SV+Q+  LR+ +       +VAKN LVK 
Sbjct: 1   MAKPDKVAAVAEIAESFRTSSATVVTQYTGLSVSQLSQLRRALG-TSAKYRVAKNTLVKR 59

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVI-APKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
           A  D  I+G+ DLFVG + I + +   + A K    F+ DNN   + GG ++   L+ D 
Sbjct: 60  AAEDAGIQGLEDLFVGATAIAFVEGEAVDAAKAIRDFAKDNNALVIKGGYMDGRALSVDE 119

Query: 120 IKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQ 170
           I +IA L   E + A    A ++  ++   L   P +QV R  +A  +K +
Sbjct: 120 INRIADLDSREVLLAKAAGAFKAKLSQAAALFQAPASQVARLAAALEEKQR 170


>gi|317495082|ref|ZP_07953453.1| ribosomal protein L10 [Gemella moribillum M424]
 gi|316914789|gb|EFV36264.1| ribosomal protein L10 [Gemella moribillum M424]
          Length = 166

 Score = 84.0 bits (206), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 46/163 (28%), Positives = 86/163 (52%), Gaps = 12/163 (7%)

Query: 10  ISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRG 69
           ++++++   +S S+V+A Y+G++VA++ +LR  MR  G   KV KN LV+ A+    I G
Sbjct: 12  VNQIAEEIKASSSVVIADYRGLNVAEVTELRNNMRNEGLTFKVYKNSLVRRAMEQAGIEG 71

Query: 70  ISDLFVGQSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASLPD 128
           + ++  G +   +S    +AP ++   F+ ++    +  GV+E  V +Q  IK IA+LP 
Sbjct: 72  LEEVLTGPNAFAFSTDDAVAPARVLNDFAKEHENLELKAGVIEGKVADQAEIKAIATLPS 131

Query: 129 LEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQQ 171
            EG+ + ++S           +L  P      A+ A  D+  +
Sbjct: 132 REGLLSMLLS-----------VLTAPMRNTALAVKAVADQKAE 163


>gi|332184684|gb|AEE26938.1| LSU ribosomal protein L10p (P0) [Francisella cf. novicida 3523]
          Length = 172

 Score = 84.0 bits (206), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 49/165 (29%), Positives = 89/165 (53%), Gaps = 1/165 (0%)

Query: 4   QGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIR 63
           + K   ++E+++  SS+ S  VA Y+G++V ++  LRK+ RE+G  ++V +N L ++AI+
Sbjct: 6   EDKKAIVAEVAEQVSSALSAAVADYRGLTVNEMTSLRKQARESGVYLRVVRNNLARLAIK 65

Query: 64  DTSIRGISDLFVGQSLIVYS-DSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQ 122
            T +  ++D   G  ++  S D P  A K+  +F  D+N F V    +   +   + +  
Sbjct: 66  GTELECLADALKGPLVLALSKDEPGAAAKLFKNFQKDHNAFEVKNLAMSGELFGPEKLDD 125

Query: 123 IASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVD 167
            A LP  E   A +++ +Q+  T+ VR L    +Q VR  +A  D
Sbjct: 126 FAKLPTREEALATLLNVMQAPVTKFVRTLNEIPSQAVRVFAAVGD 170


>gi|168187824|ref|ZP_02622459.1| 50S ribosomal protein L10 [Clostridium botulinum C str. Eklund]
 gi|169294328|gb|EDS76461.1| 50S ribosomal protein L10 [Clostridium botulinum C str. Eklund]
          Length = 167

 Score = 83.6 bits (205), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 50/152 (32%), Positives = 91/152 (59%), Gaps = 3/152 (1%)

Query: 2   NRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIA 61
           NRQ K  ++ E+ +    + S+V++ Y+G++V +  +LRK++REAG   KV KN LV +A
Sbjct: 5   NRQLKEAKVQEIREKLEKAQSVVLSSYQGLNVEEDTELRKQLREAGVEYKVYKNTLVTLA 64

Query: 62  IRDTSIRGISDLFVGQ-SLIV-YSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
            ++  + GI +   G  SL + Y D+   A +I   F+ D+ +  +  GVVE  V +Q +
Sbjct: 65  AKELGMDGIVEYLEGPVSLAIGYEDATAPA-RILNDFAKDHKKLELKAGVVEGEVFDQAA 123

Query: 120 IKQIASLPDLEGIRAGIISAIQSNATRLVRLL 151
           IK++A++P  E + A ++ ++++  +  V LL
Sbjct: 124 IKELATIPPKEVLIAKLLGSLKAPMSNFVYLL 155


>gi|228937401|ref|ZP_04100047.1| 50S ribosomal protein L10 [Bacillus thuringiensis serovar berliner
           ATCC 10792]
 gi|228970287|ref|ZP_04130946.1| 50S ribosomal protein L10 [Bacillus thuringiensis serovar
           thuringiensis str. T01001]
 gi|228976857|ref|ZP_04137269.1| 50S ribosomal protein L10 [Bacillus thuringiensis Bt407]
 gi|229074160|ref|ZP_04207206.1| 50S ribosomal protein L10 [Bacillus cereus Rock4-18]
 gi|229094821|ref|ZP_04225826.1| 50S ribosomal protein L10 [Bacillus cereus Rock3-29]
 gi|229100898|ref|ZP_04231702.1| 50S ribosomal protein L10 [Bacillus cereus Rock3-28]
 gi|229113775|ref|ZP_04243210.1| 50S ribosomal protein L10 [Bacillus cereus Rock1-3]
 gi|228669646|gb|EEL25053.1| 50S ribosomal protein L10 [Bacillus cereus Rock1-3]
 gi|228682477|gb|EEL36550.1| 50S ribosomal protein L10 [Bacillus cereus Rock3-28]
 gi|228688564|gb|EEL42437.1| 50S ribosomal protein L10 [Bacillus cereus Rock3-29]
 gi|228708930|gb|EEL61057.1| 50S ribosomal protein L10 [Bacillus cereus Rock4-18]
 gi|228782827|gb|EEM30993.1| 50S ribosomal protein L10 [Bacillus thuringiensis Bt407]
 gi|228789396|gb|EEM37316.1| 50S ribosomal protein L10 [Bacillus thuringiensis serovar
           thuringiensis str. T01001]
 gi|228822234|gb|EEM68216.1| 50S ribosomal protein L10 [Bacillus thuringiensis serovar berliner
           ATCC 10792]
 gi|326937893|gb|AEA13789.1| 50S ribosomal protein L10 [Bacillus thuringiensis serovar chinensis
           CT-43]
          Length = 166

 Score = 83.6 bits (205), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 41/134 (30%), Positives = 79/134 (58%), Gaps = 1/134 (0%)

Query: 10  ISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRG 69
           ++E++    +S S +V  Y+G++V++  +LRK++REAG   KV KN L + A     +  
Sbjct: 12  VTEIADKLRASKSTIVVDYRGLTVSEATELRKQLREAGVEFKVYKNSLTRRAAESAEMAE 71

Query: 70  ISDLFVGQSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASLPD 128
           +++   G + I +S+  V+AP K+   F+  +    +  GV+E  ++  D +K IA+LP 
Sbjct: 72  LNEFLTGPNAIAFSNEDVVAPAKVLNDFATKHEALEIKAGVIEGKLVTLDEVKAIATLPS 131

Query: 129 LEGIRAGIISAIQS 142
            EG+ + ++S +Q+
Sbjct: 132 REGLLSMLLSVLQA 145


>gi|149184030|ref|ZP_01862390.1| 50S ribosomal protein L10 [Bacillus sp. SG-1]
 gi|148848258|gb|EDL62548.1| 50S ribosomal protein L10 [Bacillus sp. SG-1]
          Length = 166

 Score = 83.6 bits (205), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 41/134 (30%), Positives = 80/134 (59%), Gaps = 1/134 (0%)

Query: 10  ISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRG 69
           + E+S    +S S ++  Y+G+ V+++ +LRK++REAG   KV KN + + A       G
Sbjct: 12  VDEISDKLKNSVSTIIVDYRGLDVSEVTELRKQLREAGIDFKVYKNTMTRRAAEAAGFEG 71

Query: 70  ISDLFVGQSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASLPD 128
           ++++  G + I +S   V+AP KI  +F+ ++    +  G++E  V + + +K IA LP+
Sbjct: 72  LNEVLTGPNAIAFSTEEVVAPAKILNNFAKEHEALEIKAGIIEGTVTSVEEVKAIAELPN 131

Query: 129 LEGIRAGIISAIQS 142
            EG+ + ++S +Q+
Sbjct: 132 REGLLSMLLSVLQA 145


>gi|329767191|ref|ZP_08258718.1| 50S ribosomal protein L10 [Gemella haemolysans M341]
 gi|328836858|gb|EGF86505.1| 50S ribosomal protein L10 [Gemella haemolysans M341]
          Length = 166

 Score = 83.6 bits (205), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 46/163 (28%), Positives = 86/163 (52%), Gaps = 12/163 (7%)

Query: 10  ISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRG 69
           ++++++   +S S+V+A Y+G++VA++ +LR  MR  G   KV KN LV+ A+    I G
Sbjct: 12  VNQIAEEIKASSSVVIADYRGLNVAEVTELRNNMRNEGLTFKVYKNSLVRRAMEQAGIEG 71

Query: 70  ISDLFVGQSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASLPD 128
           + ++  G +   +S    +AP ++   F+ ++    +  GV+E  V +Q  IK IA+LP 
Sbjct: 72  LDEVLTGPNAFAFSTDDAVAPARVLNDFAKEHENLELKAGVIEGKVADQAEIKAIATLPS 131

Query: 129 LEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQQ 171
            EG+ + ++S           +L  P      A+ A  D+  +
Sbjct: 132 REGLLSMLLS-----------VLTAPMRNTALAVKAVADQKAE 163


>gi|300769749|ref|ZP_07079631.1| 50S ribosomal protein L10 [Lactobacillus plantarum subsp. plantarum
           ATCC 14917]
 gi|300492657|gb|EFK27843.1| 50S ribosomal protein L10 [Lactobacillus plantarum subsp. plantarum
           ATCC 14917]
          Length = 170

 Score = 83.6 bits (205), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 47/141 (33%), Positives = 85/141 (60%), Gaps = 7/141 (4%)

Query: 6   KSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDT 65
           K+ E+ E+++   SS S +V  Y+G++V Q+ DLRK++REAG  ++V KN   KI +R  
Sbjct: 12  KAQEVEEVAEQLKSSVSAIVVDYRGLTVEQVTDLRKQLREAGVKMRVIKN---KIMVRAA 68

Query: 66  SIRGISDL---FVGQSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIK 121
              G  DL   F G + + +S+   +AP KI  +F+   +  ++ GGV+E  V + ++++
Sbjct: 69  DKAGFEDLKPVFAGPTAVAFSEEDPVAPAKILANFAKTADALQLKGGVIEGKVADLETVQ 128

Query: 122 QIASLPDLEGIRAGIISAIQS 142
           + A++P  E + A I + +Q+
Sbjct: 129 EYATMPSREELLATIANLLQA 149


>gi|227513719|ref|ZP_03943768.1| ribosomal protein L10 [Lactobacillus buchneri ATCC 11577]
 gi|227083038|gb|EEI18350.1| ribosomal protein L10 [Lactobacillus buchneri ATCC 11577]
          Length = 174

 Score = 83.6 bits (205), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 49/167 (29%), Positives = 86/167 (51%), Gaps = 12/167 (7%)

Query: 6   KSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDT 65
           K+ ++ E ++   ++ SIVV  Y+G++VA++ DLRK++R+ G  ++V KN+++  A    
Sbjct: 12  KAKKVEEATESIKAASSIVVVDYRGLTVAEVTDLRKQLRDEGVKMQVIKNKVLVRAAEKA 71

Query: 66  SIRGISDLFVGQSLIVY-SDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIA 124
               + D F G + +V+ S+ PV  PKI  +F+  N+   + GGV++  V   D I   A
Sbjct: 72  GFDDLKDTFAGPTAVVFSSEDPVAGPKIVHNFAKSNDALELKGGVIDGKVATLDEINAYA 131

Query: 125 SLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQQ 171
           +LP  E +            + L  +L  P       + A  DK Q+
Sbjct: 132 ALPSREEL-----------LSTLANILQAPVRNFAYGVKAIADKKQE 167


>gi|28377497|ref|NP_784389.1| ribosomal protein L10 [Lactobacillus plantarum WCFS1]
 gi|254555727|ref|YP_003062144.1| ribosomal protein L10 [Lactobacillus plantarum JDM1]
 gi|308179708|ref|YP_003923836.1| 50S ribosomal protein L10 [Lactobacillus plantarum subsp. plantarum
           ST-III]
 gi|38258542|sp|Q88YW8|RL10_LACPL RecName: Full=50S ribosomal protein L10
 gi|28270329|emb|CAD63230.1| ribosomal protein L10 [Lactobacillus plantarum WCFS1]
 gi|254044654|gb|ACT61447.1| ribosomal protein L10 [Lactobacillus plantarum JDM1]
 gi|308045199|gb|ADN97742.1| 50S ribosomal protein L10 [Lactobacillus plantarum subsp. plantarum
           ST-III]
          Length = 167

 Score = 83.6 bits (205), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 47/141 (33%), Positives = 85/141 (60%), Gaps = 7/141 (4%)

Query: 6   KSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDT 65
           K+ E+ E+++   SS S +V  Y+G++V Q+ DLRK++REAG  ++V KN   KI +R  
Sbjct: 9   KAQEVEEVAEQLKSSVSAIVVDYRGLTVEQVTDLRKQLREAGVKMRVIKN---KIMVRAA 65

Query: 66  SIRGISDL---FVGQSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIK 121
              G  DL   F G + + +S+   +AP KI  +F+   +  ++ GGV+E  V + ++++
Sbjct: 66  DKAGFEDLKPVFAGPTAVAFSEEDPVAPAKILANFAKTADALQLKGGVIEGKVADLETVQ 125

Query: 122 QIASLPDLEGIRAGIISAIQS 142
           + A++P  E + A I + +Q+
Sbjct: 126 EYATMPSREELLATIANLLQA 146


>gi|167627267|ref|YP_001677767.1| 50S ribosomal protein L10 [Francisella philomiragia subsp.
           philomiragia ATCC 25017]
 gi|241667823|ref|ZP_04755401.1| 50S ribosomal protein L10 [Francisella philomiragia subsp.
           philomiragia ATCC 25015]
 gi|254876366|ref|ZP_05249076.1| 50S ribosomal protein L10 [Francisella philomiragia subsp.
           philomiragia ATCC 25015]
 gi|189040916|sp|B0TX08|RL10_FRAP2 RecName: Full=50S ribosomal protein L10
 gi|167597268|gb|ABZ87266.1| 50S ribosomal protein L10 [Francisella philomiragia subsp.
           philomiragia ATCC 25017]
 gi|254842387|gb|EET20801.1| 50S ribosomal protein L10 [Francisella philomiragia subsp.
           philomiragia ATCC 25015]
          Length = 172

 Score = 83.6 bits (205), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 50/165 (30%), Positives = 87/165 (52%), Gaps = 1/165 (0%)

Query: 4   QGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIR 63
           + K   ++E+++  SS+ S  VA Y+G++V ++  LRK+ RE+G  ++V +N L ++AI+
Sbjct: 6   EDKKAIVAEVAEQVSSALSAAVADYRGLTVNEMTSLRKQARESGVYLRVVRNNLARLAIK 65

Query: 64  DTSIRGISDLFVGQSLIVYS-DSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQ 122
            T    + D   G  ++  S D P  A K+  SF  D+N F V    +   +   + +  
Sbjct: 66  GTDFECLGDALKGPLVLALSKDEPGAAAKLFKSFQKDHNAFEVKNLAMSGELFGPEKLDD 125

Query: 123 IASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVD 167
            A LP  E   A +++ +Q+  T+ VR L    +Q VR  +A  D
Sbjct: 126 FAKLPTREEALATLLNVMQAPVTKFVRTLNEIPSQAVRVFAAVGD 170


>gi|94266152|ref|ZP_01289864.1| Ribosomal protein L10 [delta proteobacterium MLMS-1]
 gi|93453267|gb|EAT03716.1| Ribosomal protein L10 [delta proteobacterium MLMS-1]
          Length = 203

 Score = 83.6 bits (205), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 52/173 (30%), Positives = 92/173 (53%), Gaps = 3/173 (1%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           + R  K   + EL   F+ +   V+A Y+G++V+ ++ LR+++R     +KVAKN L+  
Sbjct: 30  LKRSEKEEVVRELGDKFARAKFAVLADYRGLTVSAMQSLRRELRSNSAEIKVAKNTLLNR 89

Query: 61  AIRDTSIRGISDLFVGQS-LIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
           A++ T    +     G + L + +D PV   K  V F+ DN +  + G V+E   L  D 
Sbjct: 90  AVQGTPFEPLQAHLQGSTALTLANDDPVAPAKALVKFAKDNPKLEIKGAVLEGKALTADD 149

Query: 120 IKQIASLPDLEGIRAGIISAIQSNATRLVRLL-GTPQTQVVRAISAFVDKNQQ 171
           +  ++ LP  + +RA ++  + +  T LVR+L G PQ + V  + A  D+ +Q
Sbjct: 150 LVALSKLPGRDELRAQLLGVLNAVPTGLVRVLNGVPQ-KAVYLLQAIKDQKEQ 201


>gi|229170950|ref|ZP_04298551.1| 50S ribosomal protein L10 [Bacillus cereus MM3]
 gi|228612490|gb|EEK69711.1| 50S ribosomal protein L10 [Bacillus cereus MM3]
          Length = 166

 Score = 83.6 bits (205), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 41/134 (30%), Positives = 78/134 (58%), Gaps = 1/134 (0%)

Query: 10  ISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRG 69
           ++E++     S S +V  Y+G++V+++ +LRK +REAG   KV KN L + A     +  
Sbjct: 12  VTEIADKLRGSKSTIVVDYRGLTVSEVTELRKNLREAGVEFKVYKNSLTRRAAESAEMAE 71

Query: 70  ISDLFVGQSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASLPD 128
           +++   G + I +S+  V+AP K+   F+  +    +  GV+E  ++  D +K IA+LP 
Sbjct: 72  LNEFLTGPNAIAFSNEDVVAPAKVLNDFATKHEALEIKAGVIEGKLVTLDEVKAIATLPS 131

Query: 129 LEGIRAGIISAIQS 142
            EG+ + ++S +Q+
Sbjct: 132 REGLLSMLLSVLQA 145


>gi|218438011|ref|YP_002376340.1| 50S ribosomal protein L10 [Cyanothece sp. PCC 7424]
 gi|226699933|sp|B7KIR6|RL10_CYAP7 RecName: Full=50S ribosomal protein L10
 gi|218170739|gb|ACK69472.1| ribosomal protein L10 [Cyanothece sp. PCC 7424]
          Length = 178

 Score = 83.6 bits (205), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 56/172 (32%), Positives = 93/172 (54%), Gaps = 4/172 (2%)

Query: 2   NRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIA 61
            R+ K   +++L ++   S   V+  Y+G+SVA+I DLR+++R  GG  K+AKN LV+IA
Sbjct: 4   TRENKEDVVADLKELLKESQLAVIIDYQGLSVAEITDLRRRIRPVGGTCKIAKNTLVRIA 63

Query: 62  IR-DTSIRGISDLFVGQS--LIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQD 118
           +  D + + + +   G S  L+V  D   I  K   SF  D+ +  + GGV+E   L +D
Sbjct: 64  VDGDQNWQPMQEYLKGSSAVLLVQEDVGGIV-KAYKSFQKDSKKTELRGGVMEGRSLTKD 122

Query: 119 SIKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQ 170
            ++ +A LP  E + A I  AI S   ++   +    + V R + A+ +K Q
Sbjct: 123 QVEALADLPSKEQLYAQIAGAINSITAKIAIGIKEVPSSVARGLQAYSEKEQ 174


>gi|86739284|ref|YP_479684.1| 50S ribosomal protein L10 [Frankia sp. CcI3]
 gi|123737803|sp|Q2JFI7|RL10_FRASC RecName: Full=50S ribosomal protein L10
 gi|86566146|gb|ABD09955.1| LSU ribosomal protein L10P [Frankia sp. CcI3]
          Length = 187

 Score = 83.6 bits (205), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 52/171 (30%), Positives = 87/171 (50%), Gaps = 2/171 (1%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M +  K+  ++E+ + F  S + V+  Y+G++V+Q+ +LR+ + E G    V KN L KI
Sbjct: 1   MAKAEKTAAVAEIVEEFRGSTAAVLTEYRGLTVSQLTELRRALGE-GTRYSVVKNTLTKI 59

Query: 61  AIRDTSIRGISDLFVGQSLIVY-SDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
           A     + G+ DLFVG + + + S  PV A K    F+  N    + GG VE   +  D 
Sbjct: 60  AAEQAGVTGLDDLFVGPTAVAFVSGDPVEAAKGLRDFARANPALVLKGGFVEGKPMTADE 119

Query: 120 IKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQ 170
           I+++A L   E + A +  A++      V L   P +QV R   A  ++ +
Sbjct: 120 IRKLADLESREVLLAKLAGAMKGTLAGAVGLFAAPLSQVARLAEALREQRE 170


>gi|238785548|ref|ZP_04629529.1| 50S ribosomal protein L10 [Yersinia bercovieri ATCC 43970]
 gi|238713533|gb|EEQ05564.1| 50S ribosomal protein L10 [Yersinia bercovieri ATCC 43970]
          Length = 167

 Score = 83.2 bits (204), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 50/159 (31%), Positives = 90/159 (56%), Gaps = 2/159 (1%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           +N QGK   ++E+ ++   + S VVA  +G++V ++ +LRK  REAG  ++V +N L++ 
Sbjct: 3   LNLQGKQAIVAEVKEVAKGALSAVVADSRGVTVDKMTELRKAGREAGVHMQVVRNTLLRR 62

Query: 61  AIRDTSIRGISDLFVGQSLIVYS-DSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
            +  TS   + D FVG +LI +S + P  A ++  +F+ DN +F V     E  ++    
Sbjct: 63  IVEGTSFECLKDTFVGPTLIAFSTEHPGAAARLFKAFAKDNAKFEVKAAAFEGELIPAAQ 122

Query: 120 IKQIASLPDLEGIRAGIISAI-QSNATRLVRLLGTPQTQ 157
           I ++A+LP  E   A ++  + ++ A +LVR L   + Q
Sbjct: 123 IDRLATLPTYEEAIARLMGTMKEAAAGKLVRTLAALRDQ 161


>gi|284034029|ref|YP_003383960.1| 50S ribosomal protein L10 [Kribbella flavida DSM 17836]
 gi|283813322|gb|ADB35161.1| ribosomal protein L10 [Kribbella flavida DSM 17836]
          Length = 207

 Score = 83.2 bits (204), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 54/171 (31%), Positives = 86/171 (50%), Gaps = 6/171 (3%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVA--KNRLV 58
           M R  K+ +++EL++ F +S   V+  Y+G++VAQ++ LR  +   G  V  A  KN L 
Sbjct: 1   MARPDKAADVAELTENFRNSNGAVLTEYRGLTVAQLRQLRTTL---GDDVNYAVVKNTLT 57

Query: 59  KIAIRDTSIRGISDLFVGQSLIVY-SDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQ 117
           KIA +D  +     L  G S I +    PV+A K    F+  N    + GGV++   L  
Sbjct: 58  KIAAKDAGVESFDSLLQGPSAIAFIKGDPVVAAKGLRDFAKANPLLVIKGGVLDGKALGS 117

Query: 118 DSIKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDK 168
           D I ++A L   E + A +  A+++   + V L   P +Q  R  +A  DK
Sbjct: 118 DEINKLADLESREVLLAKLAGAMKAAPQQAVSLFAAPLSQAARLFAALQDK 168


>gi|83648861|ref|YP_437296.1| 50S ribosomal protein L10 [Hahella chejuensis KCTC 2396]
 gi|97181692|sp|Q2S903|RL10_HAHCH RecName: Full=50S ribosomal protein L10
 gi|83636904|gb|ABC32871.1| Ribosomal protein L10 [Hahella chejuensis KCTC 2396]
          Length = 176

 Score = 83.2 bits (204), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 46/170 (27%), Positives = 94/170 (55%), Gaps = 1/170 (0%)

Query: 4   QGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIR 63
           + K   ++E+++  S + S+V+A Y+G++  ++ +LR K R     ++V +N L + A+ 
Sbjct: 6   EDKKAIVAEVNETASKALSLVIADYRGVTSNKMSELRAKARAESVSLRVVRNTLARRAVE 65

Query: 64  DTSIRGISDLFVGQSLIVYS-DSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQ 122
            T      + FVG +++ +S + P  A ++   ++ +N++F +    V   +L  D I +
Sbjct: 66  GTEYECAREAFVGPTILAFSMEDPGAAARLLKDYAKENDKFEIKALAVGGEMLGADQIDR 125

Query: 123 IASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQQG 172
           +A LP  +   A ++S +Q+  T+L R L    ++V RA++A  DK Q+ 
Sbjct: 126 LAKLPTRDQALAMLMSVMQAPVTKLARTLNEIPSKVTRAVAAVRDKKQEA 175


>gi|169630956|ref|YP_001704605.1| 50S ribosomal protein L10 [Mycobacterium abscessus ATCC 19977]
 gi|226699978|sp|B1MH70|RL10_MYCA9 RecName: Full=50S ribosomal protein L10
 gi|169242923|emb|CAM63951.1| 50S ribosomal protein L10 [Mycobacterium abscessus]
          Length = 176

 Score = 83.2 bits (204), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 51/169 (30%), Positives = 87/169 (51%), Gaps = 2/169 (1%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M +  K   ++E+++ F  S + V+  Y+G+SV+ +  LR+ +  A     VAKN LVK 
Sbjct: 1   MAKTDKVTAVAEITEQFKDSTATVITEYRGLSVSALATLRRSLG-ASATYAVAKNTLVKR 59

Query: 61  AIRDTSIRGISDLFVGQSLIVY-SDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
           A  D  + G+ +LF G + I +    PV A K   +F+ DN    + GG ++   L+   
Sbjct: 60  AAADAGVEGLDELFAGPTAIAFIKGEPVDAAKAIKTFAKDNKALIIKGGYMDGRALSVAE 119

Query: 120 IKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDK 168
           +++IA L   E + A +  A++ N  +   L   P +QV R  +A  +K
Sbjct: 120 VERIADLESREVLLAKLAGAMKGNLNKAAGLFAAPASQVARLAAALQEK 168


>gi|56707312|ref|YP_169208.1| 50S ribosomal protein L10 [Francisella tularensis subsp. tularensis
           SCHU S4]
 gi|110669782|ref|YP_666339.1| 50S ribosomal protein L10 [Francisella tularensis subsp. tularensis
           FSC198]
 gi|118498138|ref|YP_899188.1| 50S ribosomal protein L10 [Francisella tularensis subsp. novicida
           U112]
 gi|134301351|ref|YP_001121319.1| 50S ribosomal protein L10 [Francisella tularensis subsp. tularensis
           WY96-3418]
 gi|208779449|ref|ZP_03246794.1| ribosomal protein L10, putative [Francisella novicida FTG]
 gi|224456376|ref|ZP_03664849.1| 50S ribosomal protein L10 [Francisella tularensis subsp. tularensis
           MA00-2987]
 gi|254373488|ref|ZP_04988976.1| 50S ribosomal protein L10 [Francisella tularensis subsp. novicida
           GA99-3549]
 gi|254374949|ref|ZP_04990430.1| ribosomal protein L10 [Francisella novicida GA99-3548]
 gi|254874148|ref|ZP_05246858.1| 50S ribosomal protein L10 [Francisella tularensis subsp. tularensis
           MA00-2987]
 gi|61214711|sp|Q5NID4|RL10_FRATT RecName: Full=50S ribosomal protein L10
 gi|123359633|sp|Q14JT7|RL10_FRAT1 RecName: Full=50S ribosomal protein L10
 gi|166229727|sp|A0Q869|RL10_FRATN RecName: Full=50S ribosomal protein L10
 gi|166229728|sp|A4IW97|RL10_FRATW RecName: Full=50S ribosomal protein L10
 gi|54114531|gb|AAV29899.1| NT02FT0277 [synthetic construct]
 gi|56603804|emb|CAG44775.1| 50S ribosomal protein L10 [Francisella tularensis subsp. tularensis
           SCHU S4]
 gi|110320115|emb|CAL08158.1| 50S ribosomal protein L10 [Francisella tularensis subsp. tularensis
           FSC198]
 gi|118424044|gb|ABK90434.1| 50S ribosomal protein L10 [Francisella novicida U112]
 gi|134049128|gb|ABO46199.1| ribosomal protein L10 [Francisella tularensis subsp. tularensis
           WY96-3418]
 gi|151571214|gb|EDN36868.1| 50S ribosomal protein L10 [Francisella novicida GA99-3549]
 gi|151572668|gb|EDN38322.1| ribosomal protein L10 [Francisella novicida GA99-3548]
 gi|208744410|gb|EDZ90709.1| ribosomal protein L10, putative [Francisella novicida FTG]
 gi|254840147|gb|EET18583.1| 50S ribosomal protein L10 [Francisella tularensis subsp. tularensis
           MA00-2987]
 gi|282158437|gb|ADA77828.1| 50S ribosomal protein L10 [Francisella tularensis subsp. tularensis
           NE061598]
          Length = 172

 Score = 83.2 bits (204), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 49/165 (29%), Positives = 88/165 (53%), Gaps = 1/165 (0%)

Query: 4   QGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIR 63
           + K   ++E+++  SS+ S  VA Y+G++V ++  LRK+ RE+G  ++V +N L ++AI+
Sbjct: 6   EDKKAIVAEVAEQVSSALSAAVADYRGLTVNEMTSLRKQARESGVYLRVVRNNLARLAIK 65

Query: 64  DTSIRGISDLFVGQSLIVYS-DSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQ 122
            T    ++D   G  ++  S D P  A K+  +F  D+N F V    +   +   + +  
Sbjct: 66  GTEFECLADALKGPLVLALSKDEPGAAAKLFKNFQKDHNAFEVKNLAMSGELFGPEKLDD 125

Query: 123 IASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVD 167
            A LP  E   A +++ +Q+  T+ VR L    +Q VR  +A  D
Sbjct: 126 FAKLPTREEALATLLNVMQAPVTKFVRTLNEIPSQAVRVFAAVGD 170


>gi|239636938|ref|ZP_04677936.1| 50S ribosomal protein L10 [Staphylococcus warneri L37603]
 gi|239597486|gb|EEQ79985.1| 50S ribosomal protein L10 [Staphylococcus warneri L37603]
 gi|330686271|gb|EGG97883.1| ribosomal protein L10 [Staphylococcus epidermidis VCU121]
          Length = 166

 Score = 83.2 bits (204), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 42/127 (33%), Positives = 75/127 (59%), Gaps = 1/127 (0%)

Query: 17  FSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRGISDLFVG 76
             +S S V+  Y+G++VA++ +LRK++REAG   KV KN +V+ A     I G+ +   G
Sbjct: 19  LKNSVSTVIVDYRGLTVAEVTELRKQLREAGVEYKVYKNTMVRRAAEKAGIEGLDEFLTG 78

Query: 77  QSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASLPDLEGIRAG 135
            + I  S   V+AP K+   F+ ++    V  GV+E  V++ + +K + SLP  +G+ + 
Sbjct: 79  PTAIATSTEDVVAPAKVIAGFAKEHEALEVKSGVMEGNVISAEEVKTVGSLPSHDGLVSM 138

Query: 136 IISAIQS 142
           ++S +Q+
Sbjct: 139 LLSVLQA 145


>gi|323339381|ref|ZP_08079666.1| 50S ribosomal protein L10 [Lactobacillus ruminis ATCC 25644]
 gi|323093204|gb|EFZ35791.1| 50S ribosomal protein L10 [Lactobacillus ruminis ATCC 25644]
          Length = 170

 Score = 83.2 bits (204), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 41/138 (29%), Positives = 80/138 (57%), Gaps = 1/138 (0%)

Query: 6   KSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDT 65
           K+  + E+ + FS++ S+VV  Y+G++V ++ +LRK++REAG  ++V KN  ++ A    
Sbjct: 12  KAAIVEEVFEKFSNASSVVVVDYRGLTVDEVTELRKELREAGVEMRVIKNTFLRRAADKA 71

Query: 66  SIRGISDLFVGQSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIA 124
              G+ + F G + + +      AP +I   F+ D+    + GG+++  V+  D I  +A
Sbjct: 72  GYEGLDETFTGPTAVAFGSEDATAPARIFSKFAEDHEALTIKGGMIDGEVVTLDEIHALA 131

Query: 125 SLPDLEGIRAGIISAIQS 142
            LP+ EG+ + + S +Q+
Sbjct: 132 KLPNREGMLSMLCSVLQA 149


>gi|183597455|ref|ZP_02958948.1| hypothetical protein PROSTU_00728 [Providencia stuartii ATCC 25827]
 gi|188023204|gb|EDU61244.1| hypothetical protein PROSTU_00728 [Providencia stuartii ATCC 25827]
          Length = 165

 Score = 83.2 bits (204), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 50/159 (31%), Positives = 89/159 (55%), Gaps = 2/159 (1%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           +N Q K   ++E+S++   + S VVA  +G++VA++ +LRK  REAG  ++V +N L++ 
Sbjct: 3   LNLQDKQAIVAEVSEVAKGALSAVVADSRGVTVAKMTELRKAGREAGVYIRVVRNTLIRR 62

Query: 61  AIRDTSIRGISDLFVGQSLIVYS-DSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
           A+  TS   + D FVG +LI +S + P  A ++   F+  N  F +     E  ++    
Sbjct: 63  AVEGTSYEVLKDAFVGPTLIAFSNEHPGAAARLFKEFAKANPAFEIKAAAFEGELIQAKD 122

Query: 120 IKQIASLPDLEGIRAGIISAIQSNAT-RLVRLLGTPQTQ 157
           I ++A+LP  E   A +++ ++  A  +LVR L   + Q
Sbjct: 123 IDRLATLPTYEEAIARLMATMKEAAAGKLVRTLAALRDQ 161


>gi|62263437|gb|AAX78160.1| unknown protein [synthetic construct]
          Length = 207

 Score = 83.2 bits (204), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 49/165 (29%), Positives = 88/165 (53%), Gaps = 1/165 (0%)

Query: 4   QGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIR 63
           + K   ++E+++  SS+ S  VA Y+G++V ++  LRK+ RE+G  ++V +N L ++AI+
Sbjct: 32  EDKKAIVAEVAEQVSSALSAAVADYRGLTVNEMTSLRKQARESGVYLRVVRNNLARLAIK 91

Query: 64  DTSIRGISDLFVGQSLIVYS-DSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQ 122
            T    ++D   G  ++  S D P  A K+  +F  D+N F V    +   +   + +  
Sbjct: 92  GTEFECLADALKGPLVLALSKDEPGAAAKLFKNFQKDHNAFEVKNLAMSGELFGPEKLDD 151

Query: 123 IASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVD 167
            A LP  E   A +++ +Q+  T+ VR L    +Q VR  +A  D
Sbjct: 152 FAKLPTREEALATLLNVMQAPVTKFVRTLNEIPSQAVRVFAAVGD 196


>gi|229083419|ref|ZP_04215767.1| 50S ribosomal protein L10 [Bacillus cereus Rock3-44]
 gi|228699852|gb|EEL52489.1| 50S ribosomal protein L10 [Bacillus cereus Rock3-44]
          Length = 166

 Score = 83.2 bits (204), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 41/134 (30%), Positives = 78/134 (58%), Gaps = 1/134 (0%)

Query: 10  ISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRG 69
           ++E++     S S +V  Y+G++V++  +LRK +REAG   KV KN L + A     +  
Sbjct: 12  VTEIADKLRESKSTIVVDYRGLTVSEATELRKNLREAGVEFKVYKNSLTRRAAESVEMAE 71

Query: 70  ISDLFVGQSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASLPD 128
           +++   G + I +S+  V+AP K+   F+ ++    +  GV+E  ++  D +K IA+LP 
Sbjct: 72  LNEFLTGPNAIAFSNEDVVAPAKVLNDFAKNHEALEIKAGVIEGKLVTLDEVKAIATLPS 131

Query: 129 LEGIRAGIISAIQS 142
            EG+ + ++S +Q+
Sbjct: 132 REGLLSMLLSVLQA 145


>gi|196233596|ref|ZP_03132437.1| ribosomal protein L10 [Chthoniobacter flavus Ellin428]
 gi|196222266|gb|EDY16795.1| ribosomal protein L10 [Chthoniobacter flavus Ellin428]
          Length = 174

 Score = 83.2 bits (204), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 50/170 (29%), Positives = 91/170 (53%), Gaps = 2/170 (1%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M    K+  + +L +  ++S  + VA Y G+ V Q  +LR ++   G    V KN  ++ 
Sbjct: 1   MPHPAKATIVDDLQQKLNASPFLFVADYTGLKVGQFAELRNRLHNTGARCHVVKNTFLRR 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
           A ++  +  +++ F GQ+ I+  D  V A  K+  +FS +  +  V  G+V+K V++ D 
Sbjct: 61  AAKEAGLPELAE-FKGQTAIIVGDKDVAAAAKVLKTFSAEFKKPEVKTGIVDKMVVSTDQ 119

Query: 120 IKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKN 169
           IK IA LP  E + A  +  + + A++LVR+L  P + + R + A  +K+
Sbjct: 120 IKAIADLPSREVLLATFLGVLNAPASKLVRVLNEPASSLARLLKAKAEKD 169


>gi|148657434|ref|YP_001277639.1| 50S ribosomal protein L10 [Roseiflexus sp. RS-1]
 gi|166230066|sp|A5UYI6|RL10_ROSS1 RecName: Full=50S ribosomal protein L10
 gi|148569544|gb|ABQ91689.1| LSU ribosomal protein L10P [Roseiflexus sp. RS-1]
          Length = 186

 Score = 83.2 bits (204), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 54/166 (32%), Positives = 85/166 (51%), Gaps = 3/166 (1%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M  Q K   +++L +        VVA Y+G+SVA + +LRKK+RE+G    VAKN L  I
Sbjct: 1   MPTQRKIETVADLKQRLKRMQVTVVADYRGLSVADMTELRKKLRESGAEFVVAKNTLTLI 60

Query: 61  AIRDTSIRGISDLFVGQSLI--VYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQD 118
           A R+T    I  L  G + +   Y D P     I+  F+    +  V GG+V   +LN++
Sbjct: 61  AARETGHEAIEPLLAGPTALAFAYDDVPKFVKAIN-EFNRGPKKIIVRGGLVGTMLLNEN 119

Query: 119 SIKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISA 164
            +  +ASLP  E +RA ++  + +  T L  ++  P   +V  + A
Sbjct: 120 VLDTVASLPTKEEVRAQVLGGLAAPVTGLAGIIAAPVNDIVNLLDA 165


>gi|300172661|ref|YP_003771826.1| 50S ribosomal protein L10 [Leuconostoc gasicomitatum LMG 18811]
 gi|299887039|emb|CBL91007.1| 50S ribosomal protein L10 [Leuconostoc gasicomitatum LMG 18811]
          Length = 186

 Score = 83.2 bits (204), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 44/137 (32%), Positives = 80/137 (58%), Gaps = 1/137 (0%)

Query: 6   KSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDT 65
           K+ ++ E++  F ++ S VV   +G++VAQ  DLR ++R+ G  ++V KN+++  A    
Sbjct: 9   KAQKVEEIADQFKNAASAVVVDARGLTVAQSTDLRHQLRQEGVVLEVIKNKILTRAAEKA 68

Query: 66  SIRGISDLFVGQSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIA 124
               ++D+F G S + +S+   IAP +I   F++ N +  + GGVV+  + N D I + A
Sbjct: 69  GFAELNDIFAGPSAVAFSNDDAIAPSRILKKFADANEKLEIKGGVVDGNIANLDDINKYA 128

Query: 125 SLPDLEGIRAGIISAIQ 141
           SLP  EG+   +++  Q
Sbjct: 129 SLPSREGLFGQLLAEFQ 145


>gi|156935817|ref|YP_001439733.1| 50S ribosomal protein L10 [Cronobacter sakazakii ATCC BAA-894]
 gi|166229725|sp|A7MQP7|RL10_ENTS8 RecName: Full=50S ribosomal protein L10
 gi|156534071|gb|ABU78897.1| hypothetical protein ESA_03693 [Cronobacter sakazakii ATCC BAA-894]
          Length = 165

 Score = 83.2 bits (204), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 50/154 (32%), Positives = 88/154 (57%), Gaps = 2/154 (1%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           +N Q K   ++E+S++   + S VVA  +G++V ++ +LRK  REAG  ++V +N L++ 
Sbjct: 3   LNLQDKQAIVAEVSEVAKGALSAVVADSRGVTVDKMTELRKAGREAGVYMRVVRNTLLRR 62

Query: 61  AIRDTSIRGISDLFVGQSLIVYS-DSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
           A+  T+   + D FVG +LI YS + P  A ++   F+  N +F V     E  ++    
Sbjct: 63  AVEGTAFECLKDAFVGPTLIAYSMEHPGAAARLFKEFAKANAKFEVKAAAFEGELIPASQ 122

Query: 120 IKQIASLPDLEGIRAGIISAI-QSNATRLVRLLG 152
           I ++A+LP  E   A ++S + ++ A +LVR L 
Sbjct: 123 IDRLATLPTYEEAIARLMSTMKEAAAGKLVRTLA 156


>gi|123440673|ref|YP_001004666.1| 50S ribosomal protein L10 [Yersinia enterocolitica subsp.
           enterocolitica 8081]
 gi|332159910|ref|YP_004296487.1| 50S ribosomal protein L10 [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|166230089|sp|A1JIH8|RL10_YERE8 RecName: Full=50S ribosomal protein L10
 gi|122087634|emb|CAL10416.1| 50S ribosomal protein L10 [Yersinia enterocolitica subsp.
           enterocolitica 8081]
 gi|318607540|emb|CBY29038.1| LSU ribosomal protein L10p (P0) [Yersinia enterocolitica subsp.
           palearctica Y11]
 gi|325664140|gb|ADZ40784.1| 50S ribosomal protein L10 [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|330863589|emb|CBX73701.1| 50S ribosomal protein L10 [Yersinia enterocolitica W22703]
          Length = 167

 Score = 82.8 bits (203), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 50/159 (31%), Positives = 89/159 (55%), Gaps = 2/159 (1%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           +N QGK   ++E+ ++   + S VVA  +G++V ++ +LRK  REAG  ++V +N L+  
Sbjct: 3   LNLQGKQAIVAEVKEVAKGALSAVVADSRGVTVDKMTELRKAGREAGVHMQVVRNTLLSR 62

Query: 61  AIRDTSIRGISDLFVGQSLIVY-SDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
           A+  T    + D FVG +LI + S+ P  A ++  +F+ DN +F V     E  ++    
Sbjct: 63  AVEGTPFECLKDTFVGPTLIAFSSEHPGAAARLFKAFAKDNAKFEVKAAAFEGELIPAAQ 122

Query: 120 IKQIASLPDLEGIRAGIISAI-QSNATRLVRLLGTPQTQ 157
           I ++A+LP  E   A ++  + ++ A +LVR L   + Q
Sbjct: 123 IDRLATLPTYEEAIARLMGTMKEAAAGKLVRTLAALRDQ 161


>gi|325982734|ref|YP_004295136.1| 50S ribosomal protein L10 [Nitrosomonas sp. AL212]
 gi|325532253|gb|ADZ26974.1| 50S ribosomal protein L10 [Nitrosomonas sp. AL212]
          Length = 171

 Score = 82.8 bits (203), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 49/167 (29%), Positives = 91/167 (54%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           +N + K   ++E+S   S++ +I++A Y+G+ V Q+  LR K RE+G   +V KN LV+ 
Sbjct: 3   LNLEEKKAIVAEVSIRISNAQAIIIAEYRGLEVGQLTQLRAKTRESGIYFRVIKNSLVRR 62

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A+ DT    ++   VG  +      PV A K+   FS  N++F +  G +   V+++D I
Sbjct: 63  AVADTPYAELAKHMVGPLVYGIGTDPVAAAKVLHEFSKGNDKFVIKVGAIGNQVISRDEI 122

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVD 167
             +A+LP  + + + ++  +Q+   + V+ L    T+ VR ++   D
Sbjct: 123 TALAALPSRDELLSKLLGTMQAPIAKFVQTLNEVPTRFVRGLAMVRD 169


>gi|27467221|ref|NP_763858.1| 50S ribosomal protein L10 [Staphylococcus epidermidis ATCC 12228]
 gi|57866131|ref|YP_187776.1| 50S ribosomal protein L10 [Staphylococcus epidermidis RP62A]
 gi|242241871|ref|ZP_04796316.1| 50S ribosomal protein L10 [Staphylococcus epidermidis W23144]
 gi|251809956|ref|ZP_04824429.1| 50S ribosomal protein L10 [Staphylococcus epidermidis BCM-HMP0060]
 gi|282875010|ref|ZP_06283885.1| ribosomal protein L10 [Staphylococcus epidermidis SK135]
 gi|293367915|ref|ZP_06614553.1| 50S ribosomal protein L10 [Staphylococcus epidermidis
           M23864:W2(grey)]
 gi|29336636|sp|Q8CTT2|RL10_STAES RecName: Full=50S ribosomal protein L10
 gi|73914068|sp|Q5HRL3|RL10_STAEQ RecName: Full=50S ribosomal protein L10
 gi|27314763|gb|AAO03900.1|AE016744_303 50S ribosomal protein L10 [Staphylococcus epidermidis ATCC 12228]
 gi|57636789|gb|AAW53577.1| ribosomal protein L10 [Staphylococcus epidermidis RP62A]
 gi|242234649|gb|EES36961.1| 50S ribosomal protein L10 [Staphylococcus epidermidis W23144]
 gi|251806499|gb|EES59156.1| 50S ribosomal protein L10 [Staphylococcus epidermidis BCM-HMP0060]
 gi|281296338|gb|EFA88857.1| ribosomal protein L10 [Staphylococcus epidermidis SK135]
 gi|291317944|gb|EFE58352.1| 50S ribosomal protein L10 [Staphylococcus epidermidis
           M23864:W2(grey)]
 gi|319399712|gb|EFV87961.1| ribosomal L10 family protein [Staphylococcus epidermidis FRI909]
 gi|329729442|gb|EGG65845.1| ribosomal protein L10 [Staphylococcus epidermidis VCU144]
 gi|329734668|gb|EGG70975.1| ribosomal protein L10 [Staphylococcus epidermidis VCU028]
 gi|329738063|gb|EGG74284.1| ribosomal protein L10 [Staphylococcus epidermidis VCU045]
          Length = 166

 Score = 82.8 bits (203), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 42/140 (30%), Positives = 81/140 (57%), Gaps = 1/140 (0%)

Query: 4   QGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIR 63
           + K  ++  +++   +S S V+  Y+G++VA++ +LR ++REAG   KV KN +V+ A  
Sbjct: 6   EAKKQQVDTIAEQLKNSVSTVIVDYRGLTVAEVTELRSQLREAGVEYKVYKNTMVRRAAE 65

Query: 64  DTSIRGISDLFVGQSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQ 122
              I G+ +   G + I  S   V+AP K+   F+ ++    V  GV+E  V++ + +K 
Sbjct: 66  QAGIEGLDEFLTGPTAIATSTEDVVAPAKVIAGFAKEHEALEVKTGVMEGNVISAEEVKT 125

Query: 123 IASLPDLEGIRAGIISAIQS 142
           + SLP  +G+ + ++S +Q+
Sbjct: 126 VGSLPSHDGLVSMLLSVLQA 145


>gi|218290026|ref|ZP_03494193.1| ribosomal protein L10 [Alicyclobacillus acidocaldarius LAA1]
 gi|218239860|gb|EED07048.1| ribosomal protein L10 [Alicyclobacillus acidocaldarius LAA1]
          Length = 170

 Score = 82.8 bits (203), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 47/133 (35%), Positives = 73/133 (54%), Gaps = 1/133 (0%)

Query: 20  SGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRGISDLFVGQSL 79
           S SIV+A Y+G++VA+  +LR ++R+AG    V KN L   A +   I G+     G + 
Sbjct: 22  SKSIVLADYRGLTVAEDTELRARLRQAGIDYSVVKNTLTTRAAQQAEIEGLEPFLTGPTA 81

Query: 80  IVYS-DSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASLPDLEGIRAGIIS 138
           I +S D PV   KI   FS D+    + GG VE  V++   I+ +A LP  EG+ + ++S
Sbjct: 82  IAFSYDDPVAPAKILHEFSRDHKALELKGGYVEGKVVDAKEIEALAKLPSREGLLSMLLS 141

Query: 139 AIQSNATRLVRLL 151
            +Q+    L  +L
Sbjct: 142 VLQAPMRNLAYVL 154


>gi|297624695|ref|YP_003706129.1| 50S ribosomal protein L10 [Truepera radiovictrix DSM 17093]
 gi|297165875|gb|ADI15586.1| ribosomal protein L10 [Truepera radiovictrix DSM 17093]
          Length = 179

 Score = 82.8 bits (203), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 47/162 (29%), Positives = 91/162 (56%), Gaps = 3/162 (1%)

Query: 10  ISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRG 69
           ++EL ++     +  +  Y+G+S  QI  LR+K+R+AGG + VAKN LV + +++  + G
Sbjct: 10  VAELRELLGDVKTFFLVDYQGLSAEQIGALRRKLRDAGGRLLVAKNTLVNVVLKEQGVTG 69

Query: 70  ISDLFVGQS-LIVYSDSPVIAPKISVSFSNDN-NEFRVL-GGVVEKGVLNQDSIKQIASL 126
           + D   G + L++  D PV   K    FS D+ N+  V  GG+++  V+  D++ +IA L
Sbjct: 70  LEDQLKGPTALVLVGDDPVTPAKAVTDFSKDHPNDLPVAKGGLLQGAVIGSDALSKIAKL 129

Query: 127 PDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDK 168
           P  + + + ++  +Q+   +LV +L      +V  ++ + +K
Sbjct: 130 PARDQLLSELVGVLQAPLQQLVGVLDAAPRNLVSVMTNYSEK 171


>gi|223042866|ref|ZP_03612914.1| 50S ribosomal protein L10 [Staphylococcus capitis SK14]
 gi|314932763|ref|ZP_07840132.1| ribosomal protein L10 [Staphylococcus caprae C87]
 gi|222443720|gb|EEE49817.1| 50S ribosomal protein L10 [Staphylococcus capitis SK14]
 gi|313654444|gb|EFS18197.1| ribosomal protein L10 [Staphylococcus caprae C87]
          Length = 166

 Score = 82.8 bits (203), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 42/140 (30%), Positives = 81/140 (57%), Gaps = 1/140 (0%)

Query: 4   QGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIR 63
           + K  ++  +++   +S S V+  Y+G++VA++ +LR ++REAG   KV KN +V+ A  
Sbjct: 6   EAKKQQVDTIAEQLKNSVSTVIVDYRGLTVAEVTELRSQLREAGVEYKVYKNTMVRRAAE 65

Query: 64  DTSIRGISDLFVGQSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQ 122
              I G+ +   G + I  S   V+AP K+   F+ ++    V  GV+E  V++ + +K 
Sbjct: 66  QAGIEGLDEFLTGPTAIATSTEDVVAPAKVIAGFAKEHEALEVKTGVMEGSVISAEEVKT 125

Query: 123 IASLPDLEGIRAGIISAIQS 142
           + SLP  +G+ + ++S +Q+
Sbjct: 126 VGSLPSHDGLVSMLLSVLQA 145


>gi|226328682|ref|ZP_03804200.1| hypothetical protein PROPEN_02577 [Proteus penneri ATCC 35198]
 gi|225201868|gb|EEG84222.1| hypothetical protein PROPEN_02577 [Proteus penneri ATCC 35198]
          Length = 165

 Score = 82.8 bits (203), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 50/159 (31%), Positives = 91/159 (57%), Gaps = 2/159 (1%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           +N Q K   ++E+S++   + S VVA  +G++VA++ +LRK  REAG  V+V +N L++ 
Sbjct: 3   LNLQDKQAIVAEVSEVAKGALSAVVADSRGVTVAKMTELRKACREAGVTVRVVRNTLLRR 62

Query: 61  AIRDTSIRGISDLFVGQSLIVYS-DSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
           A+  TS   + D FVG +LI +S + P  A ++   F+  N  F +     E   +   +
Sbjct: 63  AVEGTSYEVLKDAFVGPTLIAFSAEHPGAAARLFKDFAKANPAFEIKAAAFEGEFIPGSN 122

Query: 120 IKQIASLPDLEGIRAGIISAI-QSNATRLVRLLGTPQTQ 157
           I ++A+LP  +   A +++ + +++A +LVR L   + Q
Sbjct: 123 IDRLATLPTYDEAIARLMATMKEASAGKLVRTLAALRDQ 161


>gi|308047971|ref|YP_003911537.1| 50S ribosomal protein L10P [Ferrimonas balearica DSM 9799]
 gi|307630161|gb|ADN74463.1| LSU ribosomal protein L10P [Ferrimonas balearica DSM 9799]
          Length = 167

 Score = 82.8 bits (203), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 51/159 (32%), Positives = 89/159 (55%), Gaps = 2/159 (1%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           MN +GK   ++E+++    + S VVA  +G++V ++  LRK+ REAG  ++V +N L K 
Sbjct: 3   MNLEGKKAIVAEVNEAAKGALSAVVADCRGVTVGKMTSLRKQAREAGVVMRVVRNTLAKR 62

Query: 61  AIRDTSIRGISDLFVGQSLIVYS-DSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
           A+  TS   +SD FVG +LI +S + P  A ++   F+ +   F V     E  ++  + 
Sbjct: 63  AVEGTSYECLSDAFVGPTLIAFSIEHPGAAARLFKDFAKEEQAFEVKALAYEGELIPAEQ 122

Query: 120 IKQIASLPDL-EGIRAGIISAIQSNATRLVRLLGTPQTQ 157
           I ++A LP   E I   +++  +++A +LVR L   + Q
Sbjct: 123 IDRLAKLPTYDEAIAQLMMTMKEASAGKLVRTLAALRDQ 161


>gi|150015034|ref|YP_001307288.1| 50S ribosomal protein L10 [Clostridium beijerinckii NCIMB 8052]
 gi|149901499|gb|ABR32332.1| ribosomal protein L10 [Clostridium beijerinckii NCIMB 8052]
          Length = 167

 Score = 82.8 bits (203), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 45/151 (29%), Positives = 89/151 (58%), Gaps = 1/151 (0%)

Query: 2   NRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIA 61
           NR+ K  +++E+ +    S ++V++ Y+G++V +   LRK +REAG   KV KN LV +A
Sbjct: 4   NRELKEAKVAEIKEKLEKSKAVVLSKYQGLNVEEDTALRKSLREAGVEYKVYKNTLVTLA 63

Query: 62  IRDTSIRGISDLFVGQSLIVYSDSPV-IAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
            ++  + GI++   G   I +S   V +A ++   F+ D+ +  +  G++E  + ++  I
Sbjct: 64  AKELGLDGIAEYLEGAVSIAFSYEDVTLAARLLNDFAKDHKKLELKAGIIEGEIYDEAKI 123

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLL 151
           KQ+A++P  E + A ++ +I+S  +   R+L
Sbjct: 124 KQLATIPSKEVLIAKLLGSIKSPISSFARVL 154


>gi|329296851|ref|ZP_08254187.1| 50S ribosomal protein L10 [Plautia stali symbiont]
          Length = 165

 Score = 82.8 bits (203), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 50/154 (32%), Positives = 86/154 (55%), Gaps = 2/154 (1%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           +N QGK   ++E+S++   + S VVA  +G++V ++ +LRK  REAG  ++V +N L++ 
Sbjct: 3   LNLQGKQAIVAEVSEVAKGALSAVVADSRGVTVDKMTELRKAGREAGVYMRVVRNTLLRR 62

Query: 61  AIRDTSIRGISDLFVGQSLIVYS-DSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
            +  T    + D FVG +LI YS + P  A ++   F+  N  F V     E  ++    
Sbjct: 63  VVEGTPFECLKDTFVGPTLIAYSMEYPGAAARLFKEFAKANANFEVKAAAFEGELIPAAQ 122

Query: 120 IKQIASLPDLEGIRAGIISAI-QSNATRLVRLLG 152
           I ++A+LP  E   A ++S + ++ A +LVR L 
Sbjct: 123 IDRLATLPTYEEALARLMSTMKEAAAGKLVRTLA 156


>gi|325261299|ref|ZP_08128037.1| ribosomal protein L10 [Clostridium sp. D5]
 gi|324032753|gb|EGB94030.1| ribosomal protein L10 [Clostridium sp. D5]
          Length = 194

 Score = 82.8 bits (203), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 46/143 (32%), Positives = 80/143 (55%), Gaps = 1/143 (0%)

Query: 10  ISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRG 69
           +  +S+    + S+V+  Y+G++VAQ  +LRK++REAG   KV KN ++K AI  T   G
Sbjct: 11  VEAISEEIKDAQSVVLVDYRGLTVAQDTELRKQLREAGIIYKVYKNTMIKRAIEGTEFEG 70

Query: 70  ISDLFVGQSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASLPD 128
           ++D   G S I  S     AP +I   F+ D  +  + GGVVE  V +   + +++ +P 
Sbjct: 71  LTDCLEGPSAIAISKEDATAPARIICKFAKDAQKLELKGGVVEGNVYDVAGLTELSKIPS 130

Query: 129 LEGIRAGIISAIQSNATRLVRLL 151
            + + + ++ +IQS  T   R++
Sbjct: 131 RDELLSKLLGSIQSPITNFARVI 153


>gi|227505177|ref|ZP_03935226.1| 50S ribosomal protein L10 [Corynebacterium striatum ATCC 6940]
 gi|227198226|gb|EEI78274.1| 50S ribosomal protein L10 [Corynebacterium striatum ATCC 6940]
          Length = 173

 Score = 82.8 bits (203), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 50/165 (30%), Positives = 88/165 (53%), Gaps = 6/165 (3%)

Query: 7   SVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVK--VAKNRLVKIAIRD 64
           + +++EL +  + + SIV+  Y+G++V+Q+++LR  +   G  V+  VAKN L KIA  +
Sbjct: 7   TADLAELKEKLAGAESIVLTEYRGLTVSQLQELRNNL---GFDVEYSVAKNTLFKIAANE 63

Query: 65  TSIRGISDLFVGQSLIVY-SDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQI 123
             I G+ D   G + I +     V A K+   F++DN  F V GG ++   L  + +  I
Sbjct: 64  AGIEGLDDKLTGPTAIAFIKGEAVDAAKVIKKFADDNKAFVVKGGYMDGNALTAEQVAAI 123

Query: 124 ASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDK 168
           A L + E   A +  A++ +  +   +   P T++VR  +A  DK
Sbjct: 124 AELDNRETTLAKLAGAMKGSMAKAAAVFNAPATKMVRTAAALQDK 168


>gi|312141013|ref|YP_004008349.1| 50S ribosomal protein l10 rplj [Rhodococcus equi 103S]
 gi|325675350|ref|ZP_08155034.1| 50S ribosomal protein L10 [Rhodococcus equi ATCC 33707]
 gi|311890352|emb|CBH49670.1| 50S ribosomal protein L10 RplJ [Rhodococcus equi 103S]
 gi|325553321|gb|EGD22999.1| 50S ribosomal protein L10 [Rhodococcus equi ATCC 33707]
          Length = 185

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 54/166 (32%), Positives = 86/166 (51%), Gaps = 2/166 (1%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M +  K   ++E+++ F  S + V+  Y+G+SV  +  LR+ + E G    VAKN LVK 
Sbjct: 1   MAKPEKVSAVAEITEQFKDSTAAVITEYRGLSVTSLTQLRRALGE-GATYSVAKNTLVKR 59

Query: 61  AIRDTSIRGISDLFVGQSLIVY-SDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
           A  +  + G+ DLFVG + I +    PV A K   +F+ DN    + GG ++   L+ D 
Sbjct: 60  AAAEAGVEGLDDLFVGPTAIAFIKGEPVDAAKAIKAFAKDNKALVIKGGYMDGAALSVDQ 119

Query: 120 IKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAF 165
           + QIA L   E + A +  A++ N  +   L   P +QV R  +A 
Sbjct: 120 VNQIADLESREILLAKLAGAMKGNLAKAAGLFNAPASQVARLAAAL 165


>gi|319891503|ref|YP_004148378.1| LSU ribosomal protein L10p (P0) [Staphylococcus pseudintermedius
           HKU10-03]
 gi|317161199|gb|ADV04742.1| LSU ribosomal protein L10p (P0) [Staphylococcus pseudintermedius
           HKU10-03]
 gi|323465325|gb|ADX77478.1| ribosomal protein L10 [Staphylococcus pseudintermedius ED99]
          Length = 166

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 38/122 (31%), Positives = 72/122 (59%), Gaps = 1/122 (0%)

Query: 22  SIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRGISDLFVGQSLIV 81
           S VV  Y+G++VA++ +LRK++REA    KV KN +++ A     I G+ +   G + + 
Sbjct: 24  STVVVDYRGLTVAEVTELRKQLREANVQYKVYKNTMLRRAAEKAGIEGLDEFLTGPTAVA 83

Query: 82  YSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASLPDLEGIRAGIISAI 140
           ++   V+AP K+   F+ ++    +  G++E  V+  D +K + SLP  EG+ + ++S +
Sbjct: 84  FTTEDVVAPAKVIAGFAKEHEALEIKSGIMEGSVITADEVKTVGSLPSHEGLVSMLLSVL 143

Query: 141 QS 142
           Q+
Sbjct: 144 QA 145


>gi|242372757|ref|ZP_04818331.1| 50S ribosomal protein L10 [Staphylococcus epidermidis M23864:W1]
 gi|242349530|gb|EES41131.1| 50S ribosomal protein L10 [Staphylococcus epidermidis M23864:W1]
          Length = 166

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 42/140 (30%), Positives = 81/140 (57%), Gaps = 1/140 (0%)

Query: 4   QGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIR 63
           + K  ++  +++   +S S V+  Y+G++VA++ +LR ++REAG   KV KN +V+ A  
Sbjct: 6   EAKKQQVDAIAEQLKNSVSTVIVDYRGLTVAEVTELRSQLREAGVEYKVYKNTMVRRAAE 65

Query: 64  DTSIRGISDLFVGQSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQ 122
              I G+ +   G + I  S   V+AP K+   F+ ++    V  GV+E  V++ + +K 
Sbjct: 66  QAGIEGLDEFLTGPTAIATSTEDVVAPAKVIAGFAKEHEALEVKTGVMEGSVISAEEVKT 125

Query: 123 IASLPDLEGIRAGIISAIQS 142
           + SLP  +G+ + ++S +Q+
Sbjct: 126 VGSLPSHDGLVSMLLSVLQA 145


>gi|154684622|ref|YP_001419783.1| 50S ribosomal protein L10 [Bacillus amyloliquefaciens FZB42]
 gi|166229705|sp|A7Z0M6|RL10_BACA2 RecName: Full=50S ribosomal protein L10
 gi|154350473|gb|ABS72552.1| RplJ [Bacillus amyloliquefaciens FZB42]
          Length = 166

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 41/138 (29%), Positives = 81/138 (58%), Gaps = 1/138 (0%)

Query: 6   KSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDT 65
           K V + E++     S S ++  Y+G++V+++ +LRK++REA    KV KN + + A+   
Sbjct: 8   KKVVVEEIASKLKESKSTIIVDYRGLNVSEVTELRKQLREANVEFKVYKNTMTRRAVEQA 67

Query: 66  SIRGISDLFVGQSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIA 124
            + G++D+  G + I +S   VIAP K+   F+ ++    +  GV+E  V + + +K +A
Sbjct: 68  ELDGLNDVLTGPNAIAFSTEDVIAPAKVLNEFAKNHEALEIKAGVIEGKVSSVEEVKALA 127

Query: 125 SLPDLEGIRAGIISAIQS 142
            LP  +G+ + ++S +Q+
Sbjct: 128 ELPSRDGLLSMLLSVLQA 145


>gi|308171995|ref|YP_003918700.1| 50S ribosomal protein L10 (BL5) [Bacillus amyloliquefaciens DSM 7]
 gi|307604859|emb|CBI41230.1| ribosomal protein L10 (BL5) [Bacillus amyloliquefaciens DSM 7]
 gi|328551805|gb|AEB22297.1| 50S ribosomal protein L10 [Bacillus amyloliquefaciens TA208]
 gi|328910066|gb|AEB61662.1| ribosomal protein L10 (BL5) [Bacillus amyloliquefaciens LL3]
          Length = 166

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 40/140 (28%), Positives = 82/140 (58%), Gaps = 1/140 (0%)

Query: 4   QGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIR 63
           + K V + E++     S S ++  Y+G++V+++ +LRK++REA    KV KN + + A+ 
Sbjct: 6   ETKKVVVEEIASKLKESKSTIIVDYRGLNVSEVTELRKQLREANVEFKVYKNTMTRRAVE 65

Query: 64  DTSIRGISDLFVGQSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQ 122
              + G++D+  G + I +S   V+AP K+   F+ ++    +  GV+E  V + + +K 
Sbjct: 66  QAELDGLNDVLTGPNAIAFSTEDVVAPAKVLNEFAKNHEALEIKAGVIEGKVSSVEEVKA 125

Query: 123 IASLPDLEGIRAGIISAIQS 142
           +A LP  +G+ + ++S +Q+
Sbjct: 126 LAELPSRDGLLSMLLSVLQA 145


>gi|328906256|gb|EGG26031.1| ribosomal protein L10 [Propionibacterium sp. P08]
          Length = 203

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 52/170 (30%), Positives = 93/170 (54%), Gaps = 4/170 (2%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKM-REAGGGVKVAKNRLVK 59
           M R  K   ++EL + FSS+ + V+  Y+G+SV+ +KDLR+ +  EA     VAKN L +
Sbjct: 1   MARPDKVAAVAELKEKFSSADATVLTEYRGLSVSALKDLRRSLGSEAT--YAVAKNTLTR 58

Query: 60  IAIRDTSIRGISDLFVGQSLIVYSDSPVIA-PKISVSFSNDNNEFRVLGGVVEKGVLNQD 118
           IA ++  I G+ +  VG + + + +  V +  K   +F+ DN    + GGV++  VL+ D
Sbjct: 59  IAAKEAGIEGLDEQLVGPTALAFINGDVASVAKGLKNFAKDNPLLVIKGGVMDGNVLDAD 118

Query: 119 SIKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDK 168
            +K++A L   E + A +   +++N T+   +     ++  R + A  DK
Sbjct: 119 QVKKLADLESREVLLAKLAGGLKANLTKAAVVFNALPSKAARGLGALQDK 168


>gi|313835998|gb|EFS73712.1| ribosomal protein L10 [Propionibacterium acnes HL037PA2]
 gi|314929674|gb|EFS93505.1| ribosomal protein L10 [Propionibacterium acnes HL044PA1]
 gi|314970503|gb|EFT14601.1| ribosomal protein L10 [Propionibacterium acnes HL037PA3]
          Length = 243

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 52/170 (30%), Positives = 93/170 (54%), Gaps = 4/170 (2%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKM-REAGGGVKVAKNRLVK 59
           M R  K   ++EL + FSS+ + V+  Y+G+SV+ +KDLR+ +  EA     VAKN L +
Sbjct: 41  MARPDKVAAVAELKEKFSSADATVLTEYRGLSVSALKDLRRSLGSEAT--YAVAKNTLTR 98

Query: 60  IAIRDTSIRGISDLFVGQSLIVYSDSPVIA-PKISVSFSNDNNEFRVLGGVVEKGVLNQD 118
           IA ++  I G+ +  VG + + + +  V +  K   +F+ DN    + GGV++  VL+ D
Sbjct: 99  IAAKEAGIEGLDEQLVGPTALAFINGDVASVAKGLKNFAKDNPLLVIKGGVMDGNVLDAD 158

Query: 119 SIKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDK 168
            +K++A L   E + A +   +++N T+   +     ++  R + A  DK
Sbjct: 159 QVKKLADLESREVLLAKLAGGLKANLTKAAVVFNALPSKAARGLGALQDK 208


>gi|167629456|ref|YP_001679955.1| 50S ribosomal protein l10 [Heliobacterium modesticaldum Ice1]
 gi|167592196|gb|ABZ83944.1| 50S ribosomal protein l10 [Heliobacterium modesticaldum Ice1]
          Length = 176

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 47/156 (30%), Positives = 82/156 (52%), Gaps = 3/156 (1%)

Query: 2   NRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIA 61
           N+Q K+ +++E+ +    + S V+A ++G++V +  +LR + R+ G   KV KN L +I 
Sbjct: 3   NKQQKAAQLAEIRETMGKAKSCVLADFRGMTVKEATELRNEFRKVGVEFKVCKNTLTRIV 62

Query: 62  IRDTSIRGISDLFVGQSLIVYS-DSPVIAPKISVSF--SNDNNEFRVLGGVVEKGVLNQD 118
             +  I+G+     G + I +  + PV   K+   F  +  N  F +  GVVE  V+  D
Sbjct: 63  ANELGIQGLDPYLEGPTAIAFGIEDPVAPAKVLTEFAKTTKNKNFAIKAGVVEGKVITVD 122

Query: 119 SIKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTP 154
            +K +A LP  E + A +++ IQ     LV +L  P
Sbjct: 123 GVKALADLPSREVLLAQVLAGIQGPLVGLVNVLQGP 158


>gi|786163|dbj|BAA08840.1| ribosomal protein L10 [Bacillus subtilis]
          Length = 166

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 40/140 (28%), Positives = 80/140 (57%), Gaps = 1/140 (0%)

Query: 4   QGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIR 63
           + K V + E++     S S ++  Y+G++V+++ +LRK++REA    KV KN + + A+ 
Sbjct: 6   ETKKVVVEEIASKLKESKSTIIVDYRGLNVSEVTELRKQLREANVESKVYKNTMTRRAVE 65

Query: 64  DTSIRGISDLFVGQSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQ 122
              + G++D   G + I +S   V+AP K+   F+ ++    +  GV+E  V   + +K 
Sbjct: 66  QAELNGLNDFLTGPNAIAFSTEDVVAPAKVLNDFAKNHEALEIKAGVIEGKVSTVEEVKA 125

Query: 123 IASLPDLEGIRAGIISAIQS 142
           +A LP  EG+ + ++S +++
Sbjct: 126 LAELPPREGLLSMLLSVLKA 145


>gi|297582438|ref|YP_003698218.1| 50S ribosomal protein L10 [Bacillus selenitireducens MLS10]
 gi|297140895|gb|ADH97652.1| ribosomal protein L10 [Bacillus selenitireducens MLS10]
          Length = 166

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 50/144 (34%), Positives = 82/144 (56%), Gaps = 8/144 (5%)

Query: 3   RQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAI 62
            Q K V + E+      S S +V  Y+G+ V++I +LRK++REAG   KV KN +V+   
Sbjct: 6   EQKKQV-VDEIKTKLEESQSTIVVDYRGLDVSEITELRKQLREAGVDFKVYKNSMVR--- 61

Query: 63  RDTSIRGISDL---FVGQSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQD 118
           R T   G++DL     G + I +S+  V+AP KI   F+ D+    +  GV+E  V   +
Sbjct: 62  RATEAAGLTDLDEHLTGPTAIAFSNEDVVAPAKILNGFAKDHEALELKAGVIEGKVTGLE 121

Query: 119 SIKQIASLPDLEGIRAGIISAIQS 142
            IK +A+LP  +G+ + ++S +Q+
Sbjct: 122 EIKALATLPSRDGLVSMLLSVLQA 145


>gi|51894222|ref|YP_076913.1| 50S ribosomal protein L10 [Symbiobacterium thermophilum IAM 14863]
 gi|61214893|sp|Q67JT1|RL10_SYMTH RecName: Full=50S ribosomal protein L10
 gi|51857911|dbj|BAD42069.1| 50S ribosomal protein L10 [Symbiobacterium thermophilum IAM 14863]
          Length = 179

 Score = 82.0 bits (201), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 47/143 (32%), Positives = 83/143 (58%), Gaps = 3/143 (2%)

Query: 3   RQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAI 62
           R  K   ++EL +   ++ S+V+A   G++VAQ+  LR+++R+AG  +KVAKN L+ IA 
Sbjct: 5   RPEKQQAVAELKEALQNAKSVVLADNLGLTVAQVTQLRRELRQAGVELKVAKNTLIGIAA 64

Query: 63  RDTSIRGISDLFVGQSLIV--YSDSPVIAPKISVSFSNDNN-EFRVLGGVVEKGVLNQDS 119
           R+  I G+     G + +   Y D    A KI   F+ +   +F +  G++E  V++ D 
Sbjct: 65  RELGIEGLEPYLHGTTTLAFSYEDEAAGAKKIREFFAKEREPKFVMKAGILEGKVIDADG 124

Query: 120 IKQIASLPDLEGIRAGIISAIQS 142
           +K +A LP+ E + A +++ IQ+
Sbjct: 125 VKALADLPNRETLLAQVLAGIQA 147


>gi|116495725|ref|YP_807459.1| 50S ribosomal protein L10 [Lactobacillus casei ATCC 334]
 gi|191639213|ref|YP_001988379.1| 50S ribosomal protein L10 [Lactobacillus casei BL23]
 gi|239630130|ref|ZP_04673161.1| LSU ribosomal protein L10P [Lactobacillus paracasei subsp.
           paracasei 8700:2]
 gi|301067280|ref|YP_003789303.1| 50S ribosomal protein L10 [Lactobacillus casei str. Zhang]
 gi|122262873|sp|Q035V5|RL10_LACC3 RecName: Full=50S ribosomal protein L10
 gi|226699965|sp|B3WA02|RL10_LACCB RecName: Full=50S ribosomal protein L10
 gi|116105875|gb|ABJ71017.1| LSU ribosomal protein L10P [Lactobacillus casei ATCC 334]
 gi|190713515|emb|CAQ67521.1| 50S ribosomal protein L10 [Lactobacillus casei BL23]
 gi|239527742|gb|EEQ66743.1| LSU ribosomal protein L10P [Lactobacillus paracasei subsp.
           paracasei 8700:2]
 gi|300439687|gb|ADK19453.1| Ribosomal protein L10 [Lactobacillus casei str. Zhang]
 gi|327383291|gb|AEA54767.1| 50S ribosomal protein L10 [Lactobacillus casei LC2W]
 gi|327386474|gb|AEA57948.1| 50S ribosomal protein L10 [Lactobacillus casei BD-II]
          Length = 168

 Score = 82.0 bits (201), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 41/134 (30%), Positives = 79/134 (58%), Gaps = 1/134 (0%)

Query: 10  ISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRG 69
           +  +S+ F S+ S VV  Y G++V Q+  LRK++REAG  ++V KN  ++ A        
Sbjct: 13  VKSISEQFKSATSAVVVDYLGLTVEQVTALRKELREAGVKMEVLKNTYLRRAADANGYEA 72

Query: 70  ISDLFVGQSLIVYS-DSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASLPD 128
           + D+F G + + +S D PV   +I   +++  +  ++ GG++E  V + D+I +++ +PD
Sbjct: 73  LDDVFKGPTAVAFSNDDPVAPARIMAKYADQFDALKIKGGIIENKVASLDTIMEMSKMPD 132

Query: 129 LEGIRAGIISAIQS 142
            EG+ + + S +Q+
Sbjct: 133 REGLLSQLASVLQA 146


>gi|15804575|ref|NP_290616.1| 50S ribosomal protein L10 [Escherichia coli O157:H7 EDL933]
 gi|15834162|ref|NP_312935.1| 50S ribosomal protein L10 [Escherichia coli O157:H7 str. Sakai]
 gi|16131815|ref|NP_418412.1| 50S ribosomal subunit protein L10 [Escherichia coli str. K-12
           substr. MG1655]
 gi|24115270|ref|NP_709780.1| 50S ribosomal protein L10 [Shigella flexneri 2a str. 301]
 gi|26250755|ref|NP_756795.1| 50S ribosomal protein L10 [Escherichia coli CFT073]
 gi|30064732|ref|NP_838903.1| 50S ribosomal protein L10 [Shigella flexneri 2a str. 2457T]
 gi|74314479|ref|YP_312898.1| 50S ribosomal protein L10 [Shigella sonnei Ss046]
 gi|82546327|ref|YP_410274.1| 50S ribosomal protein L10 [Shigella boydii Sb227]
 gi|82778840|ref|YP_405189.1| 50S ribosomal protein L10 [Shigella dysenteriae Sd197]
 gi|89110054|ref|AP_003834.1| 50S ribosomal subunit protein L10 [Escherichia coli str. K-12
           substr. W3110]
 gi|91212809|ref|YP_542795.1| 50S ribosomal protein L10 [Escherichia coli UTI89]
 gi|110644320|ref|YP_672050.1| 50S ribosomal protein L10 [Escherichia coli 536]
 gi|110807835|ref|YP_691355.1| 50S ribosomal protein L10 [Shigella flexneri 5 str. 8401]
 gi|117626248|ref|YP_859571.1| 50S ribosomal protein L10 [Escherichia coli APEC O1]
 gi|157156972|ref|YP_001465477.1| 50S ribosomal protein L10 [Escherichia coli E24377A]
 gi|157163453|ref|YP_001460771.1| 50S ribosomal protein L10 [Escherichia coli HS]
 gi|168752051|ref|ZP_02777073.1| ribosomal protein L10 [Escherichia coli O157:H7 str. EC4113]
 gi|168758622|ref|ZP_02783629.1| ribosomal protein L10 [Escherichia coli O157:H7 str. EC4401]
 gi|168764563|ref|ZP_02789570.1| ribosomal protein L10 [Escherichia coli O157:H7 str. EC4501]
 gi|168771455|ref|ZP_02796462.1| ribosomal protein L10 [Escherichia coli O157:H7 str. EC4486]
 gi|168777404|ref|ZP_02802411.1| ribosomal protein L10 [Escherichia coli O157:H7 str. EC4196]
 gi|168780368|ref|ZP_02805375.1| ribosomal protein L10 [Escherichia coli O157:H7 str. EC4076]
 gi|168790343|ref|ZP_02815350.1| ribosomal protein L10 [Escherichia coli O157:H7 str. EC869]
 gi|168798383|ref|ZP_02823390.1| ribosomal protein L10 [Escherichia coli O157:H7 str. EC508]
 gi|170022012|ref|YP_001726966.1| 50S ribosomal protein L10 [Escherichia coli ATCC 8739]
 gi|170083445|ref|YP_001732765.1| 50S ribosomal subunit protein L10 [Escherichia coli str. K-12
           substr. DH10B]
 gi|170683724|ref|YP_001746369.1| 50S ribosomal protein L10 [Escherichia coli SMS-3-5]
 gi|170770117|ref|ZP_02904570.1| ribosomal protein L10 [Escherichia albertii TW07627]
 gi|187734099|ref|YP_001882670.1| 50S ribosomal protein L10 [Shigella boydii CDC 3083-94]
 gi|188496042|ref|ZP_03003312.1| ribosomal protein L10 [Escherichia coli 53638]
 gi|191174302|ref|ZP_03035810.1| ribosomal protein L10 [Escherichia coli F11]
 gi|193066425|ref|ZP_03047472.1| ribosomal protein L10 [Escherichia coli E22]
 gi|193067913|ref|ZP_03048879.1| ribosomal protein L10 [Escherichia coli E110019]
 gi|194429957|ref|ZP_03062466.1| ribosomal protein L10 [Escherichia coli B171]
 gi|194434757|ref|ZP_03067008.1| ribosomal protein L10 [Shigella dysenteriae 1012]
 gi|194439786|ref|ZP_03071853.1| ribosomal protein L10 [Escherichia coli 101-1]
 gi|195939610|ref|ZP_03084992.1| 50S ribosomal protein L10 [Escherichia coli O157:H7 str. EC4024]
 gi|208805915|ref|ZP_03248252.1| ribosomal protein L10 [Escherichia coli O157:H7 str. EC4206]
 gi|208813046|ref|ZP_03254375.1| ribosomal protein L10 [Escherichia coli O157:H7 str. EC4045]
 gi|208821306|ref|ZP_03261626.1| ribosomal protein L10 [Escherichia coli O157:H7 str. EC4042]
 gi|209400268|ref|YP_002273501.1| ribosomal protein L10 [Escherichia coli O157:H7 str. EC4115]
 gi|209921463|ref|YP_002295547.1| 50S ribosomal protein L10 [Escherichia coli SE11]
 gi|215489317|ref|YP_002331748.1| 50S ribosomal protein L10 [Escherichia coli O127:H6 str. E2348/69]
 gi|217326479|ref|ZP_03442563.1| ribosomal protein L10 [Escherichia coli O157:H7 str. TW14588]
 gi|218551031|ref|YP_002384822.1| 50S ribosomal protein L10 [Escherichia fergusonii ATCC 35469]
 gi|218556539|ref|YP_002389453.1| 50S ribosomal protein L10 [Escherichia coli IAI1]
 gi|218561051|ref|YP_002393964.1| 50S ribosomal protein L10 [Escherichia coli S88]
 gi|218692266|ref|YP_002400478.1| 50S ribosomal protein L10 [Escherichia coli ED1a]
 gi|218697692|ref|YP_002405359.1| 50S ribosomal protein L10 [Escherichia coli 55989]
 gi|218702615|ref|YP_002410244.1| 50S ribosomal protein L10 [Escherichia coli IAI39]
 gi|218707603|ref|YP_002415122.1| 50S ribosomal protein L10 [Escherichia coli UMN026]
 gi|227885486|ref|ZP_04003291.1| 50S ribosomal protein L10 [Escherichia coli 83972]
 gi|237702753|ref|ZP_04533234.1| 50S ribosomal subunit protein L10 [Escherichia sp. 3_2_53FAA]
 gi|238903041|ref|YP_002928837.1| 50S ribosomal subunit protein L10 [Escherichia coli BW2952]
 gi|253775386|ref|YP_003038217.1| 50S ribosomal protein L10 [Escherichia coli 'BL21-Gold(DE3)pLysS
           AG']
 gi|254039241|ref|ZP_04873290.1| ribosomal protein L10 [Escherichia sp. 1_1_43]
 gi|254163926|ref|YP_003047034.1| 50S ribosomal protein L10 [Escherichia coli B str. REL606]
 gi|254795983|ref|YP_003080820.1| 50S ribosomal protein L10 [Escherichia coli O157:H7 str. TW14359]
 gi|256021695|ref|ZP_05435560.1| 50S ribosomal protein L10 [Shigella sp. D9]
 gi|256026300|ref|ZP_05440165.1| 50S ribosomal protein L10 [Escherichia sp. 4_1_40B]
 gi|260846785|ref|YP_003224563.1| 50S ribosomal subunit protein L10 [Escherichia coli O103:H2 str.
           12009]
 gi|260858094|ref|YP_003231985.1| 50S ribosomal subunit protein L10 [Escherichia coli O26:H11 str.
           11368]
 gi|260870696|ref|YP_003237098.1| 50S ribosomal subunit protein L10 [Escherichia coli O111:H- str.
           11128]
 gi|261227304|ref|ZP_05941585.1| 50S ribosomal subunit protein L10 [Escherichia coli O157:H7 str.
           FRIK2000]
 gi|261257051|ref|ZP_05949584.1| 50S ribosomal subunit protein L10 [Escherichia coli O157:H7 str.
           FRIK966]
 gi|291285399|ref|YP_003502217.1| 50S ribosomal protein L10 [Escherichia coli O55:H7 str. CB9615]
 gi|293407601|ref|ZP_06651519.1| rplJ [Escherichia coli FVEC1412]
 gi|293413421|ref|ZP_06656081.1| rplJ [Escherichia coli B354]
 gi|293417488|ref|ZP_06660111.1| 50S ribosomal protein L10 [Escherichia coli B185]
 gi|293474291|ref|ZP_06664700.1| large subunit ribosomal protein L10 [Escherichia coli B088]
 gi|297518010|ref|ZP_06936396.1| 50S ribosomal protein L10 [Escherichia coli OP50]
 gi|298383349|ref|ZP_06992941.1| 50S ribosomal protein L10 [Escherichia coli FVEC1302]
 gi|300819795|ref|ZP_07099982.1| ribosomal protein L10 [Escherichia coli MS 107-1]
 gi|300824636|ref|ZP_07104744.1| ribosomal protein L10 [Escherichia coli MS 119-7]
 gi|300897602|ref|ZP_07116010.1| ribosomal protein L10 [Escherichia coli MS 198-1]
 gi|300907536|ref|ZP_07125176.1| ribosomal protein L10 [Escherichia coli MS 84-1]
 gi|300919400|ref|ZP_07135906.1| ribosomal protein L10 [Escherichia coli MS 115-1]
 gi|300925850|ref|ZP_07141695.1| ribosomal protein L10 [Escherichia coli MS 182-1]
 gi|300928802|ref|ZP_07144311.1| ribosomal protein L10 [Escherichia coli MS 187-1]
 gi|300938791|ref|ZP_07153503.1| ribosomal protein L10 [Escherichia coli MS 21-1]
 gi|300947412|ref|ZP_07161603.1| ribosomal protein L10 [Escherichia coli MS 116-1]
 gi|300954786|ref|ZP_07167215.1| ribosomal protein L10 [Escherichia coli MS 175-1]
 gi|300979575|ref|ZP_07174618.1| ribosomal protein L10 [Escherichia coli MS 45-1]
 gi|300985572|ref|ZP_07177488.1| ribosomal protein L10 [Escherichia coli MS 200-1]
 gi|301019397|ref|ZP_07183574.1| ribosomal protein L10 [Escherichia coli MS 69-1]
 gi|301023351|ref|ZP_07187143.1| ribosomal protein L10 [Escherichia coli MS 196-1]
 gi|301047718|ref|ZP_07194778.1| ribosomal protein L10 [Escherichia coli MS 185-1]
 gi|301302204|ref|ZP_07208336.1| ribosomal protein L10 [Escherichia coli MS 124-1]
 gi|301326084|ref|ZP_07219482.1| ribosomal protein L10 [Escherichia coli MS 78-1]
 gi|301645761|ref|ZP_07245681.1| ribosomal protein L10 [Escherichia coli MS 146-1]
 gi|306812000|ref|ZP_07446208.1| 50S ribosomal protein L10 [Escherichia coli NC101]
 gi|307140676|ref|ZP_07500032.1| 50S ribosomal protein L10 [Escherichia coli H736]
 gi|307315042|ref|ZP_07594628.1| ribosomal protein L10 [Escherichia coli W]
 gi|309783936|ref|ZP_07678581.1| ribosomal L10 family protein [Shigella dysenteriae 1617]
 gi|309797688|ref|ZP_07692074.1| ribosomal protein L10 [Escherichia coli MS 145-7]
 gi|312965362|ref|ZP_07779595.1| ribosomal L10 family protein [Escherichia coli 2362-75]
 gi|312974229|ref|ZP_07788399.1| ribosomal L10 family protein [Escherichia coli 1827-70]
 gi|331644719|ref|ZP_08345837.1| 50S ribosomal protein L10 [Escherichia coli H736]
 gi|331649838|ref|ZP_08350916.1| 50S ribosomal protein L10 [Escherichia coli M605]
 gi|331655682|ref|ZP_08356672.1| 50S ribosomal protein L10 [Escherichia coli M718]
 gi|331660544|ref|ZP_08361477.1| 50S ribosomal protein L10 [Escherichia coli TA206]
 gi|331665639|ref|ZP_08366535.1| 50S ribosomal protein L10 [Escherichia coli TA143]
 gi|331670837|ref|ZP_08371672.1| 50S ribosomal protein L10 [Escherichia coli TA271]
 gi|331675471|ref|ZP_08376220.1| 50S ribosomal protein L10 [Escherichia coli TA280]
 gi|331680105|ref|ZP_08380766.1| 50S ribosomal protein L10 [Escherichia coli H591]
 gi|331685726|ref|ZP_08386308.1| 50S ribosomal protein L10 [Escherichia coli H299]
 gi|67471992|sp|P0A7J3|RL10_ECOLI RecName: Full=50S ribosomal protein L10; AltName: Full=50S
           ribosomal protein L8
 gi|67471993|sp|P0A7J4|RL10_ECOL6 RecName: Full=50S ribosomal protein L10
 gi|67471994|sp|P0A7J5|RL10_ECO57 RecName: Full=50S ribosomal protein L10
 gi|67471995|sp|P0A7J6|RL10_SHIFL RecName: Full=50S ribosomal protein L10
 gi|97181947|sp|Q31U12|RL10_SHIBS RecName: Full=50S ribosomal protein L10
 gi|97181955|sp|Q32AF7|RL10_SHIDS RecName: Full=50S ribosomal protein L10
 gi|97181965|sp|Q3YUZ9|RL10_SHISS RecName: Full=50S ribosomal protein L10
 gi|122422148|sp|Q1R5V0|RL10_ECOUT RecName: Full=50S ribosomal protein L10
 gi|122957804|sp|Q0TA80|RL10_ECOL5 RecName: Full=50S ribosomal protein L10
 gi|123146463|sp|Q0SY15|RL10_SHIF8 RecName: Full=50S ribosomal protein L10
 gi|166229724|sp|A1AIF7|RL10_ECOK1 RecName: Full=50S ribosomal protein L10
 gi|166981504|sp|A7ZUJ8|RL10_ECO24 RecName: Full=50S ribosomal protein L10
 gi|166981505|sp|A8A784|RL10_ECOHS RecName: Full=50S ribosomal protein L10
 gi|189040915|sp|B1IUR2|RL10_ECOLC RecName: Full=50S ribosomal protein L10
 gi|226699940|sp|B7MIX1|RL10_ECO45 RecName: Full=50S ribosomal protein L10
 gi|226699941|sp|B5Z081|RL10_ECO5E RecName: Full=50S ribosomal protein L10
 gi|226699942|sp|B7NRR3|RL10_ECO7I RecName: Full=50S ribosomal protein L10
 gi|226699943|sp|B7M732|RL10_ECO8A RecName: Full=50S ribosomal protein L10
 gi|226699944|sp|B1XBY7|RL10_ECODH RecName: Full=50S ribosomal protein L10
 gi|226699945|sp|B7NFS5|RL10_ECOLU RecName: Full=50S ribosomal protein L10
 gi|226699946|sp|B6I5J5|RL10_ECOSE RecName: Full=50S ribosomal protein L10
 gi|226699947|sp|B1LNT7|RL10_ECOSM RecName: Full=50S ribosomal protein L10
 gi|226699949|sp|B7LUL7|RL10_ESCF3 RecName: Full=50S ribosomal protein L10
 gi|226700005|sp|B2TWH1|RL10_SHIB3 RecName: Full=50S ribosomal protein L10
 gi|254798377|sp|B7UPE0|RL10_ECO27 RecName: Full=50S ribosomal protein L10
 gi|254798378|sp|B7LA78|RL10_ECO55 RecName: Full=50S ribosomal protein L10
 gi|254798379|sp|B7MR71|RL10_ECO81 RecName: Full=50S ribosomal protein L10
 gi|259645480|sp|C5A0S5|RL10_ECOBW RecName: Full=50S ribosomal protein L10
 gi|12518910|gb|AAG59181.1|AE005630_1 50S ribosomal subunit protein L10 [Escherichia coli O157:H7 str.
           EDL933]
 gi|26111186|gb|AAN83369.1|AE016770_169 50S ribosomal protein L10 [Escherichia coli CFT073]
 gi|42816|emb|CAA23623.1| rplJ (L10) [Escherichia coli]
 gi|396324|gb|AAC43083.1| 50S ribosomal subunit protein L10 [Escherichia coli str. K-12
           substr. MG1655]
 gi|1790417|gb|AAC76959.1| 50S ribosomal subunit protein L10 [Escherichia coli str. K-12
           substr. MG1655]
 gi|13364384|dbj|BAB38331.1| 50S ribosomal subunit protein L10 [Escherichia coli O157:H7 str.
           Sakai]
 gi|24054563|gb|AAN45487.1| 50S ribosomal subunit protein L10 [Shigella flexneri 2a str. 301]
 gi|30042992|gb|AAP18714.1| 50S ribosomal subunit protein L10 [Shigella flexneri 2a str. 2457T]
 gi|73857956|gb|AAZ90663.1| 50S ribosomal subunit protein L10 [Shigella sonnei Ss046]
 gi|81242988|gb|ABB63698.1| 50S ribosomal subunit protein L10 [Shigella dysenteriae Sd197]
 gi|81247738|gb|ABB68446.1| 50S ribosomal subunit protein L10 [Shigella boydii Sb227]
 gi|85676085|dbj|BAE77335.1| 50S ribosomal subunit protein L10 [Escherichia coli str. K12
           substr. W3110]
 gi|91074383|gb|ABE09264.1| 50S ribosomal subunit protein L10 [Escherichia coli UTI89]
 gi|110345912|gb|ABG72149.1| 50S ribosomal protein L10 [Escherichia coli 536]
 gi|110617383|gb|ABF06050.1| 50S ribosomal subunit protein L10 [Shigella flexneri 5 str. 8401]
 gi|115515372|gb|ABJ03447.1| 50S ribosomal subunit protein L10 [Escherichia coli APEC O1]
 gi|157069133|gb|ABV08388.1| ribosomal protein L10 [Escherichia coli HS]
 gi|157079002|gb|ABV18710.1| ribosomal protein L10 [Escherichia coli E24377A]
 gi|169756940|gb|ACA79639.1| ribosomal protein L10 [Escherichia coli ATCC 8739]
 gi|169891280|gb|ACB04987.1| 50S ribosomal subunit protein L10 [Escherichia coli str. K-12
           substr. DH10B]
 gi|170120999|gb|EDS89930.1| ribosomal protein L10 [Escherichia albertii TW07627]
 gi|170521442|gb|ACB19620.1| ribosomal protein L10 [Escherichia coli SMS-3-5]
 gi|187431091|gb|ACD10365.1| ribosomal protein L10 [Shigella boydii CDC 3083-94]
 gi|187767355|gb|EDU31199.1| ribosomal protein L10 [Escherichia coli O157:H7 str. EC4196]
 gi|188014020|gb|EDU52142.1| ribosomal protein L10 [Escherichia coli O157:H7 str. EC4113]
 gi|188491241|gb|EDU66344.1| ribosomal protein L10 [Escherichia coli 53638]
 gi|189001872|gb|EDU70858.1| ribosomal protein L10 [Escherichia coli O157:H7 str. EC4076]
 gi|189354592|gb|EDU73011.1| ribosomal protein L10 [Escherichia coli O157:H7 str. EC4401]
 gi|189359759|gb|EDU78178.1| ribosomal protein L10 [Escherichia coli O157:H7 str. EC4486]
 gi|189365465|gb|EDU83881.1| ribosomal protein L10 [Escherichia coli O157:H7 str. EC4501]
 gi|189370164|gb|EDU88580.1| ribosomal protein L10 [Escherichia coli O157:H7 str. EC869]
 gi|189379205|gb|EDU97621.1| ribosomal protein L10 [Escherichia coli O157:H7 str. EC508]
 gi|190905434|gb|EDV65065.1| ribosomal protein L10 [Escherichia coli F11]
 gi|192925949|gb|EDV80596.1| ribosomal protein L10 [Escherichia coli E22]
 gi|192958888|gb|EDV89325.1| ribosomal protein L10 [Escherichia coli E110019]
 gi|194411986|gb|EDX28299.1| ribosomal protein L10 [Escherichia coli B171]
 gi|194416981|gb|EDX33099.1| ribosomal protein L10 [Shigella dysenteriae 1012]
 gi|194421283|gb|EDX37303.1| ribosomal protein L10 [Escherichia coli 101-1]
 gi|208725716|gb|EDZ75317.1| ribosomal protein L10 [Escherichia coli O157:H7 str. EC4206]
 gi|208734323|gb|EDZ83010.1| ribosomal protein L10 [Escherichia coli O157:H7 str. EC4045]
 gi|208741429|gb|EDZ89111.1| ribosomal protein L10 [Escherichia coli O157:H7 str. EC4042]
 gi|209161668|gb|ACI39101.1| ribosomal protein L10 [Escherichia coli O157:H7 str. EC4115]
 gi|209751828|gb|ACI74221.1| 50S ribosomal subunit protein L7/L12 [Escherichia coli]
 gi|209751830|gb|ACI74222.1| 50S ribosomal subunit protein L7/L12 [Escherichia coli]
 gi|209751832|gb|ACI74223.1| 50S ribosomal subunit protein L7/L12 [Escherichia coli]
 gi|209751834|gb|ACI74224.1| 50S ribosomal subunit protein L7/L12 [Escherichia coli]
 gi|209751836|gb|ACI74225.1| 50S ribosomal subunit protein L7/L12 [Escherichia coli]
 gi|209914722|dbj|BAG79796.1| 50S ribosomal protein L10 [Escherichia coli SE11]
 gi|215267389|emb|CAS11840.1| 50S ribosomal subunit protein L10 [Escherichia coli O127:H6 str.
           E2348/69]
 gi|217322700|gb|EEC31124.1| ribosomal protein L10 [Escherichia coli O157:H7 str. TW14588]
 gi|218354424|emb|CAV01224.1| 50S ribosomal subunit protein L10 [Escherichia coli 55989]
 gi|218358572|emb|CAQ91220.1| 50S ribosomal subunit protein L10 [Escherichia fergusonii ATCC
           35469]
 gi|218363308|emb|CAR00958.1| 50S ribosomal subunit protein L10 [Escherichia coli IAI1]
 gi|218367820|emb|CAR05615.1| 50S ribosomal subunit protein L10 [Escherichia coli S88]
 gi|218372601|emb|CAR20476.1| 50S ribosomal subunit protein L10 [Escherichia coli IAI39]
 gi|218429830|emb|CAR10656.1| 50S ribosomal subunit protein L10 [Escherichia coli ED1a]
 gi|218434700|emb|CAR15632.1| 50S ribosomal subunit protein L10 [Escherichia coli UMN026]
 gi|222035696|emb|CAP78441.1| 50S ribosomal protein L10 [Escherichia coli LF82]
 gi|226838476|gb|EEH70506.1| ribosomal protein L10 [Escherichia sp. 1_1_43]
 gi|226903066|gb|EEH89325.1| 50S ribosomal subunit protein L10 [Escherichia sp. 3_2_53FAA]
 gi|227837560|gb|EEJ48026.1| 50S ribosomal protein L10 [Escherichia coli 83972]
 gi|238859849|gb|ACR61847.1| 50S ribosomal subunit protein L10 [Escherichia coli BW2952]
 gi|242379515|emb|CAQ34331.1| 50S ribosomal subunit protein L10, subunit of 50S ribosomal protein
           complex L8, 50S ribosomal subunit and ribosome
           [Escherichia coli BL21(DE3)]
 gi|253326430|gb|ACT31032.1| ribosomal protein L10 [Escherichia coli 'BL21-Gold(DE3)pLysS AG']
 gi|253975827|gb|ACT41498.1| 50S ribosomal protein L10 [Escherichia coli B str. REL606]
 gi|253979983|gb|ACT45653.1| 50S ribosomal protein L10 [Escherichia coli BL21(DE3)]
 gi|254595383|gb|ACT74744.1| 50S ribosomal subunit protein L10 [Escherichia coli O157:H7 str.
           TW14359]
 gi|257756743|dbj|BAI28245.1| 50S ribosomal subunit protein L10 [Escherichia coli O26:H11 str.
           11368]
 gi|257761932|dbj|BAI33429.1| 50S ribosomal subunit protein L10 [Escherichia coli O103:H2 str.
           12009]
 gi|257767052|dbj|BAI38547.1| 50S ribosomal subunit protein L10 [Escherichia coli O111:H- str.
           11128]
 gi|260451188|gb|ACX41610.1| ribosomal protein L10 [Escherichia coli DH1]
 gi|281181049|dbj|BAI57379.1| 50S ribosomal protein L10 [Escherichia coli SE15]
 gi|281603371|gb|ADA76355.1| 50S ribosomal protein L10 [Shigella flexneri 2002017]
 gi|284924077|emb|CBG37176.1| 50S ribosomal subunit protein L10 [Escherichia coli 042]
 gi|290765272|gb|ADD59233.1| 50S ribosomal protein L10 [Escherichia coli O55:H7 str. CB9615]
 gi|291321321|gb|EFE60762.1| large subunit ribosomal protein L10 [Escherichia coli B088]
 gi|291425369|gb|EFE98409.1| rplJ [Escherichia coli FVEC1412]
 gi|291430815|gb|EFF03812.1| 50S ribosomal protein L10 [Escherichia coli B185]
 gi|291468016|gb|EFF10515.1| rplJ [Escherichia coli B354]
 gi|294490289|gb|ADE89045.1| ribosomal protein L10 [Escherichia coli IHE3034]
 gi|298276228|gb|EFI17749.1| 50S ribosomal protein L10 [Escherichia coli FVEC1302]
 gi|299880911|gb|EFI89122.1| ribosomal protein L10 [Escherichia coli MS 196-1]
 gi|300300403|gb|EFJ56788.1| ribosomal protein L10 [Escherichia coli MS 185-1]
 gi|300306518|gb|EFJ61038.1| ribosomal protein L10 [Escherichia coli MS 200-1]
 gi|300318255|gb|EFJ68039.1| ribosomal protein L10 [Escherichia coli MS 175-1]
 gi|300358649|gb|EFJ74519.1| ribosomal protein L10 [Escherichia coli MS 198-1]
 gi|300399281|gb|EFJ82819.1| ribosomal protein L10 [Escherichia coli MS 69-1]
 gi|300400743|gb|EFJ84281.1| ribosomal protein L10 [Escherichia coli MS 84-1]
 gi|300409479|gb|EFJ93017.1| ribosomal protein L10 [Escherichia coli MS 45-1]
 gi|300413535|gb|EFJ96845.1| ribosomal protein L10 [Escherichia coli MS 115-1]
 gi|300418075|gb|EFK01386.1| ribosomal protein L10 [Escherichia coli MS 182-1]
 gi|300452981|gb|EFK16601.1| ribosomal protein L10 [Escherichia coli MS 116-1]
 gi|300456275|gb|EFK19768.1| ribosomal protein L10 [Escherichia coli MS 21-1]
 gi|300463213|gb|EFK26706.1| ribosomal protein L10 [Escherichia coli MS 187-1]
 gi|300522885|gb|EFK43954.1| ribosomal protein L10 [Escherichia coli MS 119-7]
 gi|300527616|gb|EFK48678.1| ribosomal protein L10 [Escherichia coli MS 107-1]
 gi|300842367|gb|EFK70127.1| ribosomal protein L10 [Escherichia coli MS 124-1]
 gi|300847177|gb|EFK74937.1| ribosomal protein L10 [Escherichia coli MS 78-1]
 gi|301075972|gb|EFK90778.1| ribosomal protein L10 [Escherichia coli MS 146-1]
 gi|305854605|gb|EFM55041.1| 50S ribosomal protein L10 [Escherichia coli NC101]
 gi|306905547|gb|EFN36080.1| ribosomal protein L10 [Escherichia coli W]
 gi|307556128|gb|ADN48903.1| 50S ribosomal protein L10 [Escherichia coli ABU 83972]
 gi|307628398|gb|ADN72702.1| 50S ribosomal protein L10 [Escherichia coli UM146]
 gi|308118700|gb|EFO55962.1| ribosomal protein L10 [Escherichia coli MS 145-7]
 gi|308928307|gb|EFP73769.1| ribosomal L10 family protein [Shigella dysenteriae 1617]
 gi|309704400|emb|CBJ03749.1| 50S ribosomal subunit protein L10 [Escherichia coli ETEC H10407]
 gi|310331396|gb|EFP98661.1| ribosomal L10 family protein [Escherichia coli 1827-70]
 gi|312290036|gb|EFR17923.1| ribosomal L10 family protein [Escherichia coli 2362-75]
 gi|312948559|gb|ADR29386.1| 50S ribosomal protein L10 [Escherichia coli O83:H1 str. NRG 857C]
 gi|313648635|gb|EFS13075.1| ribosomal L10 family protein [Shigella flexneri 2a str. 2457T]
 gi|315063310|gb|ADT77637.1| 50S ribosomal subunit protein L10 [Escherichia coli W]
 gi|315138541|dbj|BAJ45700.1| 50S ribosomal protein L10 [Escherichia coli DH1]
 gi|315253057|gb|EFU33025.1| ribosomal protein L10 [Escherichia coli MS 85-1]
 gi|315288353|gb|EFU47751.1| ribosomal protein L10 [Escherichia coli MS 110-3]
 gi|315294333|gb|EFU53684.1| ribosomal protein L10 [Escherichia coli MS 153-1]
 gi|315300758|gb|EFU59983.1| ribosomal protein L10 [Escherichia coli MS 16-3]
 gi|315617348|gb|EFU97954.1| ribosomal L10 family protein [Escherichia coli 3431]
 gi|320172754|gb|EFW47988.1| LSU ribosomal protein L10p (P0) [Shigella dysenteriae CDC 74-1112]
 gi|320179554|gb|EFW54505.1| LSU ribosomal protein L10p (P0) [Shigella boydii ATCC 9905]
 gi|320185977|gb|EFW60725.1| LSU ribosomal protein L10p (P0) [Shigella flexneri CDC 796-83]
 gi|320190919|gb|EFW65569.1| LSU ribosomal protein L10p (P0) [Escherichia coli O157:H7 str.
           EC1212]
 gi|320197120|gb|EFW71738.1| LSU ribosomal protein L10p (P0) [Escherichia coli WV_060327]
 gi|320200176|gb|EFW74765.1| LSU ribosomal protein L10p (P0) [Escherichia coli EC4100B]
 gi|320639075|gb|EFX08715.1| 50S ribosomal protein L10 [Escherichia coli O157:H7 str. G5101]
 gi|320644469|gb|EFX13532.1| 50S ribosomal protein L10 [Escherichia coli O157:H- str. 493-89]
 gi|320649788|gb|EFX18309.1| 50S ribosomal protein L10 [Escherichia coli O157:H- str. H 2687]
 gi|320655121|gb|EFX23077.1| 50S ribosomal protein L10 [Escherichia coli O55:H7 str. 3256-97 TW
           07815]
 gi|320660765|gb|EFX28219.1| 50S ribosomal protein L10 [Escherichia coli O55:H7 str. USDA 5905]
 gi|320665883|gb|EFX32914.1| 50S ribosomal protein L10 [Escherichia coli O157:H7 str. LSU-61]
 gi|323155523|gb|EFZ41701.1| ribosomal L10 family protein [Escherichia coli EPECa14]
 gi|323161293|gb|EFZ47203.1| ribosomal protein L10 family protein [Escherichia coli E128010]
 gi|323167455|gb|EFZ53163.1| ribosomal L10 family protein [Shigella sonnei 53G]
 gi|323174506|gb|EFZ60131.1| ribosomal protein L10 family protein [Escherichia coli LT-68]
 gi|323177538|gb|EFZ63123.1| ribosomal protein L10 family protein [Escherichia coli 1180]
 gi|323182082|gb|EFZ67492.1| ribosomal protein L10 family protein [Escherichia coli 1357]
 gi|323190158|gb|EFZ75436.1| ribosomal protein L10 family protein [Escherichia coli RN587/1]
 gi|323380626|gb|ADX52894.1| ribosomal protein L10 [Escherichia coli KO11]
 gi|323933973|gb|EGB30447.1| ribosomal protein L10 [Escherichia coli E1520]
 gi|323938898|gb|EGB35118.1| ribosomal protein L10 [Escherichia coli E482]
 gi|323943598|gb|EGB39707.1| ribosomal protein L10 [Escherichia coli H120]
 gi|323948843|gb|EGB44740.1| ribosomal protein L10 [Escherichia coli H252]
 gi|323953802|gb|EGB49609.1| ribosomal protein L10 [Escherichia coli H263]
 gi|323958911|gb|EGB54586.1| ribosomal protein L10 [Escherichia coli H489]
 gi|323963797|gb|EGB59296.1| ribosomal protein L10 [Escherichia coli M863]
 gi|323969058|gb|EGB64366.1| ribosomal protein L10 [Escherichia coli TA007]
 gi|323974185|gb|EGB69317.1| ribosomal protein L10 [Escherichia coli TW10509]
 gi|324009468|gb|EGB78687.1| ribosomal protein L10 [Escherichia coli MS 57-2]
 gi|324015280|gb|EGB84499.1| ribosomal protein L10 [Escherichia coli MS 60-1]
 gi|324017332|gb|EGB86551.1| ribosomal protein L10 [Escherichia coli MS 117-3]
 gi|324110897|gb|EGC04889.1| ribosomal protein L10 [Escherichia fergusonii B253]
 gi|324115416|gb|EGC09361.1| ribosomal protein L10 [Escherichia coli E1167]
 gi|325499283|gb|EGC97142.1| 50S ribosomal protein L10 [Escherichia fergusonii ECD227]
 gi|326347165|gb|EGD70895.1| LSU ribosomal protein L10p (P0) [Escherichia coli O157:H7 str.
           1125]
 gi|326347584|gb|EGD71306.1| LSU ribosomal protein L10p (P0) [Escherichia coli O157:H7 str.
           1044]
 gi|327250455|gb|EGE62165.1| ribosomal protein L10 family protein [Escherichia coli STEC_7v]
 gi|330908302|gb|EGH36821.1| LSU ribosomal protein L10p (P0) [Escherichia coli AA86]
 gi|331036019|gb|EGI08256.1| 50S ribosomal protein L10 [Escherichia coli H736]
 gi|331041304|gb|EGI13456.1| 50S ribosomal protein L10 [Escherichia coli M605]
 gi|331046607|gb|EGI18694.1| 50S ribosomal protein L10 [Escherichia coli M718]
 gi|331052327|gb|EGI24365.1| 50S ribosomal protein L10 [Escherichia coli TA206]
 gi|331057157|gb|EGI29149.1| 50S ribosomal protein L10 [Escherichia coli TA143]
 gi|331061925|gb|EGI33849.1| 50S ribosomal protein L10 [Escherichia coli TA271]
 gi|331067349|gb|EGI38755.1| 50S ribosomal protein L10 [Escherichia coli TA280]
 gi|331072260|gb|EGI43594.1| 50S ribosomal protein L10 [Escherichia coli H591]
 gi|331077036|gb|EGI48252.1| 50S ribosomal protein L10 [Escherichia coli H299]
 gi|332083873|gb|EGI89086.1| ribosomal protein L10 family protein [Shigella boydii 5216-82]
 gi|332091075|gb|EGI96165.1| ribosomal protein L10 family protein [Shigella dysenteriae 155-74]
 gi|332092327|gb|EGI97402.1| ribosomal protein L10 family protein [Shigella boydii 3594-74]
 gi|332105289|gb|EGJ08635.1| ribosomal protein L10 [Shigella sp. D9]
          Length = 165

 Score = 82.0 bits (201), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 49/154 (31%), Positives = 88/154 (57%), Gaps = 2/154 (1%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           +N Q K   ++E+S++   + S VVA  +G++V ++ +LRK  REAG  ++V +N L++ 
Sbjct: 3   LNLQDKQAIVAEVSEVAKGALSAVVADSRGVTVDKMTELRKAGREAGVYMRVVRNTLLRR 62

Query: 61  AIRDTSIRGISDLFVGQSLIVYS-DSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
           A+  T    + D FVG +LI YS + P  A ++   F+  N +F V     E  ++    
Sbjct: 63  AVEGTPFECLKDAFVGPTLIAYSMEHPGAAARLFKEFAKANAKFEVKAAAFEGELIPASQ 122

Query: 120 IKQIASLPDLEGIRAGIISAI-QSNATRLVRLLG 152
           I ++A+LP  E   A +++ + +++A +LVR L 
Sbjct: 123 IDRLATLPTYEEAIARLMATMKEASAGKLVRTLA 156


>gi|197286616|ref|YP_002152488.1| 50S ribosomal protein L10 [Proteus mirabilis HI4320]
 gi|227355191|ref|ZP_03839600.1| 50S ribosomal subunit protein L10 [Proteus mirabilis ATCC 29906]
 gi|226699987|sp|B4EYV1|RL10_PROMH RecName: Full=50S ribosomal protein L10
 gi|194684103|emb|CAR45499.1| 50S ribosomal subunit protein L10 [Proteus mirabilis HI4320]
 gi|227164700|gb|EEI49554.1| 50S ribosomal subunit protein L10 [Proteus mirabilis ATCC 29906]
          Length = 165

 Score = 82.0 bits (201), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 51/159 (32%), Positives = 89/159 (55%), Gaps = 2/159 (1%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           +N Q K   ++E+S++   + S VVA  +G++V ++ +LRK  REAG  V+V +N L++ 
Sbjct: 3   LNLQDKQAIVAEVSEVAKGALSAVVADSRGVTVDKMTELRKACREAGVTVRVVRNTLLRR 62

Query: 61  AIRDTSIRGISDLFVGQSLIVY-SDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
           A+  TS   + D FVG +LI + S+ P  A ++   F+  N  F +     E   +   +
Sbjct: 63  AVEGTSYEVLKDAFVGPTLIAFSSEHPGAAARLFKDFAKANPAFEIKAAAFEGEFIPGSN 122

Query: 120 IKQIASLPDLEGIRAGIISAI-QSNATRLVRLLGTPQTQ 157
           I ++A+LP  E   A ++S + ++ A +LVR L   + Q
Sbjct: 123 IDRLATLPTYEEAIARLMSTMKEAAAGKLVRTLAALRDQ 161


>gi|227522464|ref|ZP_03952513.1| ribosomal protein L10 [Lactobacillus hilgardii ATCC 8290]
 gi|227090416|gb|EEI25728.1| ribosomal protein L10 [Lactobacillus hilgardii ATCC 8290]
          Length = 174

 Score = 82.0 bits (201), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 49/167 (29%), Positives = 87/167 (52%), Gaps = 12/167 (7%)

Query: 6   KSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDT 65
           K+ ++ E ++   ++ SIVV  Y+G++VA++ DLRK++R+ G  ++V KN+++  A    
Sbjct: 12  KAKKVEEATESIKAASSIVVVDYRGLTVAEVTDLRKQLRDEGVKMQVIKNKVLVRAAEKA 71

Query: 66  SIRGISDLFVGQSLIVY-SDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIA 124
            +  + D F G + +V+ S+ PV  PKI  +F+  N+   + GGV++  V   D I   A
Sbjct: 72  GLDDLKDTFAGPTAVVFSSEDPVAGPKIVHNFAKINDALELKGGVIDGKVATLDEINAYA 131

Query: 125 SLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQQ 171
           +LP  E +            + L  +L  P       + A  DK Q+
Sbjct: 132 ALPSREEL-----------LSTLSNILQAPVRNFAYGVKAIADKKQE 167


>gi|254424271|ref|ZP_05037989.1| ribosomal protein L10, putative [Synechococcus sp. PCC 7335]
 gi|196191760|gb|EDX86724.1| ribosomal protein L10, putative [Synechococcus sp. PCC 7335]
          Length = 173

 Score = 82.0 bits (201), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 52/162 (32%), Positives = 85/162 (52%), Gaps = 2/162 (1%)

Query: 10  ISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTS-IR 68
           ++E+  +  +S S  V  YKG+SVAQI DLR ++RE+G   K++KN L+K AI D    +
Sbjct: 12  VAEMKDLLEASESAFVIDYKGLSVAQISDLRGRLRESGATCKISKNTLLKRAIADQDQWQ 71

Query: 69  GISDLFVGQSLIVYSDSPV-IAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASLP 127
            +  L  G S ++ +   +  A K    F  D  +  + GGV+E  +L+Q   + +A LP
Sbjct: 72  ELESLLTGTSAVLLTKEDIGSAVKAYKKFQKDTKKTELRGGVLEGKLLSQKDAEALADLP 131

Query: 128 DLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKN 169
             + + A I   I + AT+L   +      + R I A+ +K 
Sbjct: 132 TKDELYAKIAVGINAVATKLALGIKEVPASIGRGIKAYAEKE 173


>gi|296168508|ref|ZP_06850324.1| 50S ribosomal protein L10 [Mycobacterium parascrofulaceum ATCC
           BAA-614]
 gi|295896686|gb|EFG76323.1| 50S ribosomal protein L10 [Mycobacterium parascrofulaceum ATCC
           BAA-614]
          Length = 205

 Score = 82.0 bits (201), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 45/169 (26%), Positives = 90/169 (53%), Gaps = 2/169 (1%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M R  K+  ++++++ F  + + ++  Y+G++VA + +LR+ +        VAKN L+K 
Sbjct: 1   MARADKATAVADIAEQFREATATLITEYRGLTVANLAELRRSL-SGSATYSVAKNTLIKR 59

Query: 61  AIRDTSIRGISDLFVGQSLIVY-SDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
           A  +  + G+ +LF G + I + +  PV A K   +F+ DN    + GG ++   L+   
Sbjct: 60  AASEAGVEGLDELFAGPTAIAFVTGEPVDAAKAIKTFAKDNKALVIKGGYMDGRALSVAE 119

Query: 120 IKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDK 168
           +++IA L   E + A +  A++ N  +   L   P +Q+ R ++A  +K
Sbjct: 120 VERIADLESREVLLAKLAGAMKGNLAKAAGLFNAPASQMARLLAALQEK 168


>gi|227115005|ref|ZP_03828661.1| 50S ribosomal protein L10 [Pectobacterium carotovorum subsp.
           brasiliensis PBR1692]
 gi|227328362|ref|ZP_03832386.1| 50S ribosomal protein L10 [Pectobacterium carotovorum subsp.
           carotovorum WPP14]
          Length = 165

 Score = 82.0 bits (201), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 49/154 (31%), Positives = 85/154 (55%), Gaps = 2/154 (1%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           +N Q K   ++E+S++   + S VVA  +G++V ++ +LRK  REAG  ++V +N L++ 
Sbjct: 3   LNLQDKQAIVAEVSEVAKGALSAVVADSRGVTVDKMTELRKAAREAGVYMRVVRNTLLRR 62

Query: 61  AIRDTSIRGISDLFVGQSLIVYS-DSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
            +  T    + D FVG +LI YS + P  A ++   F+  N +F V     E  ++    
Sbjct: 63  VVEGTQFECLKDTFVGPTLIAYSLEHPGAAARLFKEFAKANAKFEVKAAAFEGELIPAAQ 122

Query: 120 IKQIASLPDLEGIRAGIISAIQSNAT-RLVRLLG 152
           I ++A+LP  E   A ++S ++  A  +LVR L 
Sbjct: 123 IDRLATLPTYEEALARLMSTMKEAAAGKLVRTLA 156


>gi|283769317|ref|ZP_06342217.1| ribosomal protein L10 [Bulleidia extructa W1219]
 gi|283104093|gb|EFC05476.1| ribosomal protein L10 [Bulleidia extructa W1219]
          Length = 181

 Score = 82.0 bits (201), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 40/142 (28%), Positives = 81/142 (57%)

Query: 10  ISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRG 69
           +SE+ +  + S S V+A Y+G+SV ++ +LR+K+R  G   KV KN L   A        
Sbjct: 13  VSEIQEKLTKSSSSVIAEYRGLSVEEVTELRRKLRAEGIEFKVYKNTLASRAAEAAGFAD 72

Query: 70  ISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASLPDL 129
           ++D   G + I +++    A ++   F+ D+    + GG+VE  V+  ++IK++++LP+ 
Sbjct: 73  LNDYLTGPNAIAFAEDETSAARVLAKFAKDHKALVLKGGIVEGAVVTPETIKELSALPNR 132

Query: 130 EGIRAGIISAIQSNATRLVRLL 151
           EG+ + ++S + +  +   R++
Sbjct: 133 EGMLSMLLSVLNAPVSGFARVV 154


>gi|330723561|gb|AEC45931.1| 50S ribosomal protein L10 [Mycoplasma hyorhinis MCLD]
          Length = 165

 Score = 82.0 bits (201), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 45/129 (34%), Positives = 75/129 (58%), Gaps = 1/129 (0%)

Query: 3   RQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAI 62
           R+ K   + E+  + +SS S+V+A Y+G++VA+I+ LR +++EAG  VKV KNRL KIA 
Sbjct: 5   RKKKEELVQEIKDLINSSSSLVIAEYRGLTVAEIETLRNELKEAGVFVKVYKNRLFKIAS 64

Query: 63  RDTSIRGISDLFVGQSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIK 121
           ++     +    VG +   +  +  IAP KI   F+  N    + GG+ E  V +   ++
Sbjct: 65  KEAGFGDLEQSLVGPNFFAFGSTDAIAPAKIISKFAKTNPVVVLKGGIFEGKVADAQEMQ 124

Query: 122 QIASLPDLE 130
            +A+LP+ E
Sbjct: 125 TVATLPNYE 133


>gi|329770376|ref|ZP_08261758.1| 50S ribosomal protein L10 [Gemella sanguinis M325]
 gi|328836499|gb|EGF86159.1| 50S ribosomal protein L10 [Gemella sanguinis M325]
          Length = 166

 Score = 82.0 bits (201), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 46/160 (28%), Positives = 84/160 (52%), Gaps = 12/160 (7%)

Query: 10  ISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRG 69
           ++++++   +S S+V+A Y+G++V+++ +LR  MR  G   KV KN LV+ A+    I G
Sbjct: 12  VNQIAEEIKASTSVVIADYRGLNVSEVTELRNNMRNEGLTFKVYKNSLVRRAMEQAGIEG 71

Query: 70  ISDLFVGQSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASLPD 128
           + ++  G +   +S    +AP ++   F+  +    +  GV+E  V +Q  IK IASLP 
Sbjct: 72  LDEVLTGPNAFAFSTDDAVAPARVLNDFAKQHENLELKAGVIEGKVTDQAEIKAIASLPS 131

Query: 129 LEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDK 168
            EG+ + ++S           +L  P      A+ A  D+
Sbjct: 132 REGLLSMLLS-----------VLTAPMRNTALAVKAVADQ 160


>gi|297159571|gb|ADI09283.1| 50S ribosomal protein L10 [Streptomyces bingchenggensis BCW-1]
          Length = 185

 Score = 82.0 bits (201), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 54/173 (31%), Positives = 89/173 (51%), Gaps = 3/173 (1%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M R  K   + E++  F +S + +V  Y G++VAQ+K+LR+ + E     +V KN L KI
Sbjct: 1   MARPDKVAAVEEMTDKFRNSNAALVTAYTGLTVAQLKELRRSLGE-NAQYRVVKNTLTKI 59

Query: 61  AIRDTSIRGISDLFVGQSLIVY-SDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
           A  +  I  + DLF G S + + +  PV A K    F+ +N    + GGV++   L+ D 
Sbjct: 60  AANEAGISTLDDLFAGSSAVAFVTGDPVEAAKGLRDFAKENPALVIKGGVLDGKALSADE 119

Query: 120 IKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAF-VDKNQQ 171
           IK++A L   E + A +  A++   ++   L     ++ VR   A  V K +Q
Sbjct: 120 IKKLADLESREVLLAKLAGAMKGKQSQAAALFQALPSKFVRTAEALRVKKEEQ 172


>gi|238922788|ref|YP_002936301.1| 50S ribosomal protein L10 [Eubacterium rectale ATCC 33656]
 gi|238874460|gb|ACR74167.1| 50S ribosomal protein L10 [Eubacterium rectale ATCC 33656]
          Length = 183

 Score = 82.0 bits (201), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 49/143 (34%), Positives = 77/143 (53%), Gaps = 1/143 (0%)

Query: 10  ISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRG 69
           + E+S + + + S+VV  Y G++VA+   LRK++REAG   KV KN LV  AI+ T   G
Sbjct: 11  VDEISGVINGAQSVVVVDYLGLTVAEDTQLRKQLREAGVTYKVYKNTLVNRAIQGTEFEG 70

Query: 70  ISDLFVGQSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASLPD 128
           + D+  G S    S     AP +I   F+       +  GVVE    + + +K IA++P 
Sbjct: 71  LKDVLEGPSAFAVSTEDATAPARILAKFAKTAPALEIKAGVVEGTFYDAEGMKAIAAVPS 130

Query: 129 LEGIRAGIISAIQSNATRLVRLL 151
            + +   ++ +IQS  T L R+L
Sbjct: 131 RDELLGKLLGSIQSPITNLARVL 153


>gi|297569431|ref|YP_003690775.1| ribosomal protein L10 [Desulfurivibrio alkaliphilus AHT2]
 gi|296925346|gb|ADH86156.1| ribosomal protein L10 [Desulfurivibrio alkaliphilus AHT2]
          Length = 174

 Score = 81.6 bits (200), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 50/173 (28%), Positives = 94/173 (54%), Gaps = 3/173 (1%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M R+ K+  + ELS  F+ +   V+  Y+G++V+ ++ LR+++R+    +KVAKN L+  
Sbjct: 1   MKREEKAEVVQELSASFAKAKLAVLTDYRGLTVSSMQQLRRELRDISAELKVAKNTLLNR 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
           AI+ T    +S    G + +  S+   +AP K+   F+ DN +  +   V++   L  D 
Sbjct: 61  AIQGTPFEPLSGHLKGNTALTLSEVDPVAPAKVLTKFAKDNPKLVIKTAVLDGKELTPDD 120

Query: 120 IKQIASLPDLEGIRAGIISAIQSNATRLVRLL-GTPQTQVVRAISAFVDKNQQ 171
           +  ++ LP +  +RA  +  +Q+  T  VR+L G PQ + V  + A  ++ +Q
Sbjct: 121 LTALSKLPGINELRAQFLGLLQAVPTGFVRVLNGVPQ-KAVYLLQAIKEQKEQ 172


>gi|238790614|ref|ZP_04634379.1| 50S ribosomal protein L10 [Yersinia frederiksenii ATCC 33641]
 gi|238721283|gb|EEQ12958.1| 50S ribosomal protein L10 [Yersinia frederiksenii ATCC 33641]
          Length = 165

 Score = 81.6 bits (200), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 49/159 (30%), Positives = 89/159 (55%), Gaps = 2/159 (1%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           +N QGK   ++E+ ++   + S VVA  +G++V ++ +LRK  REAG  ++V +N L++ 
Sbjct: 3   LNLQGKQAIVAEVKEVAKGALSAVVADSRGVTVDKMTELRKAGREAGVHMQVVRNTLLRR 62

Query: 61  AIRDTSIRGISDLFVGQSLIVY-SDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
            +  T    + D FVG +LI + S+ P  A ++  +F+ DN +F V     E  ++    
Sbjct: 63  IVEGTPFECLKDTFVGPTLIAFSSEHPGAAARLFKAFAKDNAKFEVKAAAFEGELIPAAQ 122

Query: 120 IKQIASLPDLEGIRAGIISAI-QSNATRLVRLLGTPQTQ 157
           I ++A+LP  E   A ++  + ++ A +LVR L   + Q
Sbjct: 123 IDRLATLPTYEEAIAKLMGTMKEAAAGKLVRTLAALRDQ 161


>gi|158317801|ref|YP_001510309.1| 50S ribosomal protein L10 [Frankia sp. EAN1pec]
 gi|226699953|sp|A8LC66|RL10_FRASN RecName: Full=50S ribosomal protein L10
 gi|158113206|gb|ABW15403.1| ribosomal protein L10 [Frankia sp. EAN1pec]
          Length = 182

 Score = 81.6 bits (200), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 52/172 (30%), Positives = 87/172 (50%), Gaps = 2/172 (1%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M    K+  ++E+++ F  S + V+  Y+G++V+Q+ +LR+ + E      V KN L KI
Sbjct: 1   MANSEKTAAVAEIAEDFRGSSAAVLTEYRGLTVSQLTELRRALGETTR-YAVVKNTLTKI 59

Query: 61  AIRDTSIRGISDLFVGQSLIVY-SDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
           A     + GI +L VG + + +    PV A K    F+  N    V GGVVE   +N D 
Sbjct: 60  AAAQAGVTGIDELLVGPTAVAFVGGDPVEAAKGLRDFARANPALVVKGGVVEGKAMNADE 119

Query: 120 IKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQQ 171
           I+++A L   E + A +  A+  +  + V L   P +QV R   A   + ++
Sbjct: 120 IRRLADLESREVLLAKMAGAMNGSLAKAVGLFAAPLSQVARLAEALRAQREE 171


>gi|228475273|ref|ZP_04059998.1| 50S ribosomal protein L10 [Staphylococcus hominis SK119]
 gi|314937156|ref|ZP_07844503.1| ribosomal protein L10 [Staphylococcus hominis subsp. hominis C80]
 gi|228270738|gb|EEK12147.1| 50S ribosomal protein L10 [Staphylococcus hominis SK119]
 gi|313655775|gb|EFS19520.1| ribosomal protein L10 [Staphylococcus hominis subsp. hominis C80]
          Length = 166

 Score = 81.6 bits (200), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 42/140 (30%), Positives = 81/140 (57%), Gaps = 1/140 (0%)

Query: 4   QGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIR 63
           + K  ++  +++   +S S V+  Y+G++VA++ DLR ++REAG   KV KN LV+ A  
Sbjct: 6   EAKKQQVDVIAEQLKNSVSTVIVDYRGLTVAEVTDLRAQLREAGVEYKVYKNTLVRRAAE 65

Query: 64  DTSIRGISDLFVGQSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQ 122
              I G+ +   G + I  +   V+AP K+   F+ ++    +  GV+E  V++ + +K 
Sbjct: 66  KAGIEGLDEFLTGPTAIATTTDDVVAPAKVISGFAKEHEALEIKTGVMEGNVISAEEVKT 125

Query: 123 IASLPDLEGIRAGIISAIQS 142
           + SLP  +G+ + ++S +Q+
Sbjct: 126 VGSLPSHDGLVSMLLSVLQA 145


>gi|297181150|gb|ADI17347.1| hypothetical protein [uncultured Oceanospirillales bacterium
           HF0070_21F08]
          Length = 177

 Score = 81.6 bits (200), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 55/176 (31%), Positives = 91/176 (51%), Gaps = 9/176 (5%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           +N + K   +  ++   S + S VVA Y+G+SVAQ+ DLR K RE G  +KV +N L K 
Sbjct: 3   LNLEDKRAIVVSVNAAASEALSAVVADYRGLSVAQMTDLRHKARETGVYLKVVRNTLAKR 62

Query: 61  AIRDTSIRGISDLFVGQSLIVYS-DSPVIAPKISVSFSNDNNEFRV----LGGVVEKGVL 115
           A+  T    ++D  VG +++ +S + P  A ++   F+ D++   V    +GGV      
Sbjct: 63  AVEGTDYECLTDALVGPTVLAFSQEDPGAAARLIKDFAKDHDALEVKALAIGGV----AY 118

Query: 116 NQDSIKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQQ 171
               I  +A LP  +   A ++S +Q+   + VR L     + VR ++A  D+ QQ
Sbjct: 119 GAKDIDILAKLPTRDEAIAQLMSVMQAPVAKFVRTLNEVPGKFVRTMAAVKDQKQQ 174


>gi|145294637|ref|YP_001137458.1| 50S ribosomal protein L10 [Corynebacterium glutamicum R]
 gi|166229721|sp|A4QBF9|RL10_CORGB RecName: Full=50S ribosomal protein L10
 gi|140844557|dbj|BAF53556.1| hypothetical protein [Corynebacterium glutamicum R]
          Length = 171

 Score = 81.6 bits (200), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 51/162 (31%), Positives = 82/162 (50%), Gaps = 6/162 (3%)

Query: 10  ISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVK--VAKNRLVKIAIRDTSI 67
           ++EL   F+ + ++V+  Y+G++VAQ  +LRK +   G  V+  VAKN LVKIA  +  I
Sbjct: 10  LAELKARFAETDTVVLTEYRGLTVAQTTELRKAL---GFDVQYSVAKNTLVKIAANEAGI 66

Query: 68  RGISDLFVGQSLIVY-SDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASL 126
            G+ DL  G + + +     V   K+   F  +N  F V GG ++   L  + +  IA L
Sbjct: 67  EGLDDLLTGPTAVAFIKGEAVDTAKVLKKFGEENKAFVVKGGYMDGNALTAEQVNAIAEL 126

Query: 127 PDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDK 168
            + E   A +  A++ +  +   L   P +QV R   A  DK
Sbjct: 127 DNRETTLAKLAGAMKGSLAKAAGLFNAPASQVARLAVALQDK 168


>gi|41581794|gb|AAS07738.1| RplJ [Amycolatopsis mediterranei S699]
          Length = 191

 Score = 81.6 bits (200), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 55/170 (32%), Positives = 91/170 (53%), Gaps = 2/170 (1%)

Query: 2   NRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIA 61
           +R+   V+ S +++ F +S + VV  Y G+SV+Q+  LR+ +  +    +VAKN LVK A
Sbjct: 9   DRKAGVVQPSSIAESFRTSSATVVTQYTGLSVSQLSQLRRALGTSAK-YRVAKNTLVKRA 67

Query: 62  IRDTSIRGISDLFVGQSLIVYSDSPVI-APKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
             D  I+G+ DLFVG + I + +   + A K    F+ DNN   + GG ++   L+ D I
Sbjct: 68  AEDAGIQGLEDLFVGATAIAFVEGEAVDAAKAIRDFAKDNNALVIKGGYMDGRALSVDEI 127

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQ 170
            +IA L   E + A    A ++  ++   L   P +QV R  +A  +K +
Sbjct: 128 NRIADLDSREVLLAKAAGAFKAKLSQAAALFQAPASQVARLAAALEEKQR 177


>gi|270160338|ref|ZP_06188991.1| 50S ribosomal protein L10 [Legionella longbeachae D-4968]
 gi|289163821|ref|YP_003453959.1| 50S ribosomal subunit protein L10 [Legionella longbeachae NSW150]
 gi|269987150|gb|EEZ93408.1| 50S ribosomal protein L10 [Legionella longbeachae D-4968]
 gi|288856994|emb|CBJ10808.1| 50S ribosomal subunit protein L10 [Legionella longbeachae NSW150]
          Length = 174

 Score = 81.6 bits (200), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 49/169 (28%), Positives = 89/169 (52%), Gaps = 1/169 (0%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           +N   K   + E++ + S + S VVA Y+G++V Q+  LR + R++G  ++V +N L + 
Sbjct: 3   LNLAAKKAVVEEVTAVASKAISAVVADYRGLTVNQMTHLRSEARKSGVYLRVVRNTLTRR 62

Query: 61  AIRDTSIRGISDLFVGQSLIVYS-DSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
           A ++T    ++DL VG   +  S ++P  A ++   FS    +  V    V   V + D 
Sbjct: 63  AFKNTEFECLNDLLVGPLFVALSLEAPSDAARLLKEFSKTFEKLEVKALSVGGKVYSADQ 122

Query: 120 IKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDK 168
           I  +ASLP  +   A ++  +++   + VR L  P  ++VR ++A  DK
Sbjct: 123 IDAVASLPTRDEAIAKLMYVMKAPVEKFVRTLAEPHAKLVRTLAAVKDK 171


>gi|238752787|ref|ZP_04614255.1| 50S ribosomal protein L10 [Yersinia rohdei ATCC 43380]
 gi|238765327|ref|ZP_04626253.1| 50S ribosomal protein L10 [Yersinia kristensenii ATCC 33638]
 gi|238696454|gb|EEP89245.1| 50S ribosomal protein L10 [Yersinia kristensenii ATCC 33638]
 gi|238708985|gb|EEQ01235.1| 50S ribosomal protein L10 [Yersinia rohdei ATCC 43380]
          Length = 167

 Score = 81.6 bits (200), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 49/159 (30%), Positives = 89/159 (55%), Gaps = 2/159 (1%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           +N QGK   ++E+ ++   + S VVA  +G++V ++ +LRK  REAG  ++V +N L++ 
Sbjct: 3   LNLQGKQAIVAEVKEVAKGALSAVVADSRGVTVDKMTELRKAGREAGVHMQVVRNTLLRR 62

Query: 61  AIRDTSIRGISDLFVGQSLIVY-SDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
            +  T    + D FVG +LI + S+ P  A ++  +F+ DN +F V     E  ++    
Sbjct: 63  IVEGTPFECLKDTFVGPTLIAFSSEHPGAAARLFKAFAKDNAKFEVKAAAFEGELIPAAQ 122

Query: 120 IKQIASLPDLEGIRAGIISAI-QSNATRLVRLLGTPQTQ 157
           I ++A+LP  E   A ++  + ++ A +LVR L   + Q
Sbjct: 123 IDRLATLPTYEEAIARLMGTMKEAAAGKLVRTLAALRDQ 161


>gi|291615766|ref|YP_003518508.1| RplJ [Pantoea ananatis LMG 20103]
 gi|304399301|ref|ZP_07381166.1| ribosomal protein L10 [Pantoea sp. aB]
 gi|308188906|ref|YP_003933037.1| 50S ribosomal protein L10 [Pantoea vagans C9-1]
 gi|291150796|gb|ADD75380.1| RplJ [Pantoea ananatis LMG 20103]
 gi|304353157|gb|EFM17539.1| ribosomal protein L10 [Pantoea sp. aB]
 gi|308059416|gb|ADO11588.1| 50S ribosomal protein L10 [Pantoea vagans C9-1]
 gi|327396032|dbj|BAK13454.1| 50S ribosomal protein L10 RplJ [Pantoea ananatis AJ13355]
          Length = 165

 Score = 81.6 bits (200), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 49/154 (31%), Positives = 86/154 (55%), Gaps = 2/154 (1%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           +N Q K   ++E+S++   + S VVA  +G++V ++ +LRK  REAG  ++V +N L++ 
Sbjct: 3   LNLQDKQAIVAEVSEVAKGALSAVVADSRGVTVDKMTELRKAGREAGVYMRVVRNTLLRR 62

Query: 61  AIRDTSIRGISDLFVGQSLIVYS-DSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
            +  T    + D FVG +LI YS + P  A ++   F+  N +F V     E  ++   +
Sbjct: 63  VVEGTQFECLKDTFVGPTLIAYSMEHPGAAARLFKDFAKANAKFEVKAAAFEGELITAAN 122

Query: 120 IKQIASLPDLEGIRAGIISAIQSNAT-RLVRLLG 152
           I ++A+LP  E   A ++S ++  A  +LVR L 
Sbjct: 123 IDRLATLPTYEEALARLMSTMKEAAAGKLVRTLA 156


>gi|238798661|ref|ZP_04642135.1| 50S ribosomal protein L10 [Yersinia mollaretii ATCC 43969]
 gi|238717479|gb|EEQ09321.1| 50S ribosomal protein L10 [Yersinia mollaretii ATCC 43969]
          Length = 167

 Score = 81.6 bits (200), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 49/159 (30%), Positives = 89/159 (55%), Gaps = 2/159 (1%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           +N QGK   ++E+ ++   + S VVA  +G++V ++ +LRK  REAG  ++V +N L++ 
Sbjct: 3   LNLQGKQAIVAEVKEVAKGALSAVVADSRGVTVDKMTELRKAGREAGVHMQVVRNTLLRR 62

Query: 61  AIRDTSIRGISDLFVGQSLIVYS-DSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
            +  T    + D FVG +LI +S + P  A ++  +F+ DN +F V     E  ++    
Sbjct: 63  IVEGTPFECLKDTFVGPTLIAFSTEHPGAAARLFKAFAKDNAKFEVKAAAFEGELIPAAQ 122

Query: 120 IKQIASLPDLEGIRAGIISAI-QSNATRLVRLLGTPQTQ 157
           I ++A+LP  E   A ++  + ++ A +LVR L   + Q
Sbjct: 123 IDRLATLPTYEEAIARLMGTMKEAAAGKLVRTLAALRDQ 161


>gi|71905952|ref|YP_283539.1| 50S ribosomal protein L10 [Dechloromonas aromatica RCB]
 gi|97181615|sp|Q47JB2|RL10_DECAR RecName: Full=50S ribosomal protein L10
 gi|71845573|gb|AAZ45069.1| LSU ribosomal protein L10P [Dechloromonas aromatica RCB]
          Length = 165

 Score = 81.6 bits (200), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 48/157 (30%), Positives = 85/157 (54%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           +N   K   ++E+S   +++ +IV+A Y+GI V  +  LRKK RE+G  ++V KN LV+ 
Sbjct: 3   LNLNDKKAVVAEVSAQVANAQTIVIAEYRGIEVTDLTVLRKKARESGVYLRVLKNTLVRR 62

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A+ DT+   ++D  VG  +   S  PV A K+   F+  N++  +  G     VL++  +
Sbjct: 63  AVADTAFAALADHMVGPLIYSVSADPVAAAKVLSDFAKSNDKLVLKAGSYAGKVLDKAGV 122

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQ 157
           + +AS+P  E + + ++  +Q+     VR L     Q
Sbjct: 123 QALASVPSREELLSKLLYVMQAPVAGFVRGLAALAAQ 159


>gi|302559016|ref|ZP_07311358.1| ribosomal protein L10 [Streptomyces griseoflavus Tu4000]
 gi|302476634|gb|EFL39727.1| ribosomal protein L10 [Streptomyces griseoflavus Tu4000]
          Length = 176

 Score = 81.3 bits (199), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 52/174 (29%), Positives = 91/174 (52%), Gaps = 3/174 (1%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M R  K+  ++EL+  F SS + V+  Y+G++VAQ+K LR+ + E      V KN L KI
Sbjct: 1   MARPDKAAAVAELTDKFRSSNAAVLTEYRGLTVAQLKTLRRSLGE-NAQYAVVKNTLTKI 59

Query: 61  AIRDTSIRGISDLFVGQSLIVY-SDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
           A  +  I     LF G + + + +  PV + K    F+ DN    + GGV++   ++ D 
Sbjct: 60  AANEAGITLDDQLFAGPTAVAFVTGDPVESAKGLRDFAKDNPNLVIKGGVLDGKAMSADE 119

Query: 120 IKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAF-VDKNQQG 172
           IK++A L   E + + +  A +   T+  +L     +++VR + A    +++QG
Sbjct: 120 IKKLADLESREVLLSKLAGAFKGKQTQTAQLFQALPSKLVRTVDALRAKQDEQG 173


>gi|148263132|ref|YP_001229838.1| 50S ribosomal protein L10 [Geobacter uraniireducens Rf4]
 gi|189040917|sp|A5GAX9|RL10_GEOUR RecName: Full=50S ribosomal protein L10
 gi|146396632|gb|ABQ25265.1| LSU ribosomal protein L10P [Geobacter uraniireducens Rf4]
          Length = 174

 Score = 81.3 bits (199), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 49/166 (29%), Positives = 91/166 (54%), Gaps = 2/166 (1%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           MN++GK   ++E+      + ++ +A ++G++V Q  DLR ++R+A    KV KN L+++
Sbjct: 1   MNKEGKHQLVAEVHDKLQRAKAVFLADFRGMNVGQATDLRNELRKADVEYKVIKNTLLEL 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYS-DSPVIAPKISVSFSND-NNEFRVLGGVVEKGVLNQD 118
           A + T    ++  F G + +  S D PV A K+   F+ +  N F +  GV+    ++  
Sbjct: 61  ASKGTDKEALNPYFAGPTAVAISYDDPVAAAKVLSRFAKEQTNPFTLKAGVLSGKAISPA 120

Query: 119 SIKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISA 164
            I+ +A LP  E + A ++ ++Q+ AT  V +L       VRA++A
Sbjct: 121 DIQALADLPSREVLIAKMLGSMQAPATNFVGVLAAVPGSFVRALNA 166


>gi|327333168|gb|EGE74895.1| ribosomal protein L10 [Propionibacterium acnes HL097PA1]
          Length = 204

 Score = 81.3 bits (199), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 50/169 (29%), Positives = 91/169 (53%), Gaps = 2/169 (1%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M R  K   ++EL + FSS+ + V+  Y+G+SV+  KDLR+ +  +     VAKN L +I
Sbjct: 1   MARPDKVAAVAELREKFSSADATVLTEYRGLSVSAFKDLRRSLG-SDATYAVAKNTLTRI 59

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIA-PKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
           A ++  I G+ D  VG + + + +  V +  K   +F+ DN    + GGV++  VL+ D 
Sbjct: 60  AAKEAGIEGLDDQLVGPTALAFINGDVASVAKGLKNFAKDNPLLVIKGGVMDGNVLDADQ 119

Query: 120 IKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDK 168
           +K++A L   E + A +   +++N T+   +     ++  R + A  +K
Sbjct: 120 VKKLADLESREVLLAKLAGGLKANLTKAAVVFNALPSKAARGLGALQEK 168


>gi|294790459|ref|ZP_06755617.1| ribosomal protein L10 [Scardovia inopinata F0304]
 gi|294458356|gb|EFG26709.1| ribosomal protein L10 [Scardovia inopinata F0304]
          Length = 173

 Score = 81.3 bits (199), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 50/173 (28%), Positives = 86/173 (49%), Gaps = 2/173 (1%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M R  K   IS+L+  F  + +I +  Y+G+SV QI +LR+K+        VAKN L +I
Sbjct: 1   MRRPEKGEMISKLTDKFRDADAIYLTEYRGLSVPQITELREKL-GTDTTYNVAKNTLARI 59

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVI-APKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
           A ++  I G+ DLF G S + +     + A K+   F+ DN +  V GG  +  V + + 
Sbjct: 60  AAKEAGIEGLDDLFKGPSAVTFVKGDYVQAAKVLRDFAKDNKQLVVKGGFADGTVYDAEG 119

Query: 120 IKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQQG 172
           + ++A L   E + A +  A++    +         T+ VR + A  +K ++ 
Sbjct: 120 VSKLADLESRETLLAKMAGALKGTMAKAAYAFVALPTKAVRTVDALREKQEKA 172


>gi|304372856|ref|YP_003856065.1| 50S ribosomal protein L10 [Mycoplasma hyorhinis HUB-1]
 gi|304309047|gb|ADM21527.1| 50S ribosomal protein L10 [Mycoplasma hyorhinis HUB-1]
          Length = 182

 Score = 81.3 bits (199), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 44/129 (34%), Positives = 75/129 (58%), Gaps = 1/129 (0%)

Query: 3   RQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAI 62
           R+ K   + E+  + +SS S+V+A Y+G++VA+++ LR +++EAG  VKV KNRL KIA 
Sbjct: 22  RKKKEELVQEIKDLINSSSSLVIAEYRGLTVAEVETLRNELKEAGVFVKVYKNRLFKIAS 81

Query: 63  RDTSIRGISDLFVGQSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIK 121
           ++     +    VG +   +  +  IAP KI   F+  N    + GG+ E  V +   ++
Sbjct: 82  KEAGFGDLEQSLVGPNFFAFGSTDAIAPAKIISKFAKTNPVVVLKGGIFEGKVADAQEMQ 141

Query: 122 QIASLPDLE 130
            +A+LP+ E
Sbjct: 142 TVATLPNYE 150


>gi|261344391|ref|ZP_05972035.1| ribosomal protein L10 [Providencia rustigianii DSM 4541]
 gi|282567664|gb|EFB73199.1| ribosomal protein L10 [Providencia rustigianii DSM 4541]
          Length = 165

 Score = 81.3 bits (199), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 49/159 (30%), Positives = 89/159 (55%), Gaps = 2/159 (1%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           +N Q K   ++E+S++   + S VVA  +G++VA++ +LRK  REAG  ++V +N L++ 
Sbjct: 3   LNLQDKQAIVAEVSEVAKGALSAVVADSRGVTVAKMTELRKAGREAGVYIRVVRNTLIRR 62

Query: 61  AIRDTSIRGISDLFVGQSLIVYS-DSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
           A+  TS   + D FVG +LI +S + P    ++   F+  N  F +     E  ++    
Sbjct: 63  AVEGTSYEVLKDAFVGPTLIAFSNEHPGAGARLFKEFAKANPAFEIKAAAFEGELIQAKD 122

Query: 120 IKQIASLPDLEGIRAGIISAI-QSNATRLVRLLGTPQTQ 157
           I ++A+LP  E   A +++ + ++ A +LVR L   + Q
Sbjct: 123 IDRLATLPTYEEAIARLMATMKEAAAGKLVRTLAALRDQ 161


>gi|227533715|ref|ZP_03963764.1| ribosomal protein L10 [Lactobacillus paracasei subsp. paracasei
           ATCC 25302]
 gi|227188699|gb|EEI68766.1| ribosomal protein L10 [Lactobacillus paracasei subsp. paracasei
           ATCC 25302]
          Length = 168

 Score = 81.3 bits (199), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 40/134 (29%), Positives = 81/134 (60%), Gaps = 1/134 (0%)

Query: 10  ISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRG 69
           +  +S+ F S+ S VV  Y G++V Q+  LRK++REAG  ++V KN  ++ A        
Sbjct: 13  VKSISEQFKSATSAVVVDYLGLTVEQVTALRKELREAGVKMEVLKNTYLRRAADANGYEA 72

Query: 70  ISDLFVGQSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASLPD 128
           + D+F G + + +S++  +AP +I   +++  +  ++ GG++E  V + D+I +++ +PD
Sbjct: 73  LDDVFKGPTAVAFSNNDPVAPARIMAKYADQFDALKIKGGIIENKVASLDTIMEMSKMPD 132

Query: 129 LEGIRAGIISAIQS 142
            EG+ + + S +Q+
Sbjct: 133 REGLLSQLASVLQA 146


>gi|237666987|ref|ZP_04526972.1| ribosomal protein L10 [Clostridium butyricum E4 str. BoNT E BL5262]
 gi|237658186|gb|EEP55741.1| ribosomal protein L10 [Clostridium butyricum E4 str. BoNT E BL5262]
          Length = 163

 Score = 81.3 bits (199), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 45/151 (29%), Positives = 86/151 (56%), Gaps = 1/151 (0%)

Query: 2   NRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIA 61
           NR  K  +++E+ +    + S+V++ Y+G++V +   LRK +REAG   KV KN LV +A
Sbjct: 4   NRSLKEAKVAEIKEKLEKANSVVLSQYQGLTVEEDTVLRKNLREAGVEYKVYKNTLVILA 63

Query: 62  IRDTSIRGISDLFVGQSLIVYSDSPV-IAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
            ++  + GI +   G   I +    V +A ++   F+ D+ +  +  G+VE  + + D I
Sbjct: 64  AKELGLEGIVEYLEGPVAIAFGYEDVTVAARVLNDFAKDHKKLELKAGIVEGEIYDTDKI 123

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLL 151
           KQ+A++P  E + A ++ +I+S  +   R++
Sbjct: 124 KQLATIPSKEVLIAKLLGSIKSPISSFARVI 154


>gi|307328016|ref|ZP_07607197.1| ribosomal protein L10 [Streptomyces violaceusniger Tu 4113]
 gi|306886321|gb|EFN17326.1| ribosomal protein L10 [Streptomyces violaceusniger Tu 4113]
          Length = 186

 Score = 81.3 bits (199), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 53/174 (30%), Positives = 90/174 (51%), Gaps = 3/174 (1%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M    K   + E+ + F +S + +V  Y G++VAQ+K+LR+ + E     +V KN L KI
Sbjct: 1   MASPDKVAAVDEMREKFRTSHAALVTAYTGLTVAQLKELRRSLGE-NVQYRVVKNTLTKI 59

Query: 61  AIRDTSIRGISDLFVGQSLIVY-SDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
           A  +  I  + DLF G S + + +  PV A K    F+ +N    + GGV++   L+ D 
Sbjct: 60  AANEAGINQLDDLFAGSSAVAFVTGDPVEAAKGLRDFAKENPALVIKGGVLDGKALSADE 119

Query: 120 IKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKN-QQG 172
           IK++A L   E + A +  A+++  ++   L   P ++ +R   A   K  +QG
Sbjct: 120 IKKLADLESREVLLAKLAGAMKAKQSQAAALFQAPLSKFIRTAEALRQKQAEQG 173


>gi|159896673|ref|YP_001542920.1| 50S ribosomal protein L10 [Herpetosiphon aurantiacus ATCC 23779]
 gi|226699962|sp|A9B5G7|RL10_HERA2 RecName: Full=50S ribosomal protein L10
 gi|159889712|gb|ABX02792.1| ribosomal protein L10 [Herpetosiphon aurantiacus ATCC 23779]
          Length = 174

 Score = 81.3 bits (199), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 50/174 (28%), Positives = 89/174 (51%), Gaps = 2/174 (1%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M  Q K   ++EL+   + +  ++VA Y+G++VA++ +LRKK+RE GG V +AKN L ++
Sbjct: 1   MPTQAKVATVAELTDRLNRAQMLLVADYRGLTVAELNELRKKVREKGGEVIIAKNTLTRL 60

Query: 61  AIRDTSIRGISDLFVGQSLIV--YSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQD 118
           A R+     I +   G + +   Y D P +A  I   F     + +V GG+V    +   
Sbjct: 61  AAREAGKTEIEEFLGGPTALAFSYDDIPGVAKAIDDFFKASKKDIKVKGGIVGTSKITGA 120

Query: 119 SIKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQQG 172
            ++++A +P  +   A I+  I + A+R+V  L      +   + A   K  +G
Sbjct: 121 DVERVAKMPTRDESLAKILGGINAPASRIVGGLKGVMRNIAYILGAHAQKGAEG 174


>gi|167465653|ref|ZP_02330742.1| 50S ribosomal protein L10 [Paenibacillus larvae subsp. larvae
           BRL-230010]
 gi|322381137|ref|ZP_08055140.1| 50S ribosomal protein L10-like protein [Paenibacillus larvae subsp.
           larvae B-3650]
 gi|321154713|gb|EFX46984.1| 50S ribosomal protein L10-like protein [Paenibacillus larvae subsp.
           larvae B-3650]
          Length = 171

 Score = 81.3 bits (199), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 48/168 (28%), Positives = 87/168 (51%), Gaps = 12/168 (7%)

Query: 6   KSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDT 65
           K  ++SE++  F  S   +V  Y+G++V+++ +L K +REAG   +V KN  ++ A  + 
Sbjct: 10  KEQQVSEVASKFQESSCAIVTDYRGLNVSEVTELCKALREAGVEFQVLKNTTLRRATANV 69

Query: 66  SIRGISDLFVGQSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIA 124
            +  ++  FVG + + +S   V+AP KI   F+  +    +  GVVE  V++   IK +A
Sbjct: 70  DLSDLNSHFVGPTAVAFSKEDVVAPAKILSDFAKKHENLEIKAGVVEGKVVDVSQIKALA 129

Query: 125 SLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQQG 172
            LP  EG+ + ++S +Q+           P      A+ A  +K + G
Sbjct: 130 ELPSREGLLSMLLSVLQA-----------PMRNFALAVKAVAEKQEGG 166


>gi|258512681|ref|YP_003186115.1| 50S ribosomal protein L10 [Alicyclobacillus acidocaldarius subsp.
           acidocaldarius DSM 446]
 gi|257479407|gb|ACV59726.1| ribosomal protein L10 [Alicyclobacillus acidocaldarius subsp.
           acidocaldarius DSM 446]
          Length = 170

 Score = 81.3 bits (199), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 46/133 (34%), Positives = 72/133 (54%), Gaps = 1/133 (0%)

Query: 20  SGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRGISDLFVGQSL 79
           S SIV+A Y+G++VA+  +LR ++R+AG    V KN L   A     I G+     G + 
Sbjct: 22  SKSIVLADYRGLTVAEDTELRARLRQAGIDYSVVKNTLTTRAAEQAEIEGLEPFLTGPTA 81

Query: 80  IVYS-DSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASLPDLEGIRAGIIS 138
           I +S D PV   KI   FS ++    + GG VE  V++   I+ +A LP  EG+ + ++S
Sbjct: 82  IAFSYDDPVAPAKILHEFSREHKALELKGGYVEGKVVDAKEIEALAKLPSREGLLSMLLS 141

Query: 139 AIQSNATRLVRLL 151
            +Q+    L  +L
Sbjct: 142 VLQAPMRNLAYVL 154


>gi|19551728|ref|NP_599730.1| 50S ribosomal protein L10 [Corynebacterium glutamicum ATCC 13032]
 gi|62389383|ref|YP_224785.1| 50S ribosomal protein L10 [Corynebacterium glutamicum ATCC 13032]
 gi|24212223|sp|Q8NT29|RL10_CORGL RecName: Full=50S ribosomal protein L10
 gi|21323250|dbj|BAB97878.1| Ribosomal protein L10 [Corynebacterium glutamicum ATCC 13032]
 gi|41324717|emb|CAF19199.1| 50S RIBOSOMAL PROTEIN L10 [Corynebacterium glutamicum ATCC 13032]
          Length = 171

 Score = 80.9 bits (198), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 50/162 (30%), Positives = 82/162 (50%), Gaps = 6/162 (3%)

Query: 10  ISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVK--VAKNRLVKIAIRDTSI 67
           ++EL   F+ + ++V+  Y+G++VAQ  +LRK +   G  V+  VAKN LVKIA  +  +
Sbjct: 10  LAELKARFAETDTVVLTEYRGLTVAQTTELRKAL---GFDVQYSVAKNTLVKIAANEAGV 66

Query: 68  RGISDLFVGQSLIVY-SDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASL 126
            G+ DL  G + + +     V   K+   F  +N  F V GG ++   L  + +  IA L
Sbjct: 67  EGLDDLLTGPTAVAFIKGEAVDTAKVLKKFGEENKAFVVKGGYMDGNALTAEQVNAIAEL 126

Query: 127 PDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDK 168
            + E   A +  A++ +  +   L   P +QV R   A  DK
Sbjct: 127 DNRETTLAKLAGAMKGSLAKAAGLFNAPASQVARLAVALQDK 168


>gi|217077415|ref|YP_002335133.1| 50S ribosomal protein L10 [Thermosipho africanus TCF52B]
 gi|226700014|sp|B7ICR5|RL10_THEAB RecName: Full=50S ribosomal protein L10
 gi|217037270|gb|ACJ75792.1| chain A, Ribosomal Protein L10-L12 [Thermosipho africanus TCF52B]
          Length = 180

 Score = 80.9 bits (198), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 55/179 (30%), Positives = 94/179 (52%), Gaps = 8/179 (4%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREA---GGGVKVAKNRL 57
           + R  K   + ELS++F +S  I+ + YKG++VAQI DLRKK+RE    G   KV KN +
Sbjct: 2   LTRAQKEQLVKELSEVFKNSSLILFSDYKGLNVAQITDLRKKLREKLADGARYKVIKNSV 61

Query: 58  VKIAIRDT--SIRGISDLFVGQSLIVYSD--SPVIAPKISVSFSNDNNEFRVLGGVVEKG 113
             +A+++   ++  I D+F G   I+Y +   P+ A K+   FS +        G+   G
Sbjct: 62  AYLALKEAGYNVEEIEDVFSGPLAILYVEDGDPIEAIKVIYDFSKEMKGIPSFKGLYLDG 121

Query: 114 -VLNQDSIKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQQ 171
              + D ++ ++ LP  E + A ++S +Q     LV +L      ++ A++A  DK  +
Sbjct: 122 KFFSADEVENLSKLPSKEQLLAMVVSGVQGPIRGLVNVLSGTLKNLLYALNAIKDKKSE 180


>gi|317046442|ref|YP_004114090.1| 50S ribosomal protein L10 [Pantoea sp. At-9b]
 gi|316948059|gb|ADU67534.1| ribosomal protein L10 [Pantoea sp. At-9b]
          Length = 165

 Score = 80.9 bits (198), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 49/154 (31%), Positives = 86/154 (55%), Gaps = 2/154 (1%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           +N Q K   ++E+S++   + S VVA  +G++V ++ +LRK  REAG  ++V +N L++ 
Sbjct: 3   LNLQDKQAIVAEVSEVAKGALSAVVADSRGVTVDKMTELRKAGREAGVYMRVVRNTLLRR 62

Query: 61  AIRDTSIRGISDLFVGQSLIVYS-DSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
            +  T    + D FVG +LI YS + P  A ++   F+  N +F V     E  ++   +
Sbjct: 63  IVEGTQFECLKDTFVGPTLIAYSMEHPGAAARLFKDFAKANAKFEVKAAAFEGELITAAN 122

Query: 120 IKQIASLPDLEGIRAGIISAIQSNAT-RLVRLLG 152
           I ++A+LP  E   A ++S ++  A  +LVR L 
Sbjct: 123 IDRLATLPTYEEALARLMSTMKEAAAGKLVRTLA 156


>gi|74316414|ref|YP_314154.1| 50S ribosomal protein L10 [Thiobacillus denitrificans ATCC 25259]
 gi|97182096|sp|Q3SLQ8|RL10_THIDA RecName: Full=50S ribosomal protein L10
 gi|74055909|gb|AAZ96349.1| ribosomal protein L10 [Thiobacillus denitrificans ATCC 25259]
          Length = 173

 Score = 80.9 bits (198), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 47/141 (33%), Positives = 76/141 (53%)

Query: 28  YKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRGISDLFVGQSLIVYSDSPV 87
           Y+GI+V  +  LR K R+ G  ++V KN LV+ A+ DT   GI+D  VG      S  PV
Sbjct: 30  YRGIAVEDMTQLRVKARKEGVYLRVLKNTLVRRAVADTPFAGIADQLVGPLAYGISKDPV 89

Query: 88  IAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASLPDLEGIRAGIISAIQSNATRL 147
            A K+   FS  N++F V  G +   +++   +  +AS+P  E + + ++  +Q+   + 
Sbjct: 90  AAAKVMHEFSKTNDKFVVKAGAMPNFLMSPKDVGNLASMPSREELLSKLLGTMQAPIAQF 149

Query: 148 VRLLGTPQTQVVRAISAFVDK 168
           VR L    T+ VR ++A  DK
Sbjct: 150 VRTLNEVPTKFVRGLAAVRDK 170


>gi|116617400|ref|YP_817771.1| 50S ribosomal protein L10P [Leuconostoc mesenteroides subsp.
           mesenteroides ATCC 8293]
 gi|122272399|sp|Q03ZH4|RL10_LEUMM RecName: Full=50S ribosomal protein L10
 gi|116096247|gb|ABJ61398.1| LSU ribosomal protein L10P [Leuconostoc mesenteroides subsp.
           mesenteroides ATCC 8293]
          Length = 178

 Score = 80.9 bits (198), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 43/137 (31%), Positives = 80/137 (58%), Gaps = 1/137 (0%)

Query: 6   KSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDT 65
           K+ ++ E++  F ++ S VV   +G++VAQ  +LR ++RE G  ++V KN+++  A    
Sbjct: 9   KAQKVEEIADQFKAAASAVVVDPRGLTVAQSTELRHQLREEGVVLEVIKNKVLTRAAEKA 68

Query: 66  SIRGISDLFVGQSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIA 124
               ++D+F G S + +S+   +AP +I   F+++N    + GGVV+  + N D I + A
Sbjct: 69  GYAELNDIFAGPSAVAFSNDDAVAPARILKKFADENEALEIKGGVVDGTIANIDDINKYA 128

Query: 125 SLPDLEGIRAGIISAIQ 141
           SLP  EG+   +++  Q
Sbjct: 129 SLPSREGLLGQLMAEFQ 145


>gi|229552930|ref|ZP_04441655.1| ribosomal protein L10 [Lactobacillus rhamnosus LMS2-1]
 gi|229313706|gb|EEN79679.1| ribosomal protein L10 [Lactobacillus rhamnosus LMS2-1]
          Length = 173

 Score = 80.9 bits (198), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 40/134 (29%), Positives = 79/134 (58%), Gaps = 1/134 (0%)

Query: 10  ISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRG 69
           +  +S+ F ++ S VV  Y G++V Q+  LRK++REAG  ++V KN  ++ A        
Sbjct: 18  VKTISEQFKNATSAVVVDYLGLTVEQVTALRKELREAGVKMEVLKNTYLRRAADANGYEA 77

Query: 70  ISDLFVGQSLIVYS-DSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASLPD 128
           + D+F G + + +S D PV   +I   +++  +  ++ GG++E  V + D+I +++ +PD
Sbjct: 78  LDDVFKGPTAVAFSNDDPVAPARIMAKYADQFDALKIKGGIIENKVASLDTIMEMSKMPD 137

Query: 129 LEGIRAGIISAIQS 142
            EG+ + + S +Q+
Sbjct: 138 REGLLSQLASVLQA 151


>gi|319937660|ref|ZP_08012063.1| 50S ribosomal protein L10 [Coprobacillus sp. 29_1]
 gi|319807095|gb|EFW03709.1| 50S ribosomal protein L10 [Coprobacillus sp. 29_1]
          Length = 170

 Score = 80.9 bits (198), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 40/143 (27%), Positives = 80/143 (55%), Gaps = 1/143 (0%)

Query: 10  ISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRG 69
           +SE+++ F ++ S +V  Y+G++VA + +LRK +R    G KV KN+LV+ A     +  
Sbjct: 13  VSEIAESFKAAQSSIVVEYRGLTVADMTELRKALRAENVGFKVYKNKLVQRAAEQEGMNE 72

Query: 70  ISDLFVGQSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASLPD 128
           +++  VG + I +     +AP +I   F+  +    +  G VE   L Q+ +  +A LP+
Sbjct: 73  LNEFLVGPNAIAFGHEDAVAPARILAEFAKGHEALVIKAGYVEGKFLPQEEVMAVAKLPN 132

Query: 129 LEGIRAGIISAIQSNATRLVRLL 151
            EG+ + +++ ++    ++ R+L
Sbjct: 133 REGMYSMLLACMKEPVAKVARVL 155


>gi|240167663|ref|ZP_04746322.1| 50S ribosomal protein L10 [Mycobacterium kansasii ATCC 12478]
          Length = 194

 Score = 80.9 bits (198), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 48/169 (28%), Positives = 90/169 (53%), Gaps = 2/169 (1%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M R  K+  ++++++ F +S + V+  Y+G++VA +  LR+ + E+     VAKN L+K 
Sbjct: 1   MARADKATAVADIAERFKASTATVITEYRGLTVANLAQLRRSLGESAT-YAVAKNTLIKR 59

Query: 61  AIRDTSIRGISDLFVGQSLIVY-SDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
           A  +  I G+ +LF G + I + +  PV A K   +F+ ++    + GG ++   L    
Sbjct: 60  AASEAGIDGLDELFAGPTAIAFVTGEPVDAAKALKTFAREHKALVIKGGYMDGHPLTVAE 119

Query: 120 IKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDK 168
           +++IA L   E + A +  A++ N  +   L   P +QV R  +A  +K
Sbjct: 120 VERIADLESREVLLAKLAGAMKGNLAKAAGLFNAPASQVARLAAALQEK 168


>gi|238756062|ref|ZP_04617385.1| 50S ribosomal protein L10 [Yersinia ruckeri ATCC 29473]
 gi|238705729|gb|EEP98123.1| 50S ribosomal protein L10 [Yersinia ruckeri ATCC 29473]
          Length = 167

 Score = 80.9 bits (198), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 50/159 (31%), Positives = 87/159 (54%), Gaps = 2/159 (1%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           +N QGK   ++E+ ++   + S VVA  +G++V ++ +LRK  REAG  ++V +N L+  
Sbjct: 3   LNLQGKQAIVAEVKEVAKGALSAVVADSRGVTVDKMTELRKAGREAGVHMQVVRNTLLSR 62

Query: 61  AIRDTSIRGISDLFVGQSLIVY-SDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
           A+  T    + D FVG +LI + S+ P  A ++   F+  N +F V     E  ++    
Sbjct: 63  AVEGTPFECLKDTFVGPTLIAFSSEHPGAAARLFKDFAKANAKFEVKAAAFEGELIPAAQ 122

Query: 120 IKQIASLPDLEGIRAGIISAI-QSNATRLVRLLGTPQTQ 157
           I ++A+LP  E   A ++  I ++ A +LVR L   + Q
Sbjct: 123 IDRLATLPTYEEAIACLMGTIKEAAAGKLVRTLAALRDQ 161


>gi|33152869|ref|NP_874222.1| 50S ribosomal protein L10 [Haemophilus ducreyi 35000HP]
 gi|61215253|sp|Q7VKL4|RL10_HAEDU RecName: Full=50S ribosomal protein L10
 gi|33149094|gb|AAP96611.1| 50S ribosomal protein L10 [Haemophilus ducreyi 35000HP]
          Length = 163

 Score = 80.9 bits (198), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 52/177 (29%), Positives = 91/177 (51%), Gaps = 22/177 (12%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           +N Q K   ++E+++    + S VVA  +G++V ++ +LRK  REAG  ++V +N L++ 
Sbjct: 3   LNLQDKQAIVAEVNEAAKGALSAVVADSRGVTVEKMTELRKSAREAGVTMRVVRNTLLRR 62

Query: 61  AIRDTSIRGISDLFVGQSLIVYS-DSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
           A+  T    ++D F G +LI +S + P  A ++   F+  N EF + G   E  V N   
Sbjct: 63  AVEGTEFECLTDTFTGPTLIAFSNEHPGAAARLFTEFAKTNKEFELKGAAFEGKVQN--- 119

Query: 120 IKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQT----QVVRAISAFVDKNQQG 172
           ++ +A+LP  E                + RL+GT +     ++VR  +A  DK Q+ 
Sbjct: 120 VEFLATLPTYEEA--------------IARLMGTMKEAAAGKLVRTFAALRDKLQEA 162


>gi|302553513|ref|ZP_07305855.1| ribosomal protein L10 [Streptomyces viridochromogenes DSM 40736]
 gi|302471131|gb|EFL34224.1| ribosomal protein L10 [Streptomyces viridochromogenes DSM 40736]
          Length = 176

 Score = 80.9 bits (198), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 53/174 (30%), Positives = 90/174 (51%), Gaps = 3/174 (1%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M R  K   + E+   F +S   VV  Y G++V+Q++ LR+ + E     +VAKN L KI
Sbjct: 1   MARPDKVDAVEEMRDKFRNSNGAVVTAYTGLTVSQLQQLRRSLGE-NAHYRVAKNTLTKI 59

Query: 61  AIRDTSIRGISDLFVGQSLIVY-SDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
           A  +  I  I DLF G S + + +  PV A K    F+ DN    + GGV++   L+ D 
Sbjct: 60  AANEAGINTIDDLFTGSSAVAFVTGDPVEAAKGLRDFAKDNPNLVIKGGVLDGKALSADE 119

Query: 120 IKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAF-VDKNQQG 172
           IK++A L   E + + +  A++   ++   +     +++VR + A    +++QG
Sbjct: 120 IKKLADLESREVLLSKLAGAMKGKQSQAASVFQALPSKLVRTVDALRAKQDEQG 173


>gi|119468177|ref|ZP_01611303.1| 50S ribosomal protein L10 [Alteromonadales bacterium TW-7]
 gi|119448170|gb|EAW29434.1| 50S ribosomal protein L10 [Alteromonadales bacterium TW-7]
          Length = 164

 Score = 80.9 bits (198), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 53/159 (33%), Positives = 89/159 (55%), Gaps = 5/159 (3%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           +N QGK   ++E+++  + + S VVA  +G++V  I  LRK+ REAG  +KV +N L K 
Sbjct: 3   LNLQGKKAIVAEVNEAANGALSAVVADSRGVTVGAITALRKEAREAGVWMKVVRNTLAKR 62

Query: 61  AIRDTSIRGISDLFVGQSLIVY-SDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
           A+  T    +SD FVG SLI + S+ P  A +I   F+  N +F V     E  V++   
Sbjct: 63  ALEGTDFECLSDSFVGPSLIAFSSEHPGAAARIFSDFAKKNEKFEVKTAAFEGNVVDA-- 120

Query: 120 IKQIASLPDLEGIRAGIISAI-QSNATRLVRLLGTPQTQ 157
              +A+LP  +   A ++SA+ +++A +L + +   + Q
Sbjct: 121 -AMLATLPTYDEAVARLMSAMKEASAGKLCKTIEAVRVQ 158


>gi|253686609|ref|YP_003015799.1| ribosomal protein L10 [Pectobacterium carotovorum subsp.
           carotovorum PC1]
 gi|259645488|sp|C6DHR3|RL10_PECCP RecName: Full=50S ribosomal protein L10
 gi|251753187|gb|ACT11263.1| ribosomal protein L10 [Pectobacterium carotovorum subsp.
           carotovorum PC1]
          Length = 165

 Score = 80.9 bits (198), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 49/154 (31%), Positives = 85/154 (55%), Gaps = 2/154 (1%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           +N Q K   ++E+S++   + S VVA  +G++V ++ +LRK  REAG  ++V +N L++ 
Sbjct: 3   LNLQDKQAIVAEVSEVAKGALSAVVADSRGVTVDKMTELRKAGREAGVYMRVVRNTLLRR 62

Query: 61  AIRDTSIRGISDLFVGQSLIVYS-DSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
            +  T    + D FVG +LI YS + P  A ++   F+  N +F V     E  ++    
Sbjct: 63  VVEGTQFECLKDTFVGPTLIAYSMEHPGAAARLFKEFAKANAKFEVKAAAFEGELIPAAQ 122

Query: 120 IKQIASLPDLEGIRAGIISAIQSNAT-RLVRLLG 152
           I ++A+LP  E   A ++S ++  A  +LVR L 
Sbjct: 123 IDRLATLPTYEEALARLMSTMKEAAAGKLVRTLA 156


>gi|238760254|ref|ZP_04621398.1| 50S ribosomal protein L10 [Yersinia aldovae ATCC 35236]
 gi|238701518|gb|EEP94091.1| 50S ribosomal protein L10 [Yersinia aldovae ATCC 35236]
          Length = 165

 Score = 80.9 bits (198), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 49/159 (30%), Positives = 89/159 (55%), Gaps = 2/159 (1%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           +N QGK   ++E+ ++   + S VVA  +G++V ++ +LRK  REAG  ++V +N L++ 
Sbjct: 3   LNLQGKQAIVAEVKEVAKGALSAVVADSRGVTVDKMTELRKAGREAGVHMQVVRNTLLRR 62

Query: 61  AIRDTSIRGISDLFVGQSLIVY-SDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
            +  T    + D FVG +LI + S+ P  A ++  +F+ DN +F V     E  ++    
Sbjct: 63  IVEGTQFDCLKDTFVGPTLIAFSSEHPGAAARLFKAFAKDNAKFEVKAAAFEGELIPAAQ 122

Query: 120 IKQIASLPDLEGIRAGIISAI-QSNATRLVRLLGTPQTQ 157
           I ++A+LP  E   A ++  + ++ A +LVR L   + Q
Sbjct: 123 IDRLATLPTYEEAIARLMGTMKEAAAGKLVRTLAALRDQ 161


>gi|38233050|ref|NP_938817.1| 50S ribosomal protein L10 [Corynebacterium diphtheriae NCTC 13129]
 gi|61215055|sp|Q6NJG6|RL10_CORDI RecName: Full=50S ribosomal protein L10
 gi|38199309|emb|CAE48941.1| 50S ribosomal protein L10 [Corynebacterium diphtheriae]
          Length = 171

 Score = 80.9 bits (198), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 49/164 (29%), Positives = 86/164 (52%), Gaps = 6/164 (3%)

Query: 10  ISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVK--VAKNRLVKIAIRDTSI 67
           ++EL   F+   S+ V  Y+G++VAQI +LR+ +   G  V+  VAKN L+K+A ++  I
Sbjct: 10  LAELKNRFADIDSVFVTEYRGLTVAQITELRRAL---GSDVQYSVAKNTLIKLAAKEAGI 66

Query: 68  RGISDLFVGQSLIVY-SDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASL 126
            G+ D+  G + + +     V A K    F+++N  F + GG ++   L+   +  IA L
Sbjct: 67  EGLDDILTGPTAVAFIKGEAVDAAKAMKKFASENKAFVIKGGYMDGNALSAAQVDAIAEL 126

Query: 127 PDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQ 170
            + E   A +  A++ N  +   L   P +QV R  +A  +K +
Sbjct: 127 DNRETTLAKLAGAMKGNLAKAAGLFNAPASQVARLGAALQEKKE 170


>gi|289551661|ref|YP_003472565.1| LSU ribosomal protein L10p (P0) [Staphylococcus lugdunensis
           HKU09-01]
 gi|315659120|ref|ZP_07911985.1| 50S ribosomal protein L10 [Staphylococcus lugdunensis M23590]
 gi|289181192|gb|ADC88437.1| LSU ribosomal protein L10p (P0) [Staphylococcus lugdunensis
           HKU09-01]
 gi|315495844|gb|EFU84174.1| 50S ribosomal protein L10 [Staphylococcus lugdunensis M23590]
          Length = 166

 Score = 80.9 bits (198), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 40/127 (31%), Positives = 75/127 (59%), Gaps = 1/127 (0%)

Query: 17  FSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRGISDLFVG 76
             +S S VV  Y+G++VA++ +LR ++REAG   KV KN +V+ A     I G++D   G
Sbjct: 19  LKNSVSTVVVDYRGLTVAEVTELRSQLREAGVEYKVYKNTMVRRAAEQAGIEGLNDFLTG 78

Query: 77  QSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASLPDLEGIRAG 135
            + I  S   V+AP K+   F+ ++    +  GV++  +++ + +K + SLP  +G+ + 
Sbjct: 79  PTAIATSTEDVVAPAKVIAGFAKEHEALEIKTGVMDGSIISAEEVKTVGSLPSHDGLVSM 138

Query: 136 IISAIQS 142
           ++S +Q+
Sbjct: 139 LLSVLQA 145


>gi|199599016|ref|ZP_03212423.1| Ribosomal protein L10 [Lactobacillus rhamnosus HN001]
 gi|258509272|ref|YP_003172023.1| 50S ribosomal protein L10 [Lactobacillus rhamnosus GG]
 gi|258540459|ref|YP_003174958.1| 50S ribosomal protein L10 [Lactobacillus rhamnosus Lc 705]
 gi|199590052|gb|EDY98151.1| Ribosomal protein L10 [Lactobacillus rhamnosus HN001]
 gi|257149199|emb|CAR88172.1| LSU/50S ribosomal protein L10P [Lactobacillus rhamnosus GG]
 gi|257152135|emb|CAR91107.1| LSU/50S ribosomal protein L10P [Lactobacillus rhamnosus Lc 705]
 gi|259650553|dbj|BAI42715.1| 50S ribosomal protein L10 [Lactobacillus rhamnosus GG]
          Length = 168

 Score = 80.9 bits (198), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 40/134 (29%), Positives = 79/134 (58%), Gaps = 1/134 (0%)

Query: 10  ISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRG 69
           +  +S+ F ++ S VV  Y G++V Q+  LRK++REAG  ++V KN  ++ A        
Sbjct: 13  VKTISEQFKNATSAVVVDYLGLTVEQVTALRKELREAGVKMEVLKNTYLRRAADANGYEA 72

Query: 70  ISDLFVGQSLIVYS-DSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASLPD 128
           + D+F G + + +S D PV   +I   +++  +  ++ GG++E  V + D+I +++ +PD
Sbjct: 73  LDDVFKGPTAVAFSNDDPVAPARIMAKYADQFDALKIKGGIIENKVASLDTIMEMSKMPD 132

Query: 129 LEGIRAGIISAIQS 142
            EG+ + + S +Q+
Sbjct: 133 REGLLSQLASVLQA 146


>gi|70727467|ref|YP_254383.1| 50S ribosomal protein L10 [Staphylococcus haemolyticus JCSC1435]
 gi|82581570|sp|Q4L3K0|RL10_STAHJ RecName: Full=50S ribosomal protein L10
 gi|68448193|dbj|BAE05777.1| 50S ribosomal protein L10 [Staphylococcus haemolyticus JCSC1435]
          Length = 166

 Score = 80.9 bits (198), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 40/140 (28%), Positives = 81/140 (57%), Gaps = 1/140 (0%)

Query: 4   QGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIR 63
           + K  ++  +++   +S S V+  Y+G++VA++ +LR ++REAG   KV KN +V+ A  
Sbjct: 6   EAKKQQVDVIAEQLKNSVSTVIVDYRGLTVAEVTELRSQLREAGVEYKVYKNTMVRRAAE 65

Query: 64  DTSIRGISDLFVGQSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQ 122
              I G+ +   G + +  S   V+AP K+   F+ ++    +  GV+E  V++ + +K 
Sbjct: 66  QAGIEGLDEFLTGPTAVATSTEDVVAPAKVIAGFAKEHEALEIKTGVMEGSVISAEEVKT 125

Query: 123 IASLPDLEGIRAGIISAIQS 142
           + SLP  +G+ + ++S +Q+
Sbjct: 126 VGSLPSHDGLVSMLLSVLQA 145


>gi|50119181|ref|YP_048348.1| 50S ribosomal protein L10 [Pectobacterium atrosepticum SCRI1043]
 gi|61214944|sp|Q6DAN2|RL10_ERWCT RecName: Full=50S ribosomal protein L10
 gi|49609707|emb|CAG73140.1| 50S ribosomal protein L10 [Pectobacterium atrosepticum SCRI1043]
          Length = 165

 Score = 80.5 bits (197), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 49/154 (31%), Positives = 85/154 (55%), Gaps = 2/154 (1%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           +N Q K   ++E+S++   + S VVA  +G++V ++ +LRK  REAG  ++V +N L++ 
Sbjct: 3   LNLQDKQAIVAEVSEVAKGALSAVVADSRGVTVDKMTELRKAGREAGVYMRVVRNTLLRR 62

Query: 61  AIRDTSIRGISDLFVGQSLIVYS-DSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
            +  T    + D FVG +LI YS + P  A ++   F+  N +F V     E  ++    
Sbjct: 63  VVEGTQFECLKDTFVGPTLIAYSMEHPGAAARLFKDFAKANAKFEVKAAAFEGELIPAAQ 122

Query: 120 IKQIASLPDLEGIRAGIISAIQSNAT-RLVRLLG 152
           I ++A+LP  E   A ++S ++  A  +LVR L 
Sbjct: 123 IDRLATLPTYEEALARLMSTMKEAAAGKLVRTLA 156


>gi|268592959|ref|ZP_06127180.1| ribosomal protein L10 [Providencia rettgeri DSM 1131]
 gi|291311430|gb|EFE51883.1| ribosomal protein L10 [Providencia rettgeri DSM 1131]
          Length = 165

 Score = 80.5 bits (197), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 49/159 (30%), Positives = 90/159 (56%), Gaps = 2/159 (1%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           +N Q K   ++E+S++   + S VVA  +G++VA++ +LRK  REAG  ++V +N L++ 
Sbjct: 3   LNLQDKQAIVAEVSEVAKGALSAVVADSRGVTVAKMTELRKAGREAGVYIRVVRNTLIRR 62

Query: 61  AIRDTSIRGISDLFVGQSLIVYS-DSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
           A+  TS   + D+FVG +LI +S + P    ++   F+  N  F +     E  ++    
Sbjct: 63  AVEGTSYDVLKDVFVGPTLIAFSNEHPGAGARLFKEFAKANPAFEIKAAAFEGELIQAKD 122

Query: 120 IKQIASLPDLEGIRAGIISAI-QSNATRLVRLLGTPQTQ 157
           I ++A+LP  +   A ++S + ++ A +LVR L   + Q
Sbjct: 123 IDRLATLPTYDEAIARLMSTMKEAAAGKLVRTLAALRDQ 161


>gi|261819564|ref|YP_003257670.1| 50S ribosomal protein L10 [Pectobacterium wasabiae WPP163]
 gi|261603577|gb|ACX86063.1| ribosomal protein L10 [Pectobacterium wasabiae WPP163]
          Length = 165

 Score = 80.5 bits (197), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 49/154 (31%), Positives = 85/154 (55%), Gaps = 2/154 (1%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           +N Q K   ++E+S++   + S VVA  +G++V ++ +LRK  REAG  ++V +N L++ 
Sbjct: 3   LNLQDKQAIVAEVSEVAKGALSAVVADSRGVTVDKMTELRKAGREAGVYMRVVRNTLLRR 62

Query: 61  AIRDTSIRGISDLFVGQSLIVYS-DSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
            +  T    + D FVG +LI YS + P  A ++   F+  N +F V     E  ++    
Sbjct: 63  VVEGTQFECLKDTFVGPTLIAYSLEHPGAAARLFKEFAKANAKFEVKAAAFEGELIPAAQ 122

Query: 120 IKQIASLPDLEGIRAGIISAIQSNAT-RLVRLLG 152
           I ++A+LP  E   A ++S ++  A  +LVR L 
Sbjct: 123 IDRLATLPTYEEALARLMSTMKEAAAGKLVRTLA 156


>gi|288573179|ref|ZP_06391536.1| ribosomal protein L10 [Dethiosulfovibrio peptidovorans DSM 11002]
 gi|288568920|gb|EFC90477.1| ribosomal protein L10 [Dethiosulfovibrio peptidovorans DSM 11002]
          Length = 177

 Score = 80.5 bits (197), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 50/163 (30%), Positives = 88/163 (53%), Gaps = 3/163 (1%)

Query: 10  ISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRG 69
           +SEL K    + ++ V  Y+G++VAQ  + R+ +REA G VKVAKN LV++A+ +  +  
Sbjct: 10  VSELKKKLEGAEAVFVCEYRGLTVAQATEFRRLVREASGEVKVAKNTLVRLALGEVGMAV 69

Query: 70  ISDLFVGQS--LIVYSDSPVIAPKISVSFSNDNNEFRVL-GGVVEKGVLNQDSIKQIASL 126
             D+ VG +  +I + +SP +A  +    S   N+  V+ GG++   VL+ D +  +A L
Sbjct: 70  PEDITVGPNAYVIAHENSPAVAKAMKEFASKKENKAMVIKGGLMGSDVLSLDQVMALADL 129

Query: 127 PDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKN 169
           P  + + A ++  +      LV +L  P   +V  +S   +K 
Sbjct: 130 PSRDQMLAQLVGTLAGPIRGLVTVLSGPSRGLVTCLSQLAEKK 172


>gi|270291191|ref|ZP_06197414.1| 50S ribosomal protein L10 [Pediococcus acidilactici 7_4]
 gi|304385476|ref|ZP_07367821.1| 50S ribosomal protein L10 [Pediococcus acidilactici DSM 20284]
 gi|270280587|gb|EFA26422.1| 50S ribosomal protein L10 [Pediococcus acidilactici 7_4]
 gi|304328683|gb|EFL95904.1| 50S ribosomal protein L10 [Pediococcus acidilactici DSM 20284]
          Length = 168

 Score = 80.5 bits (197), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 48/167 (28%), Positives = 88/167 (52%), Gaps = 12/167 (7%)

Query: 6   KSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDT 65
           K+  + E+++   ++ S +V   +G++VA++ DLRK++R++G   +V KN+++  A    
Sbjct: 9   KAAIVDEVAEEMKNAVSAIVVDSRGLTVAEVTDLRKQLRDSGIKFRVIKNKILTRAAEQA 68

Query: 66  SIRGISDLFVGQSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIA 124
              G+ D+FVG S + +S    +AP KI   F++ N+   + GGV+E  V + D+I   A
Sbjct: 69  GFEGMDDIFVGPSAVAFSAEDAVAPAKILKQFADSNDNLSIKGGVIEGKVADIDTINTFA 128

Query: 125 SLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQQ 171
           ++P  E + A + +   S           P   V  A+ A  DK  +
Sbjct: 129 TMPSREDLLAMLANEFMS-----------PVRDVAYALKAVADKKSE 164


>gi|254517460|ref|ZP_05129516.1| ribosomal protein L10 [Clostridium sp. 7_2_43FAA]
 gi|226911209|gb|EEH96410.1| ribosomal protein L10 [Clostridium sp. 7_2_43FAA]
          Length = 167

 Score = 80.5 bits (197), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 43/151 (28%), Positives = 86/151 (56%), Gaps = 1/151 (0%)

Query: 2   NRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIA 61
           NRQ K  +++E+ +    + +IV+A Y+G++V +   LRK +REAG   KV KN LV +A
Sbjct: 4   NRQIKEAKVAEIREKLEKAQAIVLADYQGLTVEEDTALRKTLREAGVEYKVYKNNLVTLA 63

Query: 62  IRDTSIRGISDLFVGQSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
            ++  I G+     G   I +      AP ++  +F+ D+ +  +  G+VE  + N++ +
Sbjct: 64  AKELGIEGLDSYLEGPVSIAFGYEDATAPARVLHTFAKDHKKLELKAGMVEGTLYNKEEV 123

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLL 151
           +++A++P  E + A ++ + ++  + +  LL
Sbjct: 124 EKLATIPSKEVLIAKLLGSFKAPLSNVAYLL 154


>gi|254495701|ref|ZP_05108618.1| 50S ribosomal protein L10 [Legionella drancourtii LLAP12]
 gi|254355080|gb|EET13698.1| 50S ribosomal protein L10 [Legionella drancourtii LLAP12]
          Length = 174

 Score = 80.5 bits (197), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 48/169 (28%), Positives = 90/169 (53%), Gaps = 1/169 (0%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           +N   K   + E++++ S + S VVA Y+G++V Q+  LR + R+AG  ++V +N L + 
Sbjct: 3   LNLAAKKAVVEEVTEVASKAISAVVADYRGLTVNQMTQLRSEARKAGVYLRVVRNTLTRR 62

Query: 61  AIRDTSIRGISDLFVGQSLIVYS-DSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
           A ++T    ++DL VG   I  S ++P  A ++   F+   ++  V    V   +   + 
Sbjct: 63  AFKNTEFECLNDLLVGPLFIALSLEAPSDAARLLKEFTKTFDKLEVKALSVGGKIYQANQ 122

Query: 120 IKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDK 168
           +  +ASLP  +   A ++  +++   + VR L  P  ++VR I+A  DK
Sbjct: 123 LDVVASLPTKDEAIAKLMYVMKAPVEKFVRTLAEPHAKLVRTIAAVKDK 171


>gi|266621459|ref|ZP_06114394.1| ribosomal protein L10 [Clostridium hathewayi DSM 13479]
 gi|288866900|gb|EFC99198.1| ribosomal protein L10 [Clostridium hathewayi DSM 13479]
          Length = 167

 Score = 80.5 bits (197), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 45/143 (31%), Positives = 78/143 (54%), Gaps = 1/143 (0%)

Query: 10  ISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRG 69
           + E+ ++F  + + VV  Y+G++VAQ  +LRKK+REAG   KV KN +++ A + T+   
Sbjct: 11  VDEIKELFDGAETAVVVDYRGLTVAQDTELRKKLREAGVVYKVYKNTMIRFAGKGTAFEA 70

Query: 70  ISDLFVGQSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASLPD 128
           +     G + +  S +   AP +I   F+       + GGVVE    ++  + QI+S+P 
Sbjct: 71  LEPNLEGPTALAVSKTDATAPARILAEFAKTAPALEIKGGVVEGVYYDEKGMAQISSIPS 130

Query: 129 LEGIRAGIISAIQSNATRLVRLL 151
            E +   ++ +IQS  T   R+L
Sbjct: 131 REVLLGKLLGSIQSPITNFARVL 153


>gi|254821920|ref|ZP_05226921.1| 50S ribosomal protein L10 [Mycobacterium intracellulare ATCC 13950]
          Length = 207

 Score = 80.5 bits (197), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 48/169 (28%), Positives = 89/169 (52%), Gaps = 2/169 (1%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M R  K+  ++++++ F  S + +V  Y+G++VA + +LR+ +  A     VAKN LVK 
Sbjct: 1   MARADKATAVADIAEQFKESTAALVTEYRGLTVANLAELRRSLG-ASATYSVAKNTLVKR 59

Query: 61  AIRDTSIRGISDLFVGQSLIVY-SDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
           A  +  + G+ +LF G + I + +  PV A K   +F+ ++    + GG ++   L    
Sbjct: 60  AASEAGVDGLDELFAGPTAIAFITGEPVDAAKAIKTFAKEHKALVIKGGYMDGRALTVAE 119

Query: 120 IKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDK 168
           +++IA L   E + A +  A++ N  +   L   P +QV R  +A  +K
Sbjct: 120 VERIADLESREVLLAKLAGAMKGNLAKAAGLFNAPASQVARLAAALQEK 168


>gi|254776943|ref|ZP_05218459.1| 50S ribosomal protein L10 [Mycobacterium avium subsp. avium ATCC
           25291]
          Length = 196

 Score = 80.5 bits (197), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 47/170 (27%), Positives = 90/170 (52%), Gaps = 2/170 (1%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M R  K+  ++++++ F  + + ++  Y+G++VA + +LR+ +  A     VAKN LVK 
Sbjct: 1   MARADKATAVADIAEQFKEATATLITEYRGLTVANLAELRRSLSGAAT-YSVAKNTLVKR 59

Query: 61  AIRDTSIRGISDLFVGQSLIVY-SDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
           A  +  I G+ +LF G + I + +  PV A K   +F+ ++    + GG ++   L+   
Sbjct: 60  AASEAGIEGLDELFAGPTAIAFVTGEPVDAAKAIKTFAKEHKALVIKGGYMDGRALSVAE 119

Query: 120 IKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKN 169
           +++IA L   E + A +  A++ N  +   L   P +QV R  +A  +K 
Sbjct: 120 VERIADLESREVLLAKLAGAMKGNLAKAAGLFNAPASQVARLAAALQEKK 169


>gi|41410223|ref|NP_963059.1| 50S ribosomal protein L10 [Mycobacterium avium subsp.
           paratuberculosis K-10]
 gi|61215110|sp|Q73SE9|RL10_MYCPA RecName: Full=50S ribosomal protein L10
 gi|41399057|gb|AAS06675.1| RplJ [Mycobacterium avium subsp. paratuberculosis K-10]
          Length = 196

 Score = 80.5 bits (197), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 47/170 (27%), Positives = 90/170 (52%), Gaps = 2/170 (1%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M R  K+  ++++++ F  + + ++  Y+G++VA + +LR+ +  A     VAKN LVK 
Sbjct: 1   MARADKATAVADIAEQFKEATATLITEYRGLTVANLAELRRSLSGAAT-YSVAKNTLVKR 59

Query: 61  AIRDTSIRGISDLFVGQSLIVY-SDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
           A  +  I G+ +LF G + I + +  PV A K   +F+ ++    + GG ++   L+   
Sbjct: 60  AASEAGIEGLDELFAGPTAIAFVTGEPVDAAKAIKTFAKEHKALVIKGGYMDGRALSVAE 119

Query: 120 IKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKN 169
           +++IA L   E + A +  A++ N  +   L   P +QV R  +A  +K 
Sbjct: 120 VERIADLESREVLLAKLAGAMKGNLAKAAGLFNAPASQVARLAAALQEKK 169


>gi|22124397|ref|NP_667820.1| 50S ribosomal protein L10 [Yersinia pestis KIM 10]
 gi|45442866|ref|NP_994405.1| 50S ribosomal protein L10 [Yersinia pestis biovar Microtus str.
           91001]
 gi|51594636|ref|YP_068827.1| 50S ribosomal protein L10 [Yersinia pseudotuberculosis IP 32953]
 gi|108809612|ref|YP_653528.1| 50S ribosomal protein L10 [Yersinia pestis Antiqua]
 gi|108810383|ref|YP_646150.1| 50S ribosomal protein L10 [Yersinia pestis Nepal516]
 gi|145600990|ref|YP_001165066.1| 50S ribosomal protein L10 [Yersinia pestis Pestoides F]
 gi|153949060|ref|YP_001402813.1| 50S ribosomal protein L10 [Yersinia pseudotuberculosis IP 31758]
 gi|153997217|ref|ZP_02022324.1| 50S ribosomal protein L10 [Yersinia pestis CA88-4125]
 gi|162418901|ref|YP_001607194.1| 50S ribosomal protein L10 [Yersinia pestis Angola]
 gi|165928335|ref|ZP_02224167.1| ribosomal protein L10 [Yersinia pestis biovar Orientalis str.
           F1991016]
 gi|165938225|ref|ZP_02226784.1| ribosomal protein L10 [Yersinia pestis biovar Orientalis str.
           IP275]
 gi|166012055|ref|ZP_02232953.1| ribosomal protein L10 [Yersinia pestis biovar Antiqua str.
           E1979001]
 gi|166214415|ref|ZP_02240450.1| ribosomal protein L10 [Yersinia pestis biovar Antiqua str.
           B42003004]
 gi|167402414|ref|ZP_02307874.1| ribosomal protein L10 [Yersinia pestis biovar Antiqua str.
           UG05-0454]
 gi|167422938|ref|ZP_02314691.1| ribosomal protein L10 [Yersinia pestis biovar Orientalis str.
           MG05-1020]
 gi|167426827|ref|ZP_02318580.1| ribosomal protein L10 [Yersinia pestis biovar Mediaevalis str.
           K1973002]
 gi|170022595|ref|YP_001719100.1| 50S ribosomal protein L10 [Yersinia pseudotuberculosis YPIII]
 gi|186893637|ref|YP_001870749.1| 50S ribosomal protein L10 [Yersinia pseudotuberculosis PB1/+]
 gi|218930754|ref|YP_002348629.1| 50S ribosomal protein L10 [Yersinia pestis CO92]
 gi|229837495|ref|ZP_04457657.1| 50S ribosomal subunit protein L10 [Yersinia pestis Pestoides A]
 gi|229839431|ref|ZP_04459590.1| 50S ribosomal subunit protein L10 [Yersinia pestis biovar
           Orientalis str. PEXU2]
 gi|229899993|ref|ZP_04515133.1| 50S ribosomal subunit protein L10 [Yersinia pestis biovar
           Orientalis str. India 195]
 gi|229900558|ref|ZP_04515684.1| 50S ribosomal subunit protein L10 [Yersinia pestis Nepal516]
 gi|270488914|ref|ZP_06205988.1| ribosomal protein L10 [Yersinia pestis KIM D27]
 gi|294505417|ref|YP_003569479.1| 50S ribosomal protein L10 [Yersinia pestis Z176003]
 gi|20978600|sp|Q8ZAP3|RL10_YERPE RecName: Full=50S ribosomal protein L10
 gi|61214874|sp|Q66FQ4|RL10_YERPS RecName: Full=50S ribosomal protein L10
 gi|122382591|sp|Q1C1T9|RL10_YERPA RecName: Full=50S ribosomal protein L10
 gi|122385352|sp|Q1CN80|RL10_YERPN RecName: Full=50S ribosomal protein L10
 gi|166230090|sp|A4TS31|RL10_YERPP RecName: Full=50S ribosomal protein L10
 gi|166981917|sp|A7FNI5|RL10_YERP3 RecName: Full=50S ribosomal protein L10
 gi|226700028|sp|B2K110|RL10_YERPB RecName: Full=50S ribosomal protein L10
 gi|226700029|sp|A9R0H6|RL10_YERPG RecName: Full=50S ribosomal protein L10
 gi|226700030|sp|B1JJJ6|RL10_YERPY RecName: Full=50S ribosomal protein L10
 gi|21957179|gb|AAM84071.1|AE013649_1 50S ribosomal subunit protein L10 [Yersinia pestis KIM 10]
 gi|45437732|gb|AAS63282.1| 50S ribosomal protein L10 [Yersinia pestis biovar Microtus str.
           91001]
 gi|51587918|emb|CAH19521.1| 50S ribosomal protein L10 [Yersinia pseudotuberculosis IP 32953]
 gi|108774031|gb|ABG16550.1| LSU ribosomal protein L10P [Yersinia pestis Nepal516]
 gi|108781525|gb|ABG15583.1| LSU ribosomal protein L10P [Yersinia pestis Antiqua]
 gi|115349365|emb|CAL22336.1| 50S ribosomal protein L10 [Yersinia pestis CO92]
 gi|145212686|gb|ABP42093.1| LSU ribosomal protein L10P [Yersinia pestis Pestoides F]
 gi|149289325|gb|EDM39404.1| 50S ribosomal protein L10 [Yersinia pestis CA88-4125]
 gi|152960555|gb|ABS48016.1| ribosomal protein L10 [Yersinia pseudotuberculosis IP 31758]
 gi|162351716|gb|ABX85664.1| ribosomal protein L10 [Yersinia pestis Angola]
 gi|165913886|gb|EDR32504.1| ribosomal protein L10 [Yersinia pestis biovar Orientalis str.
           IP275]
 gi|165919674|gb|EDR37007.1| ribosomal protein L10 [Yersinia pestis biovar Orientalis str.
           F1991016]
 gi|165989050|gb|EDR41351.1| ribosomal protein L10 [Yersinia pestis biovar Antiqua str.
           E1979001]
 gi|166204419|gb|EDR48899.1| ribosomal protein L10 [Yersinia pestis biovar Antiqua str.
           B42003004]
 gi|166957149|gb|EDR55170.1| ribosomal protein L10 [Yersinia pestis biovar Orientalis str.
           MG05-1020]
 gi|167048194|gb|EDR59602.1| ribosomal protein L10 [Yersinia pestis biovar Antiqua str.
           UG05-0454]
 gi|167054209|gb|EDR64034.1| ribosomal protein L10 [Yersinia pestis biovar Mediaevalis str.
           K1973002]
 gi|169749129|gb|ACA66647.1| ribosomal protein L10 [Yersinia pseudotuberculosis YPIII]
 gi|186696663|gb|ACC87292.1| ribosomal protein L10 [Yersinia pseudotuberculosis PB1/+]
 gi|229682378|gb|EEO78468.1| 50S ribosomal subunit protein L10 [Yersinia pestis Nepal516]
 gi|229686978|gb|EEO79054.1| 50S ribosomal subunit protein L10 [Yersinia pestis biovar
           Orientalis str. India 195]
 gi|229695797|gb|EEO85844.1| 50S ribosomal subunit protein L10 [Yersinia pestis biovar
           Orientalis str. PEXU2]
 gi|229704183|gb|EEO91194.1| 50S ribosomal subunit protein L10 [Yersinia pestis Pestoides A]
 gi|262363483|gb|ACY60204.1| 50S ribosomal protein L10 [Yersinia pestis D106004]
 gi|262367411|gb|ACY63968.1| 50S ribosomal protein L10 [Yersinia pestis D182038]
 gi|270337418|gb|EFA48195.1| ribosomal protein L10 [Yersinia pestis KIM D27]
 gi|294355876|gb|ADE66217.1| 50S ribosomal protein L10 [Yersinia pestis Z176003]
 gi|320013655|gb|ADV97226.1| 50S ribosomal subunit protein L10 [Yersinia pestis biovar
           Medievalis str. Harbin 35]
          Length = 165

 Score = 80.5 bits (197), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 48/159 (30%), Positives = 89/159 (55%), Gaps = 2/159 (1%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           +N QGK   ++E+ ++   + S VVA  +G++V ++ +LR+  REAG  ++V +N L++ 
Sbjct: 3   LNLQGKQAIVAEVKEVAKGALSAVVADSRGVTVDKMTELRRAGREAGVHMQVVRNTLLRR 62

Query: 61  AIRDTSIRGISDLFVGQSLIVYS-DSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
            +  T    + D FVG +LI +S + P  A ++  +F+ DN +F V     E  ++    
Sbjct: 63  IVEGTPFECLKDTFVGPTLIAFSAEHPGAAARLFKAFAKDNAKFEVKAAAFEGELIPAAQ 122

Query: 120 IKQIASLPDLEGIRAGIISAI-QSNATRLVRLLGTPQTQ 157
           I ++A+LP  E   A ++  + ++ A +LVR L   + Q
Sbjct: 123 IDRLATLPTYEEAIARLMGTMKEAAAGKLVRTLAALRDQ 161


>gi|242241129|ref|YP_002989310.1| 50S ribosomal protein L10 [Dickeya dadantii Ech703]
 gi|251791445|ref|YP_003006166.1| 50S ribosomal protein L10 [Dickeya zeae Ech1591]
 gi|271498790|ref|YP_003331815.1| 50S ribosomal protein L10 [Dickeya dadantii Ech586]
 gi|307128977|ref|YP_003880993.1| 50S ribosomal subunit protein L10 [Dickeya dadantii 3937]
 gi|242133186|gb|ACS87488.1| ribosomal protein L10 [Dickeya dadantii Ech703]
 gi|247540066|gb|ACT08687.1| ribosomal protein L10 [Dickeya zeae Ech1591]
 gi|270342345|gb|ACZ75110.1| ribosomal protein L10 [Dickeya dadantii Ech586]
 gi|306526506|gb|ADM96436.1| 50S ribosomal subunit protein L10 [Dickeya dadantii 3937]
          Length = 165

 Score = 80.5 bits (197), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 49/159 (30%), Positives = 89/159 (55%), Gaps = 2/159 (1%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           +N Q K   ++E+S++   + S VVA  +G++V ++ +LRK  REAG  ++V +N L++ 
Sbjct: 3   LNLQDKQAIVAEVSEVAKGALSAVVADSRGVTVDKMTELRKAGREAGVYMRVVRNTLLRR 62

Query: 61  AIRDTSIRGISDLFVGQSLIVYS-DSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
            +  T    + D FVG +LI YS + P  A ++   F+  N +F V     E  ++    
Sbjct: 63  VVEGTQFECLKDTFVGPTLIAYSMEHPGAAARLFKEFAKANAKFEVKAAAFEGELIPAAQ 122

Query: 120 IKQIASLPDLEGIRAGIISAI-QSNATRLVRLLGTPQTQ 157
           I ++A+LP  E   A +++ + +++A +LVR L   + Q
Sbjct: 123 IDRLATLPTYEEAIARLMATMKEASAGKLVRTLAAVRDQ 161


>gi|187934059|ref|YP_001884464.1| 50S ribosomal protein L10 [Clostridium botulinum B str. Eklund 17B]
 gi|187722212|gb|ACD23433.1| 50S ribosomal protein L10 [Clostridium botulinum B str. Eklund 17B]
          Length = 167

 Score = 80.5 bits (197), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 47/151 (31%), Positives = 83/151 (54%), Gaps = 1/151 (0%)

Query: 2   NRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIA 61
           NRQ K  +++E+ +    + ++V A Y+G++V +   LRK +REAG   KV KN LV IA
Sbjct: 4   NRQLKEAKVAEIKEKLEKAKAVVFAKYQGLTVEEDTALRKNLREAGVEYKVYKNTLVSIA 63

Query: 62  IRDTSIRGISDLFVGQSLIVYSDSPV-IAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
            ++  + G  +   G   I +    V +  ++   F+ D+ +  +  GVVE  V + + I
Sbjct: 64  AKELGLDGAVEYLEGPVAIAFGYEDVTVGARVLNDFAKDHKKLELKAGVVEGEVYDSEKI 123

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLL 151
           KQ+A++P  E + A ++ +I+S  +    LL
Sbjct: 124 KQLATIPSKEVLIAKLLGSIKSPLSNFAYLL 154


>gi|118463739|ref|YP_883642.1| 50S ribosomal protein L10 [Mycobacterium avium 104]
 gi|166230032|sp|A0QL54|RL10_MYCA1 RecName: Full=50S ribosomal protein L10
 gi|118165026|gb|ABK65923.1| 50S ribosomal protein L10 [Mycobacterium avium 104]
          Length = 196

 Score = 80.5 bits (197), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 47/170 (27%), Positives = 90/170 (52%), Gaps = 2/170 (1%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M R  K+  ++++++ F  + + ++  Y+G++VA + +LR+ +  A     VAKN LVK 
Sbjct: 1   MARADKATAVADIAEQFKEATATLITEYRGLTVANLAELRRSLSGAAT-YSVAKNTLVKR 59

Query: 61  AIRDTSIRGISDLFVGQSLIVY-SDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
           A  +  I G+ +LF G + I + +  PV A K   +F+ ++    + GG ++   L+   
Sbjct: 60  AASEAGIEGLDELFAGPTAIAFVTGEPVDAAKAIKTFAKEHKALVIKGGYMDGRALSVAE 119

Query: 120 IKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKN 169
           +++IA L   E + A +  A++ N  +   L   P +QV R  +A  +K 
Sbjct: 120 VERIADLESREVLLAKLAGAMKGNLAKAAGLFNAPASQVARLAAALQEKK 169


>gi|78221837|ref|YP_383584.1| 50S ribosomal protein L10 [Geobacter metallireducens GS-15]
 gi|97181655|sp|Q39Y15|RL10_GEOMG RecName: Full=50S ribosomal protein L10
 gi|78193092|gb|ABB30859.1| LSU ribosomal protein L10P [Geobacter metallireducens GS-15]
          Length = 174

 Score = 80.5 bits (197), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 49/166 (29%), Positives = 88/166 (53%), Gaps = 2/166 (1%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           MNR+ K  +++EL +    + ++ +A ++G+SV Q   LR ++R A    KVAKN L+++
Sbjct: 1   MNRENKQQQVAELHEKLKRAKAVFLADFRGMSVEQATTLRNELRAAAVEYKVAKNTLLEL 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYS-DSPVIAPKISVSFSNDN-NEFRVLGGVVEKGVLNQD 118
           A ++T    +S  + G + I +S D PV A K+   F+    N F++   V+    ++  
Sbjct: 61  ASKETDKESLSPHYAGPTAIAFSYDDPVAAAKVLSKFAKTQANTFKLKAAVLSGKQISVS 120

Query: 119 SIKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISA 164
            I+ +A LP  E + A ++  I +     V +L       VRA++A
Sbjct: 121 DIQALADLPSREVLLAKLLGTINAPVANFVGVLAAVPGSFVRALNA 166


>gi|16762302|ref|NP_457919.1| 50S ribosomal protein L10 [Salmonella enterica subsp. enterica
           serovar Typhi str. CT18]
 gi|16767405|ref|NP_463020.1| 50S ribosomal protein L10 [Salmonella enterica subsp. enterica
           serovar Typhimurium str. LT2]
 gi|29143790|ref|NP_807132.1| 50S ribosomal protein L10 [Salmonella enterica subsp. enterica
           serovar Typhi str. Ty2]
 gi|56415978|ref|YP_153053.1| 50S ribosomal protein L10 [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. ATCC 9150]
 gi|62182605|ref|YP_219022.1| 50S ribosomal protein L10 [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. SC-B67]
 gi|152972843|ref|YP_001337989.1| 50S ribosomal protein L10 [Klebsiella pneumoniae subsp. pneumoniae
           MGH 78578]
 gi|161505367|ref|YP_001572479.1| 50S ribosomal protein L10 [Salmonella enterica subsp. arizonae
           serovar 62:z4,z23:-- str. RSK2980]
 gi|161617288|ref|YP_001591253.1| 50S ribosomal protein L10 [Salmonella enterica subsp. enterica
           serovar Paratyphi B str. SPB7]
 gi|168264594|ref|ZP_02686567.1| ribosomal protein L10 [Salmonella enterica subsp. enterica serovar
           Hadar str. RI_05P066]
 gi|168467917|ref|ZP_02701754.1| ribosomal protein L10 [Salmonella enterica subsp. enterica serovar
           Newport str. SL317]
 gi|194444696|ref|YP_002043403.1| 50S ribosomal protein L10 [Salmonella enterica subsp. enterica
           serovar Newport str. SL254]
 gi|194447634|ref|YP_002048138.1| 50S ribosomal protein L10 [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL476]
 gi|194468828|ref|ZP_03074812.1| ribosomal protein L10 [Salmonella enterica subsp. enterica serovar
           Kentucky str. CVM29188]
 gi|194738328|ref|YP_002117054.1| 50S ribosomal protein L10 [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. CVM19633]
 gi|197247856|ref|YP_002149062.1| 50S ribosomal protein L10 [Salmonella enterica subsp. enterica
           serovar Agona str. SL483]
 gi|197263215|ref|ZP_03163289.1| ribosomal protein L10 [Salmonella enterica subsp. enterica serovar
           Saintpaul str. SARA23]
 gi|197364905|ref|YP_002144542.1| 50S ribosomal protein L10 [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. AKU_12601]
 gi|198245252|ref|YP_002218068.1| 50S ribosomal protein L10 [Salmonella enterica subsp. enterica
           serovar Dublin str. CT_02021853]
 gi|200388010|ref|ZP_03214622.1| ribosomal protein L10 [Salmonella enterica subsp. enterica serovar
           Virchow str. SL491]
 gi|204931281|ref|ZP_03222041.1| ribosomal protein L10 [Salmonella enterica subsp. enterica serovar
           Javiana str. GA_MM04042433]
 gi|205354446|ref|YP_002228247.1| 50S ribosomal protein L10 [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 287/91]
 gi|206577086|ref|YP_002241078.1| ribosomal protein L10 [Klebsiella pneumoniae 342]
 gi|207859329|ref|YP_002245980.1| 50S ribosomal protein L10 [Salmonella enterica subsp. enterica
           serovar Enteritidis str. P125109]
 gi|213163870|ref|ZP_03349580.1| 50S ribosomal protein L10 [Salmonella enterica subsp. enterica
           serovar Typhi str. E00-7866]
 gi|213425736|ref|ZP_03358486.1| 50S ribosomal protein L10 [Salmonella enterica subsp. enterica
           serovar Typhi str. E02-1180]
 gi|213582507|ref|ZP_03364333.1| 50S ribosomal protein L10 [Salmonella enterica subsp. enterica
           serovar Typhi str. E98-0664]
 gi|213623119|ref|ZP_03375902.1| 50S ribosomal protein L10 [Salmonella enterica subsp. enterica
           serovar Typhi str. E98-2068]
 gi|213650886|ref|ZP_03380939.1| 50S ribosomal protein L10 [Salmonella enterica subsp. enterica
           serovar Typhi str. J185]
 gi|213852737|ref|ZP_03382269.1| 50S ribosomal protein L10 [Salmonella enterica subsp. enterica
           serovar Typhi str. M223]
 gi|224585693|ref|YP_002639492.1| 50S ribosomal protein L10 [Salmonella enterica subsp. enterica
           serovar Paratyphi C strain RKS4594]
 gi|237727881|ref|ZP_04558362.1| 50S ribosomal subunit protein L10 [Citrobacter sp. 30_2]
 gi|238892455|ref|YP_002917189.1| 50S ribosomal protein L10 [Klebsiella pneumoniae NTUH-K2044]
 gi|238913730|ref|ZP_04657567.1| 50S ribosomal protein L10 [Salmonella enterica subsp. enterica
           serovar Tennessee str. CDC07-0191]
 gi|261340894|ref|ZP_05968752.1| ribosomal protein L10 [Enterobacter cancerogenus ATCC 35316]
 gi|262043782|ref|ZP_06016884.1| 50S ribosomal protein L10 [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
 gi|283787342|ref|YP_003367207.1| 50S ribosomal subunit protein L10 [Citrobacter rodentium ICC168]
 gi|288937723|ref|YP_003441782.1| ribosomal protein L10 [Klebsiella variicola At-22]
 gi|289826711|ref|ZP_06545676.1| 50S ribosomal protein L10 [Salmonella enterica subsp. enterica
           serovar Typhi str. E98-3139]
 gi|290513231|ref|ZP_06552592.1| 50S ribosomal protein L10 [Klebsiella sp. 1_1_55]
 gi|330005012|ref|ZP_08305083.1| ribosomal protein L10 [Klebsiella sp. MS 92-3]
 gi|61230415|sp|P0A297|RL10_SALTY RecName: Full=50S ribosomal protein L10
 gi|61230422|sp|P0A298|RL10_SALTI RecName: Full=50S ribosomal protein L10
 gi|75479236|sp|Q57H71|RL10_SALCH RecName: Full=50S ribosomal protein L10
 gi|81599689|sp|Q5PK95|RL10_SALPA RecName: Full=50S ribosomal protein L10
 gi|166229736|sp|A6TGN8|RL10_KLEP7 RecName: Full=50S ribosomal protein L10
 gi|189040931|sp|A9MHF4|RL10_SALAR RecName: Full=50S ribosomal protein L10
 gi|189040932|sp|A9N0J1|RL10_SALPB RecName: Full=50S ribosomal protein L10
 gi|226699963|sp|B5XYF7|RL10_KLEP3 RecName: Full=50S ribosomal protein L10
 gi|226699995|sp|B5F0W5|RL10_SALA4 RecName: Full=50S ribosomal protein L10
 gi|226699996|sp|B5FQJ7|RL10_SALDC RecName: Full=50S ribosomal protein L10
 gi|226699997|sp|B5QYD6|RL10_SALEP RecName: Full=50S ribosomal protein L10
 gi|226699998|sp|B5RFK3|RL10_SALG2 RecName: Full=50S ribosomal protein L10
 gi|226699999|sp|B4TCS2|RL10_SALHS RecName: Full=50S ribosomal protein L10
 gi|226700000|sp|B4T0Y7|RL10_SALNS RecName: Full=50S ribosomal protein L10
 gi|226700001|sp|B5BJQ1|RL10_SALPK RecName: Full=50S ribosomal protein L10
 gi|226700002|sp|B4TQJ3|RL10_SALSV RecName: Full=50S ribosomal protein L10
 gi|254798397|sp|C0Q2R5|RL10_SALPC RecName: Full=50S ribosomal protein L10
 gi|25295130|pir||AG0933 50S ribosomal chain protein L10 [imported] - Salmonella enterica
           subsp. enterica serovar Typhi (strain CT18)
 gi|47914|emb|CAA35085.1| unnamed protein product [Salmonella enterica subsp. enterica
           serovar Typhimurium]
 gi|47916|emb|CAA37245.1| unnamed protein product [Salmonella enterica subsp. enterica
           serovar Typhimurium]
 gi|6960337|gb|AAF33497.1| Salmonella typhimurium ribosomal protein L10 (RPLJ) (SW:P17352);
           contains similarity to Pfam domain PF00466
           (Ribosomal_L10), Score=132, E=1.1e-35, N=1 [Salmonella
           enterica subsp. enterica serovar Typhimurium str. LT2]
 gi|16422709|gb|AAL22979.1| 50S ribosomal subunit protein L10 [Salmonella enterica subsp.
           enterica serovar Typhimurium str. LT2]
 gi|16504606|emb|CAD09489.1| 50S ribosomal subunit protein L10 [Salmonella enterica subsp.
           enterica serovar Typhi]
 gi|29139425|gb|AAO70992.1| 50S ribosomal subunit protein L10 [Salmonella enterica subsp.
           enterica serovar Typhi str. Ty2]
 gi|56130235|gb|AAV79741.1| 50S ribosomal subunit protein L10 [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. ATCC 9150]
 gi|62130238|gb|AAX67941.1| 50S ribosomal subunit protein L10 [Salmonella enterica subsp.
           enterica serovar Choleraesuis str. SC-B67]
 gi|150957692|gb|ABR79722.1| 50S ribosomal protein L10 [Klebsiella pneumoniae subsp. pneumoniae
           MGH 78578]
 gi|160866714|gb|ABX23337.1| hypothetical protein SARI_03512 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
 gi|161366652|gb|ABX70420.1| hypothetical protein SPAB_05139 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|194403359|gb|ACF63581.1| ribosomal protein L10 [Salmonella enterica subsp. enterica serovar
           Newport str. SL254]
 gi|194405938|gb|ACF66157.1| ribosomal protein L10 [Salmonella enterica subsp. enterica serovar
           Heidelberg str. SL476]
 gi|194455192|gb|EDX44031.1| ribosomal protein L10 [Salmonella enterica subsp. enterica serovar
           Kentucky str. CVM29188]
 gi|194713830|gb|ACF93051.1| ribosomal protein L10 [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. CVM19633]
 gi|195629017|gb|EDX48409.1| ribosomal protein L10 [Salmonella enterica subsp. enterica serovar
           Newport str. SL317]
 gi|197096382|emb|CAR61987.1| 50S ribosomal subunit protein L10 [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. AKU_12601]
 gi|197211559|gb|ACH48956.1| ribosomal protein L10 [Salmonella enterica subsp. enterica serovar
           Agona str. SL483]
 gi|197241470|gb|EDY24090.1| ribosomal protein L10 [Salmonella enterica subsp. enterica serovar
           Saintpaul str. SARA23]
 gi|197939768|gb|ACH77101.1| ribosomal protein L10 [Salmonella enterica subsp. enterica serovar
           Dublin str. CT_02021853]
 gi|199605108|gb|EDZ03653.1| ribosomal protein L10 [Salmonella enterica subsp. enterica serovar
           Virchow str. SL491]
 gi|204319896|gb|EDZ05103.1| ribosomal protein L10 [Salmonella enterica subsp. enterica serovar
           Javiana str. GA_MM04042433]
 gi|205274227|emb|CAR39246.1| 50S ribosomal subunit protein L10 [Salmonella enterica subsp.
           enterica serovar Gallinarum str. 287/91]
 gi|205346990|gb|EDZ33621.1| ribosomal protein L10 [Salmonella enterica subsp. enterica serovar
           Hadar str. RI_05P066]
 gi|206566144|gb|ACI07920.1| ribosomal protein L10 [Klebsiella pneumoniae 342]
 gi|206711132|emb|CAR35506.1| 50S ribosomal subunit protein L10 [Salmonella enterica subsp.
           enterica serovar Enteritidis str. P125109]
 gi|224470221|gb|ACN48051.1| 50S ribosomal protein L10 [Salmonella enterica subsp. enterica
           serovar Paratyphi C strain RKS4594]
 gi|226910438|gb|EEH96356.1| 50S ribosomal subunit protein L10 [Citrobacter sp. 30_2]
 gi|238544771|dbj|BAH61122.1| 50S ribosomal protein L10 [Klebsiella pneumoniae subsp. pneumoniae
           NTUH-K2044]
 gi|259038869|gb|EEW40038.1| 50S ribosomal protein L10 [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
 gi|261249255|emb|CBG27117.1| 50S ribosomal subunit protein L10 [Salmonella enterica subsp.
           enterica serovar Typhimurium str. D23580]
 gi|267996449|gb|ACY91334.1| 50S ribosomal protein L10 [Salmonella enterica subsp. enterica
           serovar Typhimurium str. 14028S]
 gi|282950796|emb|CBG90472.1| 50S ribosomal subunit protein L10 [Citrobacter rodentium ICC168]
 gi|288316947|gb|EFC55885.1| ribosomal protein L10 [Enterobacter cancerogenus ATCC 35316]
 gi|288892432|gb|ADC60750.1| ribosomal protein L10 [Klebsiella variicola At-22]
 gi|289774328|gb|EFD82335.1| 50S ribosomal protein L10 [Klebsiella sp. 1_1_55]
 gi|301160647|emb|CBW20178.1| 50S ribosomal subunit protein L10 [Salmonella enterica subsp.
           enterica serovar Typhimurium str. SL1344]
 gi|320088582|emb|CBY98341.1| 50S ribosomal protein L10 [Salmonella enterica subsp. enterica
           serovar Weltevreden str. 2007-60-3289-1]
 gi|321223351|gb|EFX48418.1| LSU ribosomal protein L10p (P0) [Salmonella enterica subsp.
           enterica serovar Typhimurium str. TN061786]
 gi|322616261|gb|EFY13171.1| 50S ribosomal protein L10 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 315996572]
 gi|322617296|gb|EFY14198.1| 50S ribosomal protein L10 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-1]
 gi|322625932|gb|EFY22747.1| 50S ribosomal protein L10 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-3]
 gi|322626670|gb|EFY23472.1| 50S ribosomal protein L10 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-4]
 gi|322631505|gb|EFY28262.1| 50S ribosomal protein L10 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 515920-1]
 gi|322635218|gb|EFY31936.1| 50S ribosomal protein L10 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 515920-2]
 gi|322642615|gb|EFY39209.1| 50S ribosomal protein L10 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 531954]
 gi|322646788|gb|EFY43292.1| 50S ribosomal protein L10 [Salmonella enterica subsp. enterica
           serovar Montevideo str. NC_MB110209-0054]
 gi|322650787|gb|EFY47180.1| 50S ribosomal protein L10 [Salmonella enterica subsp. enterica
           serovar Montevideo str. OH_2009072675]
 gi|322655914|gb|EFY52215.1| 50S ribosomal protein L10 [Salmonella enterica subsp. enterica
           serovar Montevideo str. CASC_09SCPH15965]
 gi|322657313|gb|EFY53592.1| 50S ribosomal protein L10 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 19N]
 gi|322665575|gb|EFY61760.1| 50S ribosomal protein L10 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 81038-01]
 gi|322669758|gb|EFY65903.1| 50S ribosomal protein L10 [Salmonella enterica subsp. enterica
           serovar Montevideo str. MD_MDA09249507]
 gi|322670963|gb|EFY67095.1| 50S ribosomal protein L10 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 414877]
 gi|322679213|gb|EFY75266.1| 50S ribosomal protein L10 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 366867]
 gi|322679371|gb|EFY75418.1| 50S ribosomal protein L10 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 413180]
 gi|322688138|gb|EFY84102.1| 50S ribosomal protein L10 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 446600]
 gi|322717101|gb|EFZ08672.1| 50S ribosomal protein L10 [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. A50]
 gi|323132486|gb|ADX19916.1| 50S ribosomal protein L10 [Salmonella enterica subsp. enterica
           serovar Typhimurium str. 4/74]
 gi|323193406|gb|EFZ78616.1| 50S ribosomal protein L10 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 609458-1]
 gi|323200674|gb|EFZ85747.1| 50S ribosomal protein L10 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 556150-1]
 gi|323202163|gb|EFZ87219.1| 50S ribosomal protein L10 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 609460]
 gi|323209274|gb|EFZ94209.1| 50S ribosomal protein L10 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 507440-20]
 gi|323211599|gb|EFZ96436.1| 50S ribosomal protein L10 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 556152]
 gi|323218063|gb|EGA02776.1| 50S ribosomal protein L10 [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB101509-0077]
 gi|323221352|gb|EGA05774.1| 50S ribosomal protein L10 [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB102109-0047]
 gi|323225721|gb|EGA09942.1| 50S ribosomal protein L10 [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB110209-0055]
 gi|323230991|gb|EGA15108.1| 50S ribosomal protein L10 [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB111609-0052]
 gi|323235773|gb|EGA19855.1| 50S ribosomal protein L10 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 2009083312]
 gi|323240087|gb|EGA24133.1| 50S ribosomal protein L10 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 2009085258]
 gi|323242580|gb|EGA26602.1| 50S ribosomal protein L10 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 315731156]
 gi|323249712|gb|EGA33619.1| 50S ribosomal protein L10 [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2009159199]
 gi|323252595|gb|EGA36436.1| 50S ribosomal protein L10 [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008282]
 gi|323256911|gb|EGA40623.1| 50S ribosomal protein L10 [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008283]
 gi|323262067|gb|EGA45631.1| 50S ribosomal protein L10 [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008284]
 gi|323263928|gb|EGA47442.1| 50S ribosomal protein L10 [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008285]
 gi|323268459|gb|EGA51929.1| 50S ribosomal protein L10 [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008287]
 gi|326625861|gb|EGE32206.1| 50S ribosomal protein L10 [Salmonella enterica subsp. enterica
           serovar Dublin str. 3246]
 gi|326629579|gb|EGE35922.1| 50S ribosomal protein L10 [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 9]
 gi|328536454|gb|EGF62803.1| ribosomal protein L10 [Klebsiella sp. MS 92-3]
 gi|226909|prf||1611234A ribosomal protein L10
          Length = 165

 Score = 80.1 bits (196), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 48/154 (31%), Positives = 87/154 (56%), Gaps = 2/154 (1%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           +N Q K   ++E+S++   + S VVA  +G++V ++ +LRK  REAG  ++V +N L++ 
Sbjct: 3   LNLQDKQAIVAEVSEVAKGALSAVVADSRGVTVDKMTELRKAGREAGVYMRVVRNTLLRR 62

Query: 61  AIRDTSIRGISDLFVGQSLIVYS-DSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
            +  T    + D FVG +LI YS + P  A ++   F+  N +F V     E  ++    
Sbjct: 63  VVEGTQFECLKDTFVGPTLIAYSMEHPGAAARLFKEFAKANAKFEVKAAAFEGELIPASQ 122

Query: 120 IKQIASLPDLEGIRAGIISAI-QSNATRLVRLLG 152
           I ++A+LP  E   A +++ + +++A +LVR L 
Sbjct: 123 IDRLATLPTYEEAIARLMATMKEASAGKLVRTLA 156


>gi|210623168|ref|ZP_03293618.1| hypothetical protein CLOHIR_01568 [Clostridium hiranonis DSM 13275]
 gi|210153781|gb|EEA84787.1| hypothetical protein CLOHIR_01568 [Clostridium hiranonis DSM 13275]
          Length = 166

 Score = 80.1 bits (196), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 50/148 (33%), Positives = 87/148 (58%), Gaps = 2/148 (1%)

Query: 6   KSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDT 65
           KS+ +SE+ +  ++S S VV  YKG++VA++ +LRK MREAG   KV KN LV+ A ++ 
Sbjct: 8   KSLVVSEIVEKLNNSSSAVVVDYKGLTVAEVTELRKVMREAGVDYKVYKNTLVRRAAQEV 67

Query: 66  SIRGISD-LFVGQSLIVY-SDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQI 123
            I   +D L VG + I +  D PV   +I   F   + + ++  GVVE    ++  I ++
Sbjct: 68  GIEQFNDELLVGTNAIAFGYDDPVAPARILKKFIETHPKMKLKMGVVEGEFYDEAKIMEL 127

Query: 124 ASLPDLEGIRAGIISAIQSNATRLVRLL 151
           A++P  E + A ++ ++++  +  V L+
Sbjct: 128 ANIPSREELIAKLLGSLKAPVSNFVYLV 155


>gi|157147221|ref|YP_001454540.1| 50S ribosomal protein L10 [Citrobacter koseri ATCC BAA-895]
 gi|166229720|sp|A8AKU1|RL10_CITK8 RecName: Full=50S ribosomal protein L10
 gi|157084426|gb|ABV14104.1| hypothetical protein CKO_03004 [Citrobacter koseri ATCC BAA-895]
          Length = 165

 Score = 80.1 bits (196), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 48/154 (31%), Positives = 87/154 (56%), Gaps = 2/154 (1%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           +N Q K   ++E+S++   + S VVA  +G++V ++ +LRK  REAG  ++V +N L++ 
Sbjct: 3   LNLQDKQAIVAEVSEVAKGALSAVVADSRGVTVDKMTELRKAGREAGVYMRVVRNTLLRR 62

Query: 61  AIRDTSIRGISDLFVGQSLIVYS-DSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
            +  T    + D FVG +LI YS + P  A ++   F+  N +F V     E  ++    
Sbjct: 63  VVEGTPFECLKDTFVGPTLIAYSMEHPGAAARLFKEFAKANAKFEVKAAAFEGELIPASQ 122

Query: 120 IKQIASLPDLEGIRAGIISAI-QSNATRLVRLLG 152
           I ++A+LP  E   A +++ + +++A +LVR L 
Sbjct: 123 IDRLATLPTYEEAIARLMATMKEASAGKLVRTLA 156


>gi|288917218|ref|ZP_06411587.1| ribosomal protein L10 [Frankia sp. EUN1f]
 gi|288351409|gb|EFC85617.1| ribosomal protein L10 [Frankia sp. EUN1f]
          Length = 192

 Score = 80.1 bits (196), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 50/166 (30%), Positives = 83/166 (50%), Gaps = 2/166 (1%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M    K+  ++E+++ F  S + V+  Y+G++V+Q+ +LR+ + E      V KN L KI
Sbjct: 1   MANSEKTAAVAEIAEEFRGSTAAVLTEYRGLTVSQLTELRRTLGETTR-YAVVKNTLTKI 59

Query: 61  AIRDTSIRGISDLFVGQSLIVY-SDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
           A     + G+ DL VG + + +    PV A K    F+  N    V GG VE   +  D 
Sbjct: 60  AAEQAGVSGLDDLLVGPTAVAFVGGDPVEAAKGLRDFARANPALIVKGGYVEGKAMTADE 119

Query: 120 IKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAF 165
           I+++A L   E + A +  A+  +  + V L   P +QV R + A 
Sbjct: 120 IRKLADLESREVLLAKLAGAMNGSLAKAVGLFAAPLSQVARLVEAL 165


>gi|310644215|ref|YP_003948974.1| 50S ribosomal protein l10 [Paenibacillus polymyxa SC2]
 gi|309249167|gb|ADO58734.1| 50S ribosomal protein L10 [Paenibacillus polymyxa SC2]
          Length = 167

 Score = 80.1 bits (196), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 52/169 (30%), Positives = 84/169 (49%), Gaps = 12/169 (7%)

Query: 4   QGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIR 63
           Q K   +  ++     S + VVA Y+G++VAQ+ +LRK++REAG   +V KN L++ A  
Sbjct: 8   QAKQEAVEVVAAKLRESVTTVVADYRGLNVAQVTELRKQLREAGIEFQVLKNTLLRRATA 67

Query: 64  DTSIRGISDLFVGQSLIVY-SDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQ 122
              +  +  +  G + I +  D  V A KI   F+  N    + G VVE  V+  + IK 
Sbjct: 68  AAELTELDAVLTGPTAIAFGKDDAVSAAKILNDFAKKNTALELKGAVVEGRVIGVEEIKA 127

Query: 123 IASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQQ 171
           +A LP  EG+ + ++S +Q+           P      A+ A  DK +Q
Sbjct: 128 LAELPSREGLLSMLLSVLQA-----------PMRNFALAVKAVADKEEQ 165


>gi|260655337|ref|ZP_05860825.1| ribosomal protein L10 [Jonquetella anthropi E3_33 E1]
 gi|260629785|gb|EEX47979.1| ribosomal protein L10 [Jonquetella anthropi E3_33 E1]
          Length = 177

 Score = 80.1 bits (196), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 47/174 (27%), Positives = 94/174 (54%), Gaps = 3/174 (1%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M  Q K  E++ L +    + ++ +  Y+G+SV +  +LRK +R+AGG V+VA+N L+ I
Sbjct: 1   MPAQYKIDEVALLREALEGADAVFITEYRGLSVEKSTELRKAVRDAGGHVRVARNTLMSI 60

Query: 61  AIRDTSIRGISDLFVGQS--LIVYSDSPVIAPKIS-VSFSNDNNEFRVLGGVVEKGVLNQ 117
           A+++  +    ++  G +  +I Y +SP +A  +   +   +N    + GGV+ + VL+ 
Sbjct: 61  ALKEHGLAHPDEMMTGPNAYIISYGESPAVAKALEDFAAKKENAALVIKGGVMGESVLDS 120

Query: 118 DSIKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQQ 171
            ++  +A LP  E +RA ++  + +    LV +L      +V  +S   +K ++
Sbjct: 121 KAVAALAKLPSKEQLRAQVVGTMVAPLRGLVTVLSGTMRGLVTCLSQLAEKKEK 174


>gi|29653580|ref|NP_819272.1| 50S ribosomal protein L10 [Coxiella burnetii RSA 493]
 gi|153209794|ref|ZP_01947511.1| ribosomal protein L10 [Coxiella burnetii 'MSU Goat Q177']
 gi|154705819|ref|YP_001425192.1| 50S ribosomal protein L10 [Coxiella burnetii Dugway 5J108-111]
 gi|161830516|ref|YP_001596173.1| 50S ribosomal protein L10 [Coxiella burnetii RSA 331]
 gi|165918634|ref|ZP_02218720.1| ribosomal protein L10 [Coxiella burnetii RSA 334]
 gi|212213260|ref|YP_002304196.1| 50S ribosomal protein L10 [Coxiella burnetii CbuG_Q212]
 gi|212218062|ref|YP_002304849.1| 50S ribosomal protein L10 [Coxiella burnetii CbuK_Q154]
 gi|61215274|sp|Q83ET2|RL10_COXBU RecName: Full=50S ribosomal protein L10
 gi|189040911|sp|A9KD41|RL10_COXBN RecName: Full=50S ribosomal protein L10
 gi|189040912|sp|A9NAL2|RL10_COXBR RecName: Full=50S ribosomal protein L10
 gi|226699930|sp|B6J5C0|RL10_COXB1 RecName: Full=50S ribosomal protein L10
 gi|226699931|sp|B6J273|RL10_COXB2 RecName: Full=50S ribosomal protein L10
 gi|29540842|gb|AAO89786.1| LSU ribosomal protein L10P [Coxiella burnetii RSA 493]
 gi|120575245|gb|EAX31869.1| ribosomal protein L10 [Coxiella burnetii 'MSU Goat Q177']
 gi|154355105|gb|ABS76567.1| LSU ribosomal protein L10P [Coxiella burnetii Dugway 5J108-111]
 gi|161762383|gb|ABX78025.1| ribosomal protein L10 [Coxiella burnetii RSA 331]
 gi|165917662|gb|EDR36266.1| ribosomal protein L10 [Coxiella burnetii RSA 334]
 gi|212011670|gb|ACJ19051.1| LSU ribosomal protein L10P [Coxiella burnetii CbuG_Q212]
 gi|212012324|gb|ACJ19704.1| LSU ribosomal protein L10P [Coxiella burnetii CbuK_Q154]
          Length = 174

 Score = 80.1 bits (196), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 46/170 (27%), Positives = 92/170 (54%), Gaps = 1/170 (0%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           +N + K   ++E++ I + + S V A Y+G++V+++ DLRK  REA   ++V +N L + 
Sbjct: 3   LNLEQKKAMVAEITDIANQAVSAVAADYRGLTVSEMSDLRKSAREARVHMRVYRNTLARR 62

Query: 61  AIRDTSIRGISDLFVGQSLIVYS-DSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
           A ++T+   + ++  G  ++ +S + P  A ++   F  ++    V G  +   +L  + 
Sbjct: 63  AFKETTYACLEEVLTGPIVLFFSQEEPGAAARLIEKFIKEHERLEVKGLALGGELLPAEK 122

Query: 120 IKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKN 169
           +K +A LP  E   + + + + +  T+LVR L  P  QV R ++A  D+ 
Sbjct: 123 LKAVARLPSREEALSQLAAVLLAPVTKLVRTLNEPIAQVARVMAAVRDQK 172


>gi|46143568|ref|ZP_00134927.2| COG0244: Ribosomal protein L10 [Actinobacillus pleuropneumoniae
           serovar 1 str. 4074]
 gi|126209184|ref|YP_001054409.1| 50S ribosomal protein L10 [Actinobacillus pleuropneumoniae L20]
 gi|190151049|ref|YP_001969574.1| 50S ribosomal protein L10 [Actinobacillus pleuropneumoniae serovar
           7 str. AP76]
 gi|303249962|ref|ZP_07336164.1| 50S ribosomal protein L10 [Actinobacillus pleuropneumoniae serovar
           6 str. Femo]
 gi|303253134|ref|ZP_07339283.1| 50S ribosomal protein L10 [Actinobacillus pleuropneumoniae serovar
           2 str. 4226]
 gi|166229698|sp|A3N318|RL10_ACTP2 RecName: Full=50S ribosomal protein L10
 gi|226699899|sp|B3GYU6|RL10_ACTP7 RecName: Full=50S ribosomal protein L10
 gi|126097976|gb|ABN74804.1| 50S ribosomal protein L10 [Actinobacillus pleuropneumoniae serovar
           5b str. L20]
 gi|189916180|gb|ACE62432.1| 50S ribosomal protein L10 [Actinobacillus pleuropneumoniae serovar
           7 str. AP76]
 gi|302647816|gb|EFL78023.1| 50S ribosomal protein L10 [Actinobacillus pleuropneumoniae serovar
           2 str. 4226]
 gi|302651025|gb|EFL81179.1| 50S ribosomal protein L10 [Actinobacillus pleuropneumoniae serovar
           6 str. Femo]
          Length = 163

 Score = 80.1 bits (196), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 53/177 (29%), Positives = 93/177 (52%), Gaps = 22/177 (12%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           +N Q K   ++E+++    + S VVA  +G++V ++ +LRK  REAG  ++V +N L++ 
Sbjct: 3   LNLQDKQAIVAEVNEAAKGALSAVVADSRGVTVEKMTELRKSAREAGVTMRVVRNTLLRR 62

Query: 61  AIRDTSIRGISDLFVGQSLIVYS-DSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
           A+  T    ++D F G +LI +S + P  A ++   F+  N EF + G   E  V  QD 
Sbjct: 63  AVEGTEFECLTDTFTGPTLIAFSHEHPGAAARLFTEFAKANKEFELKGAAFEGKV--QD- 119

Query: 120 IKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQT----QVVRAISAFVDKNQQG 172
           ++ +A+LP  E                + RL+GT +     ++VR ++A  DK Q+ 
Sbjct: 120 VEFLATLPTYEEA--------------IARLMGTMKEAAAGKLVRTLAALRDKLQEA 162


>gi|222056714|ref|YP_002539076.1| ribosomal protein L10 [Geobacter sp. FRC-32]
 gi|254798380|sp|B9M6V4|RL10_GEOSF RecName: Full=50S ribosomal protein L10
 gi|221566003|gb|ACM21975.1| ribosomal protein L10 [Geobacter sp. FRC-32]
          Length = 174

 Score = 80.1 bits (196), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 47/166 (28%), Positives = 91/166 (54%), Gaps = 2/166 (1%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           MN++GK   ++E+      + ++ +A ++G++V Q  +LR ++R+A    KV KN L+++
Sbjct: 1   MNKEGKHQLVTEVHDKLQRAKAVFLADFRGMNVGQATELRNELRKAAVEFKVVKNTLLEL 60

Query: 61  AIRDTSIRGISDLFVGQSLI-VYSDSPVIAPKISVSFSND-NNEFRVLGGVVEKGVLNQD 118
           A + T    ++  F G + + +  D PV A K+   F+ +  N F +  GV+    ++  
Sbjct: 61  ASKGTDKEALNPYFAGPTAVAITYDDPVAAAKVLSRFAKETTNPFTLKAGVLSGKAISPA 120

Query: 119 SIKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISA 164
            I+ +A LP  E + A ++ ++Q+ AT  V +L       VRA++A
Sbjct: 121 DIQALADLPSREVLIAKMLGSMQAPATNFVGVLAAVPGSFVRALNA 166


>gi|307152577|ref|YP_003887961.1| 50S ribosomal protein L10 [Cyanothece sp. PCC 7822]
 gi|306982805|gb|ADN14686.1| ribosomal protein L10 [Cyanothece sp. PCC 7822]
          Length = 175

 Score = 80.1 bits (196), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 52/171 (30%), Positives = 91/171 (53%), Gaps = 2/171 (1%)

Query: 2   NRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIA 61
            R+ K   +++   +   S   VV  Y+G++VA+I DLR+++R  GG  K+AKN LV+IA
Sbjct: 4   TRENKEEVVADFKGLLKESQLAVVIDYQGLTVAEITDLRRRLRPLGGTCKIAKNTLVRIA 63

Query: 62  IR-DTSIRGISDLFVGQSLIVYSDSPV-IAPKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
           +  D   + + +   G S I+     V  A K   +F  D+ +  + GGV+E   L +D 
Sbjct: 64  VDGDEKWQVMHEHLKGSSAILLVPEDVGGAVKAYKAFQKDSKKTELRGGVMEGRSLTKDQ 123

Query: 120 IKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQ 170
           ++ +A LP  E + A I  A+ + AT++   +    + + R I A+ +K +
Sbjct: 124 VEALADLPTKEQLYAQIAGALNALATKIAVGIKEVPSSIARGIQAYSEKEE 174


>gi|257454926|ref|ZP_05620174.1| 50S ribosomal protein L10 [Enhydrobacter aerosaccus SK60]
 gi|257447636|gb|EEV22631.1| 50S ribosomal protein L10 [Enhydrobacter aerosaccus SK60]
          Length = 169

 Score = 80.1 bits (196), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 51/175 (29%), Positives = 93/175 (53%), Gaps = 19/175 (10%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           +N Q K   ++E+S+    + S VVA  +G++V ++  LRK+ R AG  +++ +N L++ 
Sbjct: 3   LNLQDKQAIVAEVSESAKGALSAVVADARGVTVGKMTQLRKEARAAGVDMRIVRNTLLRR 62

Query: 61  AIRDTSIRGISDLFVGQSLIVYS-DSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
           A+ DT+   ++D+FVG +LI +S + P  A ++   F+  N++F + G   E   +    
Sbjct: 63  ALEDTNYTVLNDVFVGPTLIAFSTEHPGAAARLFKEFAKTNDKFEIKGAAFEGEFIAAKD 122

Query: 120 IKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQT----QVVRAISAFVDKNQ 170
           I ++ASLP  +                + RL+GT +     + VR ++A  DK Q
Sbjct: 123 IDRLASLPTYD--------------EAIARLMGTMKEAAAGKFVRTLAALRDKMQ 163


>gi|227431253|ref|ZP_03913307.1| ribosomal protein L10 [Leuconostoc mesenteroides subsp. cremoris
           ATCC 19254]
 gi|227353015|gb|EEJ43187.1| ribosomal protein L10 [Leuconostoc mesenteroides subsp. cremoris
           ATCC 19254]
          Length = 178

 Score = 80.1 bits (196), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 43/137 (31%), Positives = 80/137 (58%), Gaps = 1/137 (0%)

Query: 6   KSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDT 65
           K+ ++ E++  F ++ S VV   +G++VAQ  +LR ++RE G  ++V KN+++  A    
Sbjct: 9   KAQKVEEIADQFKAAASAVVVDPRGLTVAQSTELRHQLREEGVVLEVIKNKVLTRAAEKA 68

Query: 66  SIRGISDLFVGQSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIA 124
               ++D+F G S + +S+   +AP +I   F+++N    + GGVV+  + N D I + A
Sbjct: 69  GYAELNDIFSGPSAVAFSNDDAVAPARILKKFADENEALEIKGGVVDGTIANIDDINKYA 128

Query: 125 SLPDLEGIRAGIISAIQ 141
           SLP  EG+   +++  Q
Sbjct: 129 SLPSREGLLGQLMAEFQ 145


>gi|329938253|ref|ZP_08287704.1| 50S ribosomal protein L10 [Streptomyces griseoaurantiacus M045]
 gi|329302742|gb|EGG46632.1| 50S ribosomal protein L10 [Streptomyces griseoaurantiacus M045]
          Length = 176

 Score = 80.1 bits (196), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 56/177 (31%), Positives = 94/177 (53%), Gaps = 9/177 (5%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M R  K+  ++EL+  F +S + V+  Y+G++VAQ+K LR+ + E      V KN L KI
Sbjct: 1   MARPDKAAAVAELTDQFRNSSAAVLTEYRGLTVAQLKTLRRSLGE-NAQYAVVKNTLTKI 59

Query: 61  AIRDTSIRGISDLFVGQSLIVY-SDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
           A  +  I  + DLF G + + + +  PV + K    F+ +N    + GGV++   L+ D 
Sbjct: 60  AANEAGITTLDDLFNGPTAVAFVTGDPVESAKGLRDFAKENPNLVIKGGVLDGKALSADE 119

Query: 120 IKQIASLPDLEGI---RAGIISAIQSNATRLVRLLGTPQTQVVRAISAF-VDKNQQG 172
           IK++A L   E +    AG   A QS A  + + L    +++VR + A    +++QG
Sbjct: 120 IKKLADLESREVLLSKLAGAFKAKQSQAASVFQAL---PSKLVRTVDALRAKQDEQG 173


>gi|296111505|ref|YP_003621887.1| ribosomal protein L10 [Leuconostoc kimchii IMSNU 11154]
 gi|295833037|gb|ADG40918.1| ribosomal protein L10 [Leuconostoc kimchii IMSNU 11154]
          Length = 178

 Score = 80.1 bits (196), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 44/137 (32%), Positives = 79/137 (57%), Gaps = 1/137 (0%)

Query: 6   KSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDT 65
           K+ ++ E++  F +S S VV   +G++VAQ  DLR ++R+ G  ++V KN+++  A    
Sbjct: 9   KAQKVEEVADQFKNSASAVVVDARGLTVAQSTDLRHQLRQEGVVLEVIKNKILTRAAEKA 68

Query: 66  SIRGISDLFVGQSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIA 124
               ++D+F G S + +S    IAP +I   F++ N +  + GGVV+  + N + I + A
Sbjct: 69  GYAELNDVFAGPSAVAFSTEDAIAPSRILKKFADANEKLEIKGGVVDGNIANLEDISKYA 128

Query: 125 SLPDLEGIRAGIISAIQ 141
           SLP  EG+   +++  Q
Sbjct: 129 SLPSREGLLGQLMAEFQ 145


>gi|118616527|ref|YP_904859.1| 50S ribosomal protein L10 [Mycobacterium ulcerans Agy99]
 gi|183981010|ref|YP_001849301.1| 50S ribosomal protein L10, RplJ [Mycobacterium marinum M]
 gi|118568637|gb|ABL03388.1| 50S ribosomal protein L10, RplJ [Mycobacterium ulcerans Agy99]
 gi|183174336|gb|ACC39446.1| 50S ribosomal protein L10, RplJ [Mycobacterium marinum M]
          Length = 206

 Score = 80.1 bits (196), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 45/169 (26%), Positives = 89/169 (52%), Gaps = 2/169 (1%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M R  K+  ++++++ F +S + V+  Y+G++V+ + +LR+ + E+     VAKN L+K 
Sbjct: 1   MARADKATAVADIAEHFKASTATVITEYRGLTVSNLAELRRSLGESAT-YAVAKNTLIKR 59

Query: 61  AIRDTSIRGISDLFVGQSLIVY-SDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
           A  +  + G+ +LF G + I +    PV A K   +F+ ++    + GG ++   L    
Sbjct: 60  AASEAGVEGLDELFAGPTAIAFVKGEPVDAAKALKTFAKEHKALVIKGGYMDGHALTVAE 119

Query: 120 IKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDK 168
           +++IA L   E + A +  A++ N  +   L   P +Q  R  +A  +K
Sbjct: 120 VERIADLETREVLLAKLAGAMKGNLAKAAGLFNAPASQFARLAAALQEK 168


>gi|283836721|ref|ZP_06356462.1| ribosomal protein L10 [Citrobacter youngae ATCC 29220]
 gi|311281465|ref|YP_003943696.1| ribosomal protein L10 [Enterobacter cloacae SCF1]
 gi|291067268|gb|EFE05377.1| ribosomal protein L10 [Citrobacter youngae ATCC 29220]
 gi|308750660|gb|ADO50412.1| ribosomal protein L10 [Enterobacter cloacae SCF1]
          Length = 165

 Score = 80.1 bits (196), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 48/154 (31%), Positives = 87/154 (56%), Gaps = 2/154 (1%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           +N Q K   ++E+S++   + S VVA  +G++V ++ +LRK  REAG  ++V +N L++ 
Sbjct: 3   LNLQDKQAIVAEVSEVAKGALSAVVADSRGVTVDKMTELRKAGREAGVYMRVVRNTLLRR 62

Query: 61  AIRDTSIRGISDLFVGQSLIVYS-DSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
            +  T    + D FVG +LI YS + P  A ++   F+  N +F V     E  ++    
Sbjct: 63  VVEGTQFECLKDAFVGPTLIAYSMEHPGAAARLFKEFAKANAKFEVKAAAFEGELIPASQ 122

Query: 120 IKQIASLPDLEGIRAGIISAI-QSNATRLVRLLG 152
           I ++A+LP  E   A +++ + +++A +LVR L 
Sbjct: 123 IDRLATLPTYEEAIARLMATMKEASAGKLVRTLA 156


>gi|205372080|ref|ZP_03224897.1| 50S ribosomal protein L10 [Bacillus coahuilensis m4-4]
          Length = 166

 Score = 80.1 bits (196), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 56/171 (32%), Positives = 91/171 (53%), Gaps = 13/171 (7%)

Query: 4   QGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIR 63
           + K V +SE++  F SS S+VV  Y+G+ VA++ +LRK+MREAG   KV KN +V+ A  
Sbjct: 6   EQKKVLVSEIADKFKSSVSVVVVDYRGLKVAEVTELRKQMREAGVEFKVLKNSMVRRAAE 65

Query: 64  DTSIRGISDLFVGQSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQ 122
              +  +++   G + I +S   VIAP KI   F+  +    +  GV+E  V + + +K 
Sbjct: 66  SVELGALNESLTGPNAIAFSAEDVIAPAKILNDFAKKHEALEIKAGVIEGNVASAEEVKA 125

Query: 123 IASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVD-KNQQG 172
           +A LP  +G+ + ++S +Q+           P      A  A  D K +QG
Sbjct: 126 LAELPSRDGLLSMLLSVLQA-----------PMRNFALATKAVADQKEEQG 165


>gi|330470184|ref|YP_004407927.1| 50S ribosomal protein L10 [Verrucosispora maris AB-18-032]
 gi|328813155|gb|AEB47327.1| 50S ribosomal protein L10 [Verrucosispora maris AB-18-032]
          Length = 181

 Score = 80.1 bits (196), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 49/171 (28%), Positives = 90/171 (52%), Gaps = 4/171 (2%)

Query: 3   RQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKM-REAGGGVKVAKNRLVKIA 61
           R  K+  ++EL++ F S+G+ V+  Y+G++V+Q+  LR+ + +E      VAKN L K A
Sbjct: 7   RADKATAVAELTESFRSAGATVLTEYRGLTVSQLTQLRRSLGKET--SYTVAKNTLAKRA 64

Query: 62  IRDTSIRGISDLFVGQSLIVYSDSPVI-APKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
             D  I G+ +LF G + + +    V+ A K    F+  N +  + GGV E   ++   +
Sbjct: 65  AADAGISGLDELFTGPTALTFVSGDVVEAAKGLRDFAKANPKLVIKGGVFEGKAISAAEV 124

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQQ 171
            ++A L   E + A +  A++ N ++   L   P ++  R  +A  DK ++
Sbjct: 125 TKLADLESREVLLAKLAGAMKGNLSKAAALFQAPLSKTARLAAALQDKREK 175


>gi|307246646|ref|ZP_07528717.1| 50S ribosomal protein L10 [Actinobacillus pleuropneumoniae serovar
           1 str. 4074]
 gi|307248773|ref|ZP_07530786.1| 50S ribosomal protein L10 [Actinobacillus pleuropneumoniae serovar
           2 str. S1536]
 gi|307251016|ref|ZP_07532941.1| 50S ribosomal protein L10 [Actinobacillus pleuropneumoniae serovar
           4 str. M62]
 gi|307253392|ref|ZP_07535263.1| 50S ribosomal protein L10 [Actinobacillus pleuropneumoniae serovar
           6 str. Femo]
 gi|307255631|ref|ZP_07537436.1| 50S ribosomal protein L10 [Actinobacillus pleuropneumoniae serovar
           9 str. CVJ13261]
 gi|307257807|ref|ZP_07539564.1| 50S ribosomal protein L10 [Actinobacillus pleuropneumoniae serovar
           10 str. D13039]
 gi|307260082|ref|ZP_07541794.1| 50S ribosomal protein L10 [Actinobacillus pleuropneumoniae serovar
           11 str. 56153]
 gi|307262211|ref|ZP_07543861.1| 50S ribosomal protein L10 [Actinobacillus pleuropneumoniae serovar
           12 str. 1096]
 gi|307264412|ref|ZP_07545998.1| 50S ribosomal protein L10 [Actinobacillus pleuropneumoniae serovar
           13 str. N273]
 gi|306852518|gb|EFM84752.1| 50S ribosomal protein L10 [Actinobacillus pleuropneumoniae serovar
           1 str. 4074]
 gi|306854700|gb|EFM86890.1| 50S ribosomal protein L10 [Actinobacillus pleuropneumoniae serovar
           2 str. S1536]
 gi|306856956|gb|EFM89087.1| 50S ribosomal protein L10 [Actinobacillus pleuropneumoniae serovar
           4 str. M62]
 gi|306859071|gb|EFM91113.1| 50S ribosomal protein L10 [Actinobacillus pleuropneumoniae serovar
           6 str. Femo]
 gi|306861480|gb|EFM93469.1| 50S ribosomal protein L10 [Actinobacillus pleuropneumoniae serovar
           9 str. CVJ13261]
 gi|306863713|gb|EFM95639.1| 50S ribosomal protein L10 [Actinobacillus pleuropneumoniae serovar
           10 str. D13039]
 gi|306865918|gb|EFM97794.1| 50S ribosomal protein L10 [Actinobacillus pleuropneumoniae serovar
           11 str. 56153]
 gi|306868085|gb|EFM99911.1| 50S ribosomal protein L10 [Actinobacillus pleuropneumoniae serovar
           12 str. 1096]
 gi|306870228|gb|EFN01986.1| 50S ribosomal protein L10 [Actinobacillus pleuropneumoniae serovar
           13 str. N273]
          Length = 170

 Score = 80.1 bits (196), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 53/177 (29%), Positives = 93/177 (52%), Gaps = 22/177 (12%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           +N Q K   ++E+++    + S VVA  +G++V ++ +LRK  REAG  ++V +N L++ 
Sbjct: 10  LNLQDKQAIVAEVNEAAKGALSAVVADSRGVTVEKMTELRKSAREAGVTMRVVRNTLLRR 69

Query: 61  AIRDTSIRGISDLFVGQSLIVYS-DSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
           A+  T    ++D F G +LI +S + P  A ++   F+  N EF + G   E  V  QD 
Sbjct: 70  AVEGTEFECLTDTFTGPTLIAFSHEHPGAAARLFTEFAKANKEFELKGAAFEGKV--QD- 126

Query: 120 IKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQT----QVVRAISAFVDKNQQG 172
           ++ +A+LP  E                + RL+GT +     ++VR ++A  DK Q+ 
Sbjct: 127 VEFLATLPTYEEA--------------IARLMGTMKEAAAGKLVRTLAALRDKLQEA 169


>gi|229592912|ref|YP_002875031.1| 50S ribosomal protein L10 [Pseudomonas fluorescens SBW25]
 gi|259645489|sp|C3K2Y5|RL10_PSEFS RecName: Full=50S ribosomal protein L10
 gi|229364778|emb|CAY52781.1| 50S ribosomal protein L10 [Pseudomonas fluorescens SBW25]
          Length = 166

 Score = 80.1 bits (196), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 48/158 (30%), Positives = 87/158 (55%), Gaps = 1/158 (0%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           +N + K   ++E+++   ++ S VVA  +G++V+ +  LRK+ REAG  V+V +N L+K 
Sbjct: 3   INLEDKKAIVAEVNEAAKAALSAVVADARGVTVSAMTGLRKEAREAGVYVRVVRNTLLKR 62

Query: 61  AIRDTSIRGISDLFVGQSLIVYS-DSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
           A+ DT    ++D+F G +LI +S D P  A ++   F+   ++F +     E   L  + 
Sbjct: 63  AVADTEYSVLNDVFTGPTLIAFSTDHPGAAARLFKEFAKGQDKFEIKAAAFEGKFLAANQ 122

Query: 120 IKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQ 157
           I  +A+LP      + ++S IQ   ++L R L   + Q
Sbjct: 123 IDVLATLPTRNEAISQLMSVIQGATSKLARTLAAVREQ 160


>gi|304405630|ref|ZP_07387289.1| ribosomal protein L10 [Paenibacillus curdlanolyticus YK9]
 gi|304345669|gb|EFM11504.1| ribosomal protein L10 [Paenibacillus curdlanolyticus YK9]
          Length = 167

 Score = 80.1 bits (196), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 52/140 (37%), Positives = 84/140 (60%), Gaps = 1/140 (0%)

Query: 4   QGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIR 63
           Q K + + E++    +S S VVA Y+G++VAQ+ +LRK++REAG   +V KN LV+ A  
Sbjct: 8   QEKQLAVDEIAAKLRASSSTVVADYRGLNVAQVTELRKQLREAGIEFQVLKNSLVRRATA 67

Query: 64  DTSIRGISDLFVGQSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQ 122
              +  +  +  G + I +    ++AP KI  SF+  N+  +V GGVVE  V+  D IK 
Sbjct: 68  SAELTELDAVLTGPTAIAFGGDDIVAPAKILSSFAKKNDALQVKGGVVEGRVVGVDQIKA 127

Query: 123 IASLPDLEGIRAGIISAIQS 142
           +A LP  EG+ + ++S +Q+
Sbjct: 128 LADLPSREGLLSMLLSVLQA 147


>gi|224827269|ref|ZP_03700363.1| ribosomal protein L10 [Lutiella nitroferrum 2002]
 gi|224600558|gb|EEG06747.1| ribosomal protein L10 [Lutiella nitroferrum 2002]
          Length = 165

 Score = 80.1 bits (196), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 48/170 (28%), Positives = 87/170 (51%), Gaps = 11/170 (6%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           +N + K   ++E+S     + ++V+A Y+GI V  +  LR K RE G  ++V KN LV+ 
Sbjct: 3   LNLEDKKAVVAEVSAQLVDAQTLVIAEYRGIEVGSMTQLRAKARENGVYLRVLKNTLVRR 62

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A+ DT+  G++D  VG  +   S  PV A K+   F+  +++  +  G  +  VL+   +
Sbjct: 63  AVADTAFAGLADQMVGPLVYGISADPVAAAKVLQQFAKQDDKIVIKAGSYDGKVLDAAQV 122

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQ 170
            ++AS+P  E +            ++L+ +L  P     R ++A  +K Q
Sbjct: 123 AELASIPSREELL-----------SKLLYVLQAPMAGFARGLAALAEKKQ 161


>gi|320527673|ref|ZP_08028847.1| ribosomal protein L10 [Solobacterium moorei F0204]
 gi|320131994|gb|EFW24550.1| ribosomal protein L10 [Solobacterium moorei F0204]
          Length = 181

 Score = 80.1 bits (196), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 42/158 (26%), Positives = 85/158 (53%), Gaps = 11/158 (6%)

Query: 10  ISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRG 69
           +SE+ + F++S S +VA Y+G+SVA++ +LR+ +R  G  +KV KN L   A  D     
Sbjct: 13  VSEIKEKFTNSSSTIVAEYRGLSVAEVTELRRALRAEGVELKVYKNTLASKAAEDAGYGD 72

Query: 70  ISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASLPDL 129
           + D   G + + +      A ++   F+  +    + GG+VE  V++ +++ ++++LP+ 
Sbjct: 73  LKDCLTGPNALAFGGDETGAARVMAKFAKKHKALVLKGGIVEGKVVDLNTVNELSALPNR 132

Query: 130 EGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVD 167
           EG+ + ++S           +L  P +   RA++A  +
Sbjct: 133 EGMLSMLLS-----------VLNAPVSSFARAVNAVAE 159


>gi|223982608|ref|ZP_03632843.1| hypothetical protein HOLDEFILI_00117 [Holdemania filiformis DSM
           12042]
 gi|223965445|gb|EEF69722.1| hypothetical protein HOLDEFILI_00117 [Holdemania filiformis DSM
           12042]
          Length = 178

 Score = 80.1 bits (196), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 40/139 (28%), Positives = 81/139 (58%)

Query: 4   QGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIR 63
           + K   +SE+ +  ++S S VV  Y+G++VA++ +LR+ +R  G   KV KN + + A  
Sbjct: 12  ESKKAVVSEIQEKMTASQSTVVVEYRGLTVAEVTELRRSLRAEGIEFKVYKNSMSQRAAE 71

Query: 64  DTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQI 123
                 +++   G + I +SD  V   ++   F+  +++  + G +VE  V+  D+IK++
Sbjct: 72  AAGFNELTEQLTGPNAIAFSDDAVAPSRVLAKFAKKHDKLVLKGAIVEGKVVGVDTIKEL 131

Query: 124 ASLPDLEGIRAGIISAIQS 142
           +SLP+ EG+ + ++S +Q+
Sbjct: 132 SSLPNREGMLSMLLSCLQA 150


>gi|298253099|ref|ZP_06976891.1| ribosomal protein L10 [Gardnerella vaginalis 5-1]
 gi|297532494|gb|EFH71380.1| ribosomal protein L10 [Gardnerella vaginalis 5-1]
          Length = 173

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 54/177 (30%), Positives = 88/177 (49%), Gaps = 10/177 (5%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKM-REAGGGVKVAKNRLVK 59
           M R  K   ++EL+K+F ++ +I +  Y+G++V QI  LR+K+ R+      VAKN L +
Sbjct: 1   MKRPEKEAVVAELTKLFRNADAIYLTEYRGLTVPQISTLREKLGRDT--SYSVAKNTLAR 58

Query: 60  IAIRDTSIRGISDLFVGQSLIVYSDSPVI-APKISVSFSNDNNEFRVLGGVVEKGVLNQD 118
           IA ++  I G+ +L  G + + +     I A K    F+ +N    + GG  +  V + +
Sbjct: 59  IAAKEAGIEGLDELLAGPTAVTFVKGDFIEAAKTLRDFAKENKALVIKGGFADGTVYDAE 118

Query: 119 SIKQIASL---PDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQQG 172
             KQ+A L   P L    AG +    S A  L   L    T+ VR I A  +K ++ 
Sbjct: 119 GAKQLADLKSRPQLLSEMAGALKGTMSKAAYLFNAL---PTKAVRTIDALREKQEKA 172


>gi|294630864|ref|ZP_06709424.1| ribosomal protein L10 [Streptomyces sp. e14]
 gi|292834197|gb|EFF92546.1| ribosomal protein L10 [Streptomyces sp. e14]
          Length = 176

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 52/174 (29%), Positives = 90/174 (51%), Gaps = 3/174 (1%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M R  K+  ++EL+  F SS + V+  Y+G++VAQ+K LR+ + E      V KN L KI
Sbjct: 1   MARPDKAAAVAELTDKFRSSNAAVLTEYRGLTVAQLKTLRRSLGE-NAQYAVVKNTLTKI 59

Query: 61  AIRDTSIRGISDLFVGQSLIVY-SDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
           A  +  I     LF G + + + +  PV + K    F+ DN    + GGV++   L+ D 
Sbjct: 60  AANEAGITLDDQLFAGPTAVAFVTGDPVESAKGLRDFAKDNPNLVIKGGVLDGKALSADE 119

Query: 120 IKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAF-VDKNQQG 172
           IK++A L   E + + +  A +   ++   L     +++VR + A    +++QG
Sbjct: 120 IKKLADLESREVLLSKLAGAFKGKQSQAASLFQALPSKLVRTVDALRAKRDEQG 173


>gi|149376695|ref|ZP_01894454.1| Ribosomal protein L10 [Marinobacter algicola DG893]
 gi|149359068|gb|EDM47533.1| Ribosomal protein L10 [Marinobacter algicola DG893]
          Length = 176

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 49/170 (28%), Positives = 86/170 (50%), Gaps = 1/170 (0%)

Query: 4   QGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIR 63
           + K   ++E+++    + S+V+A Y+GI+   +  LR K R     +KV +N L KIAIR
Sbjct: 6   EDKKAIVAEVNETAGGALSVVLADYRGITSGDMTALRAKARAESVHLKVVRNNLAKIAIR 65

Query: 64  DTSIRGISDLFVGQSLIVYS-DSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQ 122
            T    I    VG +++ +S + P  A ++   F+ +   F + G  V   ++  D I +
Sbjct: 66  GTEFECIDAALVGPTILAFSMEDPGAAARLLKDFAKEKEAFEIKGLAVGGELMGADQIDR 125

Query: 123 IASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQQG 172
           +A LP        + +  Q+  T+L R L    T+V RA++A  D+ Q+ 
Sbjct: 126 LAKLPTRHEALTMLAAVTQAPITKLARTLNEVPTKVTRAVAAVRDQKQEA 175


>gi|312963376|ref|ZP_07777859.1| 50S ribosomal protein L10 [Pseudomonas fluorescens WH6]
 gi|311282456|gb|EFQ61054.1| 50S ribosomal protein L10 [Pseudomonas fluorescens WH6]
          Length = 166

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 48/158 (30%), Positives = 86/158 (54%), Gaps = 1/158 (0%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           +N + K   ++E+++   ++ S VVA  +G++V  +  LRK+ REAG  V+V +N L+K 
Sbjct: 3   INLEDKKAIVAEVNEAAKAALSAVVADARGVTVGAMTGLRKEAREAGVYVRVVRNTLLKR 62

Query: 61  AIRDTSIRGISDLFVGQSLIVYS-DSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
           A+ DT    ++D+F G +LI +S D P  A ++   F+   ++F +     E   L  + 
Sbjct: 63  AVADTEYSVLNDVFTGPTLIAFSKDHPGAAARLFKEFAKSQDKFEIKAAAFEGKFLAANQ 122

Query: 120 IKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQ 157
           I  +A+LP      + ++S IQ   ++L R L   + Q
Sbjct: 123 IDVLATLPTRNEAISQLMSVIQGATSKLARTLAAVREQ 160


>gi|319777488|ref|YP_004137139.1| 50S ribosomal protein l10 [Mycoplasma fermentans M64]
 gi|318038563|gb|ADV34762.1| 50S ribosomal protein L10 [Mycoplasma fermentans M64]
          Length = 169

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 48/162 (29%), Positives = 86/162 (53%), Gaps = 12/162 (7%)

Query: 10  ISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRG 69
           + E+     SS ++V+A Y+G+SVA++  LR++ ++ G  +KV KNRL KIA ++  I  
Sbjct: 17  VKEIQNKLESSQALVIAEYRGLSVAELTSLRQEAKKEGIDIKVYKNRLFKIAAKNHGIND 76

Query: 70  ISDLFVGQSLIVY-SDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASLPD 128
           +    VG ++  + +   +IA K+ V FS +N       G+ E  V++   ++++ASLP+
Sbjct: 77  LDQHLVGPNIFAFGTTDALIAAKVLVKFSKENKLLVPKAGIFEGKVIDAKGVQEVASLPN 136

Query: 129 LEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQ 170
            E              T L R L +P  Q+  ++  F +K +
Sbjct: 137 YE-----------EALTILARSLMSPLQQLSLSLKMFSEKEE 167


>gi|308070987|ref|YP_003872592.1| 50S ribosomal protein L10 [Paenibacillus polymyxa E681]
 gi|305860266|gb|ADM72054.1| 50S ribosomal protein L10 [Paenibacillus polymyxa E681]
          Length = 167

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 52/169 (30%), Positives = 85/169 (50%), Gaps = 12/169 (7%)

Query: 4   QGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIR 63
           Q K   +  ++     S + VVA Y+G++VAQ+ +LRK++REAG   +V KN L++ A  
Sbjct: 8   QAKQEAVEVVAAKLRESVTTVVADYRGLNVAQVTELRKQLREAGIEFQVLKNTLLRRATA 67

Query: 64  DTSIRGISDLFVGQSLIVY-SDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQ 122
              +  +  +  G + I +  D  V A KI   F+  NN   + G VVE  V+  + IK 
Sbjct: 68  AAELTELDAVLTGPTAIAFGKDDAVSAAKILNDFAKKNNALELKGAVVEGRVIGVEEIKA 127

Query: 123 IASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQQ 171
           +A LP  EG+ + ++S +Q+           P      A+ A  +K +Q
Sbjct: 128 LAELPSREGLLSMLLSVLQA-----------PVRNFALAVKAVAEKEEQ 165


>gi|288905449|ref|YP_003430671.1| ribosomal protein L10 [Streptococcus gallolyticus UCN34]
 gi|306831530|ref|ZP_07464688.1| 50S ribosomal protein L10 [Streptococcus gallolyticus subsp.
           gallolyticus TX20005]
 gi|325978439|ref|YP_004288155.1| 50S ribosomal protein L10 [Streptococcus gallolyticus subsp.
           gallolyticus ATCC BAA-2069]
 gi|288732175|emb|CBI13740.1| ribosomal protein L10 [Streptococcus gallolyticus UCN34]
 gi|304426315|gb|EFM29429.1| 50S ribosomal protein L10 [Streptococcus gallolyticus subsp.
           gallolyticus TX20005]
 gi|325178367|emb|CBZ48411.1| 50S ribosomal protein L10 [Streptococcus gallolyticus subsp.
           gallolyticus ATCC BAA-2069]
          Length = 167

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 45/138 (32%), Positives = 80/138 (57%), Gaps = 1/138 (0%)

Query: 6   KSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDT 65
           K+ ++  +++   ++ SIVV   +G++V Q   LR+ +RE G   KV KN ++  A    
Sbjct: 9   KAEQVDAVAEKMKAAASIVVVDSRGLTVEQDTVLRRTLRENGVEFKVIKNSILTRAAEKA 68

Query: 66  SIRGISDLFVGQSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIA 124
            +  + DLFVG S + +S+  VIAP K+   F+ D     + GG +E  V +++ I  +A
Sbjct: 69  GLDEMKDLFVGPSAVAFSNEDVIAPAKVLSDFAKDAEALEIKGGAIEGAVSSKEEIAALA 128

Query: 125 SLPDLEGIRAGIISAIQS 142
           SLP+ EG+ + ++S +Q+
Sbjct: 129 SLPNREGLLSMLLSVLQA 146


>gi|269926926|ref|YP_003323549.1| ribosomal protein L10 [Thermobaculum terrenum ATCC BAA-798]
 gi|269790586|gb|ACZ42727.1| ribosomal protein L10 [Thermobaculum terrenum ATCC BAA-798]
          Length = 179

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 46/169 (27%), Positives = 86/169 (50%), Gaps = 1/169 (0%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M    K   ++EL ++ S S ++++A Y+G++VAQ+ +LR+KMREA     VAKN L +I
Sbjct: 1   MPNPQKEAAVAELQELLSKSSAVILADYRGLNVAQMNELRRKMREANAEFHVAKNTLTRI 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYS-DSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
           A +   I G+     G + I  S   P +  K+   F+       V  GV+E  V++ ++
Sbjct: 61  ASKAAGIEGLDPYLEGPTAIAVSFGDPTVVAKVINDFARSTRILSVKAGVLEHKVISAEA 120

Query: 120 IKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDK 168
           +  +A++   E +   ++  + +    LV +L      +   + A +D+
Sbjct: 121 VNDLANIEPREVLLGKVVGGLNAPIANLVGVLNAAVASIAYVLQARIDQ 169


>gi|149922219|ref|ZP_01910657.1| Ribosomal protein L10 [Plesiocystis pacifica SIR-1]
 gi|149816959|gb|EDM76444.1| Ribosomal protein L10 [Plesiocystis pacifica SIR-1]
          Length = 174

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 46/173 (26%), Positives = 93/173 (53%), Gaps = 1/173 (0%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M +  K  + + L +      ++VV  Y  ++VA+ ++LR + R+AG   +V KN +++ 
Sbjct: 1   MEKSIKYAQSAALREEVEDLTALVVVEYDRLTVAEAEELRGQFRDAGCTYRVYKNSVIRY 60

Query: 61  AIRDTSIRGISDLFVGQSLIVY-SDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
           AI  TS   +S    G S + Y +D P    +++  F+  N++ R+  GVVE  VL  ++
Sbjct: 61  AIAGTSHEPLSPFLKGVSGLAYNADDPGAPARVARDFAKKNDKLRLKAGVVEGEVLEGEA 120

Query: 120 IKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQQG 172
             ++A +P    I+A ++   ++ ATR+V+++       +R ++A   K+++ 
Sbjct: 121 CNKLADMPGPREIKAKLLMLFKTPATRMVQVMQAAPRDFLRVLNAKKKKDEEA 173


>gi|146309862|ref|YP_001174936.1| 50S ribosomal protein L10 [Enterobacter sp. 638]
 gi|260596084|ref|YP_003208655.1| 50S ribosomal protein L10 [Cronobacter turicensis z3032]
 gi|166981506|sp|A4W5A5|RL10_ENT38 RecName: Full=50S ribosomal protein L10
 gi|145316738|gb|ABP58885.1| LSU ribosomal protein L10P [Enterobacter sp. 638]
 gi|260215261|emb|CBA27167.1| 50S ribosomal protein L10 [Cronobacter turicensis z3032]
          Length = 165

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 48/154 (31%), Positives = 87/154 (56%), Gaps = 2/154 (1%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           +N Q K   ++E+S++   + S VVA  +G++V ++ +LRK  REAG  ++V +N L++ 
Sbjct: 3   LNLQDKQAIVAEVSEVAKGALSAVVADSRGVTVDKMTELRKAGREAGVYMRVVRNTLLRR 62

Query: 61  AIRDTSIRGISDLFVGQSLIVYS-DSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
            +  T    + D FVG +LI YS + P  A ++   F+  N +F V     E  ++    
Sbjct: 63  VVEGTQFECLKDAFVGPTLIAYSMEHPGAAARLFKDFAKANAKFEVKAAAFEGELIPASQ 122

Query: 120 IKQIASLPDLEGIRAGIISAI-QSNATRLVRLLG 152
           I ++A+LP  E   A +++ + +++A +LVR L 
Sbjct: 123 IDRLATLPTYEEAIARLMATMKEASAGKLVRTLA 156


>gi|223035|prf||0409278A ribosomal protein L10
          Length = 165

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 48/155 (30%), Positives = 87/155 (56%), Gaps = 3/155 (1%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           +N Q K   ++E+S++   + S VVA  +G++V ++ +LRK  REAG  ++V +N L++ 
Sbjct: 2   LNLQDKQAIVAEVSEVAKGALSAVVADSRGVTVDKMTELRKAGREAGVYMRVVRNTLLRR 61

Query: 61  AIRDTSIRGISDLFVGQSLIVYS--DSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQD 118
           A+  T    + D FVG +LI Y   + P  A ++   F+  N +F V     E  ++   
Sbjct: 62  AVEGTPFECLKDAFVGPTLIAYRSMEHPGAAARLFKEFAKANAKFEVKAAAFEGELIPAS 121

Query: 119 SIKQIASLPDLEGIRAGIISAI-QSNATRLVRLLG 152
            I ++A+LP  E   A +++ + +++A +LVR L 
Sbjct: 122 QIDRLATLPTYEEAIARLMATMKEASAGKLVRTLA 156


>gi|322513226|ref|ZP_08066352.1| 50S ribosomal protein L10 [Actinobacillus ureae ATCC 25976]
 gi|322121002|gb|EFX92843.1| 50S ribosomal protein L10 [Actinobacillus ureae ATCC 25976]
          Length = 170

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 50/160 (31%), Positives = 90/160 (56%), Gaps = 5/160 (3%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           +N Q K   ++E+++    + S VVA  +G++V ++ +LRK  REAG  ++V +N L++ 
Sbjct: 10  LNLQDKQAIVAEVNEAAKGALSAVVADSRGVTVEKMTELRKAAREAGVTMQVVRNTLLRR 69

Query: 61  AIRDTSIRGISDLFVGQSLIVYS-DSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
           A+  T    ++D F G +LI +S + P  A ++   F+  N EF + G   E  V  QD 
Sbjct: 70  AVEGTEFECLTDTFTGPTLIAFSNEHPGAAARLFTEFAKTNKEFELKGAAFEGKV--QD- 126

Query: 120 IKQIASLPDLEGIRAGIISAI-QSNATRLVRLLGTPQTQV 158
           ++ +A+LP  E   A ++  + ++ A +LVR L   + Q+
Sbjct: 127 VEFLATLPTYEEAIARLMGTMKEAAAGKLVRTLAALRDQM 166


>gi|56477585|ref|YP_159174.1| 50S ribosomal protein L10 [Aromatoleum aromaticum EbN1]
 gi|81598747|sp|Q5P341|RL10_AZOSE RecName: Full=50S ribosomal protein L10
 gi|56313628|emb|CAI08273.1| 50S ribosomal protein L10 [Aromatoleum aromaticum EbN1]
          Length = 166

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 46/145 (31%), Positives = 81/145 (55%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           +N   K   ++E+S   +++ +I VA Y+GI+V  +  LR K RE+G  ++V KN LV+ 
Sbjct: 3   LNLDDKKAVVAEVSAQVANAQTIAVAEYRGIAVGDLTGLRAKARESGVYLRVLKNTLVRR 62

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           AI +T   G+SD  VG  +   S+ PV A K+   F+  N++  +  G      L++  +
Sbjct: 63  AIAETPFAGLSDQLVGPLIYGISEDPVAAAKVLNDFAKGNDKLVLKAGSYAGNTLDKAGV 122

Query: 121 KQIASLPDLEGIRAGIISAIQSNAT 145
           + +AS+P  E + A ++  +Q+  T
Sbjct: 123 QALASIPSREELLARLLGVMQAPVT 147


>gi|320546902|ref|ZP_08041204.1| 50S ribosomal protein L10 [Streptococcus equinus ATCC 9812]
 gi|320448420|gb|EFW89161.1| 50S ribosomal protein L10 [Streptococcus equinus ATCC 9812]
          Length = 167

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 45/138 (32%), Positives = 80/138 (57%), Gaps = 1/138 (0%)

Query: 6   KSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDT 65
           K+ ++  +++   ++ SIVV   +G++V Q   LR+ +RE G   KV KN ++  A    
Sbjct: 9   KAEQVDAVAEKMKAAASIVVVDSRGLTVEQDTVLRRNLRENGIEFKVIKNSILTRAAEKA 68

Query: 66  SIRGISDLFVGQSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIA 124
            + G+ DLFVG S + +S+  V+AP K+   F+ D     + GG +E  V +++ I  +A
Sbjct: 69  GLDGMKDLFVGPSAVAFSNEDVVAPAKVINDFAKDAEALEIKGGAIEGAVSSKEEIVALA 128

Query: 125 SLPDLEGIRAGIISAIQS 142
           SLP  EG+ + ++S +Q+
Sbjct: 129 SLPSREGLLSMLLSVLQA 146


>gi|156744231|ref|YP_001434360.1| 50S ribosomal protein L10 [Roseiflexus castenholzii DSM 13941]
 gi|189040930|sp|A7NRZ6|RL10_ROSCS RecName: Full=50S ribosomal protein L10
 gi|156235559|gb|ABU60342.1| ribosomal protein L10 [Roseiflexus castenholzii DSM 13941]
          Length = 187

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 51/166 (30%), Positives = 85/166 (51%), Gaps = 3/166 (1%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M  Q K   +++L +        VVA Y+G+SVA + DLRKK+RE+G    VAKN L +I
Sbjct: 1   MPTQRKIETVADLKQRLERMQVAVVADYRGLSVADMTDLRKKLRESGAEFVVAKNTLTRI 60

Query: 61  AIRDTSIRGISDLFVGQSLI--VYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQD 118
           A R+T    I  L  G + +   Y D P     I+  F+    +  V GG++   +L ++
Sbjct: 61  AARETGHEAIEPLLEGPTALAFAYDDVPKFVRAIN-EFNRGPKKITVRGGLLGTTLLKEN 119

Query: 119 SIKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISA 164
            +  +A+LP  + +RA ++  + +  T L  ++  P   +V  + A
Sbjct: 120 VLDVVATLPTKDEVRAQVLGGLAAPVTGLAGIIAAPVNDIVNLLDA 165


>gi|78042885|ref|YP_361130.1| 50S ribosomal protein L10 [Carboxydothermus hydrogenoformans
           Z-2901]
 gi|97181562|sp|Q3A9Q4|RL10_CARHZ RecName: Full=50S ribosomal protein L10
 gi|77995000|gb|ABB13899.1| ribosomal protein L10 [Carboxydothermus hydrogenoformans Z-2901]
          Length = 176

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 41/134 (30%), Positives = 76/134 (56%), Gaps = 1/134 (0%)

Query: 10  ISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRG 69
           ++E+ ++  SS + ++  Y+G++VA++ +LR+K++E G  +KV KN L K A  +  I G
Sbjct: 12  VAEIEEMIKSSQAAILVDYRGLTVAEMTELRRKLKEKGAEIKVVKNTLAKRAAHNLGITG 71

Query: 70  ISDLFVGQS-LIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASLPD 128
           +     G + L V  + P  A K+   F+ D+    +  G++E  VL +D +K IA LP 
Sbjct: 72  LDPYLEGPTALAVAKEDPASAAKVLFDFAKDHPNLEIKVGILENIVLEKDQVKAIADLPP 131

Query: 129 LEGIRAGIISAIQS 142
              + A ++  +Q+
Sbjct: 132 RNVLLAKLLGGMQA 145


>gi|89075379|ref|ZP_01161801.1| 50S ribosomal protein L10 [Photobacterium sp. SKA34]
 gi|89048928|gb|EAR54497.1| 50S ribosomal protein L10 [Photobacterium sp. SKA34]
          Length = 164

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 51/159 (32%), Positives = 88/159 (55%), Gaps = 5/159 (3%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           +N Q K   ++E+++  + + S VVA  +G++V  +  LRK+ REAG  VKV +N L + 
Sbjct: 3   LNLQDKKAIVAEVNEAANGALSAVVADSRGVTVGAMTTLRKQAREAGVYVKVVRNTLARR 62

Query: 61  AIRDTSIRGISDLFVGQSLIVYS-DSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
           A+  T    + D+FVG SLI +S + P  A ++   F+ +N EF +     E  V N   
Sbjct: 63  AVEGTDFECLKDVFVGPSLIGFSNEHPGAAARLFKDFAKENKEFEIKAAAFEGAVAN--- 119

Query: 120 IKQIASLPDL-EGIRAGIISAIQSNATRLVRLLGTPQTQ 157
           ++ +A+LP   E I   ++   +++A +LVR +   + Q
Sbjct: 120 VEVLATLPTYDEAIARLMMCMKEASAGKLVRTIAAVRDQ 158


>gi|238809569|dbj|BAH69359.1| hypothetical protein [Mycoplasma fermentans PG18]
          Length = 196

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 48/162 (29%), Positives = 86/162 (53%), Gaps = 12/162 (7%)

Query: 10  ISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRG 69
           + E+     SS ++V+A Y+G+SVA++  LR++ ++ G  +KV KNRL KIA ++  I  
Sbjct: 44  VKEIQNKLESSQALVIAEYRGLSVAELTSLRQEAKKEGIDIKVYKNRLFKIAAKNHGIND 103

Query: 70  ISDLFVGQSLIVY-SDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASLPD 128
           +    VG ++  + +   +IA K+ V FS +N       G+ E  V++   ++++ASLP+
Sbjct: 104 LDQHLVGPNIFAFGTTDALIAAKVLVKFSKENKLLVPKAGIFEGKVIDAKGVQEVASLPN 163

Query: 129 LEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQ 170
            E              T L R L +P  Q+  ++  F +K +
Sbjct: 164 YE-----------EALTILARSLMSPLQQLSLSLKMFSEKEE 194


>gi|269793108|ref|YP_003318012.1| 50S ribosomal protein L10 [Thermanaerovibrio acidaminovorans DSM
           6589]
 gi|269100743|gb|ACZ19730.1| ribosomal protein L10 [Thermanaerovibrio acidaminovorans DSM 6589]
          Length = 176

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 49/173 (28%), Positives = 91/173 (52%), Gaps = 3/173 (1%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M  + K   + +L ++   S  + +  Y+G++V ++ D+R ++R+AGG +KVAKN L+++
Sbjct: 1   MPTKAKEQSVEQLVEMLGRSDGVFICEYRGLTVKKMTDIRSRVRKAGGEMKVAKNTLMRL 60

Query: 61  AIRDTSIRGISDLFVGQSLIV--YSDSPVIAPKISVSFSNDNNEFRVL-GGVVEKGVLNQ 117
           A++   +  +     G ++ V  Y D   +A  +        NE  ++ GGV+ K +LN+
Sbjct: 61  ALQRVGMPTVDPYEQGPNVYVFAYGDVAAVAKALRDYSKEKGNEALIIKGGVMGKDLLNK 120

Query: 118 DSIKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQ 170
           D +  IA LP  E + A ++  I +    LV +L  P   +V  +S   DK +
Sbjct: 121 DQVMAIADLPSKEVLIAQVVGTIAAPLRGLVTVLSGPARGLVTCLSQIKDKKE 173


>gi|330432331|gb|AEC17390.1| 50S ribosomal protein L10 [Gallibacterium anatis UMN179]
          Length = 165

 Score = 79.3 bits (194), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 46/159 (28%), Positives = 90/159 (56%), Gaps = 2/159 (1%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           +N Q K   ++E+S++   + S VVA  +G++V ++ +LRK  REAG  ++V +N L++ 
Sbjct: 3   LNLQDKQAVVAEVSEVAKGALSAVVADSRGVTVDKMTELRKSAREAGVYMRVVRNTLLRR 62

Query: 61  AIRDTSIRGISDLFVGQSLIVYS-DSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
           A+  ++   + D F G +LI +S + P  A ++   F+  N++F + G   E   +   +
Sbjct: 63  AVEGSAFECMKDTFKGPTLIAFSNEHPGAAARLFKEFAKANDKFEIKGAAFEGEFIEAKA 122

Query: 120 IKQIASLPDLEGIRAGIISAI-QSNATRLVRLLGTPQTQ 157
           I ++A+LP  E   A ++  + ++ A +LVR +   + Q
Sbjct: 123 IDRLATLPTYEEAIARLMGTMKEAAAGKLVRTIAAIRDQ 161


>gi|73663525|ref|YP_302306.1| 50S ribosomal protein L10 [Staphylococcus saprophyticus subsp.
           saprophyticus ATCC 15305]
 gi|82581571|sp|Q49V49|RL10_STAS1 RecName: Full=50S ribosomal protein L10
 gi|72496040|dbj|BAE19361.1| 50S ribosomal protein L10 [Staphylococcus saprophyticus subsp.
           saprophyticus ATCC 15305]
          Length = 169

 Score = 79.3 bits (194), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 41/139 (29%), Positives = 81/139 (58%), Gaps = 1/139 (0%)

Query: 5   GKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRD 64
            K  E+  +++   +S S V+  Y+G+SVA++ +LR ++REAG   KV KN +V+ A + 
Sbjct: 7   AKKQEVDIIAEQLKNSVSTVIVDYRGLSVAEVTELRSQLREAGVEYKVLKNTMVRRAAQQ 66

Query: 65  TSIRGISDLFVGQSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQI 123
             I G+ +  VG + +  S   V+AP K+   F+ ++    +  GV+E  V++ + +  +
Sbjct: 67  AGIDGLDEFLVGPTAVATSTEDVVAPAKVIAGFAKEHQALEIKTGVMEGNVISAEEVNTV 126

Query: 124 ASLPDLEGIRAGIISAIQS 142
            +LP  +G+ + ++S +Q+
Sbjct: 127 GTLPSHDGLVSMLLSVLQA 145


>gi|308190182|ref|YP_003923113.1| 50s ribosomal protein L10 [Mycoplasma fermentans JER]
 gi|307624924|gb|ADN69229.1| 50s ribosomal protein L10 [Mycoplasma fermentans JER]
          Length = 169

 Score = 79.3 bits (194), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 48/162 (29%), Positives = 86/162 (53%), Gaps = 12/162 (7%)

Query: 10  ISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRG 69
           + E+     SS ++V+A Y+G+SVA++  LR++ ++ G  +KV KNRL KIA ++  I  
Sbjct: 17  VKEIQNKLESSQALVIAEYRGLSVAELTSLRQEAKKEGIDIKVYKNRLFKIAAKNHGIND 76

Query: 70  ISDLFVGQSLIVY-SDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASLPD 128
           +    VG ++  + +   +IA K+ V FS +N       G+ E  V++   ++++ASLP+
Sbjct: 77  LDQHLVGPNIFAFGTADALIAAKVLVKFSKENKLLVPKAGIFEGKVIDAKGVQEVASLPN 136

Query: 129 LEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQ 170
            E              T L R L +P  Q+  ++  F +K +
Sbjct: 137 YE-----------EALTILARSLMSPLQQLSLSLKMFSEKEE 167


>gi|295095129|emb|CBK84219.1| LSU ribosomal protein L10P [Enterobacter cloacae subsp. cloacae
           NCTC 9394]
          Length = 165

 Score = 79.3 bits (194), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 48/154 (31%), Positives = 85/154 (55%), Gaps = 2/154 (1%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           +N Q K   ++E+S++   + S VVA  +G++V ++ +LRK  REAG  ++V +N L++ 
Sbjct: 3   LNLQDKQAIVAEVSEVAKGALSAVVADSRGVTVDKMTELRKAGREAGVYMRVVRNTLLRR 62

Query: 61  AIRDTSIRGISDLFVGQSLIVYS-DSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
            +  T    + D FVG +LI YS + P  A ++   F+  N +F V     E  ++    
Sbjct: 63  VVEGTQFECLKDTFVGPTLIAYSMEHPGAAARLFKEFAKANAKFEVKAAAFEGELIPASQ 122

Query: 120 IKQIASLPDLEGIRAGIISAIQSNAT-RLVRLLG 152
           I ++A+LP  E   A +++ ++  A  +LVR L 
Sbjct: 123 IDRLATLPTYEEAIARLMATMKEAAAGKLVRTLA 156


>gi|313888200|ref|ZP_07821874.1| ribosomal protein L10 [Peptoniphilus harei ACS-146-V-Sch2b]
 gi|312845890|gb|EFR33277.1| ribosomal protein L10 [Peptoniphilus harei ACS-146-V-Sch2b]
          Length = 178

 Score = 79.3 bits (194), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 47/168 (27%), Positives = 82/168 (48%), Gaps = 1/168 (0%)

Query: 4   QGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIR 63
           Q K   + E+ +    + SIV+ +Y+G++V ++ +LR K REA    KV KN +++ A  
Sbjct: 7   QSKQALVDEIKEKIQGAQSIVLVNYRGLTVEEVTELRTKYREANVDYKVYKNTMMRRAFE 66

Query: 64  DTSIRGISDLFVGQSLIVYS-DSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQ 122
           +  + G+ D   G S I +  + P  A KIS  F+ D+    +  G V+  VL+   I  
Sbjct: 67  ELGVEGLEDFLKGPSAIAFGMEDPASAAKISSEFAEDHEALEIKAGYVDGKVLSLPEIDA 126

Query: 123 IASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQ 170
           +A LP  E + A ++  + +       +L    +   R I+   DK +
Sbjct: 127 LAKLPSKEVLVAQVLGGLNAPIQGFANVLNGTLSGFARVIAQIADKKE 174


>gi|171914823|ref|ZP_02930293.1| ribosomal protein L10 [Verrucomicrobium spinosum DSM 4136]
          Length = 173

 Score = 79.3 bits (194), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 53/167 (31%), Positives = 91/167 (54%), Gaps = 2/167 (1%)

Query: 6   KSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAI-RD 64
           K++ I  L +  ++S  + V  Y G+ V + ++LRK++R AG  + V KN LVK A  R 
Sbjct: 5   KTILIEHLLEKVNASPFMFVVDYTGLKVDKFEELRKRLRAAGAEMHVYKNTLVKKAAERA 64

Query: 65  TSIRGISDLFVGQSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQI 123
                I D+  GQS +V  +  V A  K+  +F+ +  + +V  GV++   L+   I+ +
Sbjct: 65  GYPVEIGDVLTGQSAVVTGEKDVCAAAKVMKTFATEFQKPQVKAGVLDGKYLDASGIQVL 124

Query: 124 ASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQ 170
           A LP  E + A ++  +Q+ A++LVRLL  P   + R + A  ++ Q
Sbjct: 125 ADLPSREVLLATLLGVLQAPASKLVRLLNEPAASLARVLKAKGEQEQ 171


>gi|15607791|ref|NP_215165.1| 50S ribosomal protein L10 [Mycobacterium tuberculosis H37Rv]
 gi|15840054|ref|NP_335091.1| 50S ribosomal protein L10 [Mycobacterium tuberculosis CDC1551]
 gi|31791835|ref|NP_854328.1| 50S ribosomal protein L10 [Mycobacterium bovis AF2122/97]
 gi|121636572|ref|YP_976795.1| 50S ribosomal protein L10 [Mycobacterium bovis BCG str. Pasteur
           1173P2]
 gi|148660425|ref|YP_001281948.1| 50S ribosomal protein L10 [Mycobacterium tuberculosis H37Ra]
 gi|148821855|ref|YP_001286609.1| 50S ribosomal protein L10 [Mycobacterium tuberculosis F11]
 gi|215402433|ref|ZP_03414614.1| 50S ribosomal protein L10 [Mycobacterium tuberculosis 02_1987]
 gi|215410200|ref|ZP_03419008.1| 50S ribosomal protein L10 [Mycobacterium tuberculosis 94_M4241A]
 gi|215425888|ref|ZP_03423807.1| 50S ribosomal protein L10 [Mycobacterium tuberculosis T92]
 gi|215429489|ref|ZP_03427408.1| 50S ribosomal protein L10 [Mycobacterium tuberculosis EAS054]
 gi|215444772|ref|ZP_03431524.1| 50S ribosomal protein L10 [Mycobacterium tuberculosis T85]
 gi|218752302|ref|ZP_03531098.1| 50S ribosomal protein L10 [Mycobacterium tuberculosis GM 1503]
 gi|224989044|ref|YP_002643731.1| 50S ribosomal protein L10 [Mycobacterium bovis BCG str. Tokyo 172]
 gi|253797591|ref|YP_003030592.1| 50S ribosomal protein L10 rplJ [Mycobacterium tuberculosis KZN
           1435]
 gi|254230980|ref|ZP_04924307.1| 50S ribosomal protein L10 rplJ [Mycobacterium tuberculosis C]
 gi|254363602|ref|ZP_04979648.1| 50S ribosomal protein L10 rplJ [Mycobacterium tuberculosis str.
           Haarlem]
 gi|254549611|ref|ZP_05140058.1| 50S ribosomal protein L10 [Mycobacterium tuberculosis '98-R604
           INH-RIF-EM']
 gi|260185533|ref|ZP_05763007.1| 50S ribosomal protein L10 [Mycobacterium tuberculosis CPHL_A]
 gi|260199658|ref|ZP_05767149.1| 50S ribosomal protein L10 [Mycobacterium tuberculosis T46]
 gi|260203821|ref|ZP_05771312.1| 50S ribosomal protein L10 [Mycobacterium tuberculosis K85]
 gi|289442046|ref|ZP_06431790.1| 50S ribosomal protein L10 rplJ [Mycobacterium tuberculosis T46]
 gi|289446208|ref|ZP_06435952.1| 50S ribosomal protein L10 rplJ [Mycobacterium tuberculosis CPHL_A]
 gi|289552905|ref|ZP_06442115.1| 50S ribosomal protein L10 rplJ [Mycobacterium tuberculosis KZN 605]
 gi|289573255|ref|ZP_06453482.1| 50S ribosomal protein L10 rplJ [Mycobacterium tuberculosis K85]
 gi|289744373|ref|ZP_06503751.1| ribosomal protein L10 [Mycobacterium tuberculosis 02_1987]
 gi|289749154|ref|ZP_06508532.1| 50S ribosomal protein L10 rplJ [Mycobacterium tuberculosis T92]
 gi|289752697|ref|ZP_06512075.1| 50S ribosomal protein L10 [Mycobacterium tuberculosis EAS054]
 gi|289756736|ref|ZP_06516114.1| 50S ribosomal protein L10 [Mycobacterium tuberculosis T85]
 gi|289760775|ref|ZP_06520153.1| 50S ribosomal protein L10 rplJ [Mycobacterium tuberculosis GM 1503]
 gi|294996170|ref|ZP_06801861.1| 50S ribosomal protein L10 [Mycobacterium tuberculosis 210]
 gi|297633149|ref|ZP_06950929.1| 50S ribosomal protein L10 [Mycobacterium tuberculosis KZN 4207]
 gi|297730129|ref|ZP_06959247.1| 50S ribosomal protein L10 [Mycobacterium tuberculosis KZN R506]
 gi|298524142|ref|ZP_07011551.1| 50S ribosomal protein L10 [Mycobacterium tuberculosis 94_M4241A]
 gi|306774761|ref|ZP_07413098.1| 50S ribosomal protein L10 rplJ [Mycobacterium tuberculosis SUMu001]
 gi|306781506|ref|ZP_07419843.1| 50S ribosomal protein L10 rplJ [Mycobacterium tuberculosis SUMu002]
 gi|306783301|ref|ZP_07421623.1| 50S ribosomal protein L10 rplJ [Mycobacterium tuberculosis SUMu003]
 gi|306787670|ref|ZP_07425992.1| 50S ribosomal protein L10 rplJ [Mycobacterium tuberculosis SUMu004]
 gi|306794436|ref|ZP_07432738.1| 50S ribosomal protein L10 rplJ [Mycobacterium tuberculosis SUMu005]
 gi|306796404|ref|ZP_07434706.1| 50S ribosomal protein L10 rplJ [Mycobacterium tuberculosis SUMu006]
 gi|306802263|ref|ZP_07438931.1| 50S ribosomal protein L10 rplJ [Mycobacterium tuberculosis SUMu008]
 gi|306806473|ref|ZP_07443141.1| 50S ribosomal protein L10 rplJ [Mycobacterium tuberculosis SUMu007]
 gi|306966672|ref|ZP_07479333.1| 50S ribosomal protein L10 rplJ [Mycobacterium tuberculosis SUMu009]
 gi|306970864|ref|ZP_07483525.1| 50S ribosomal protein L10 rplJ [Mycobacterium tuberculosis SUMu010]
 gi|307078592|ref|ZP_07487762.1| 50S ribosomal protein L10 rplJ [Mycobacterium tuberculosis SUMu011]
 gi|307083155|ref|ZP_07492268.1| 50S ribosomal protein L10 rplJ [Mycobacterium tuberculosis SUMu012]
 gi|313657456|ref|ZP_07814336.1| 50S ribosomal protein L10 [Mycobacterium tuberculosis KZN V2475]
 gi|54039081|sp|P66045|RL10_MYCBO RecName: Full=50S ribosomal protein L10
 gi|54041811|sp|P66044|RL10_MYCTU RecName: Full=50S ribosomal protein L10
 gi|166230033|sp|A1KGD1|RL10_MYCBP RecName: Full=50S ribosomal protein L10
 gi|166230037|sp|A5U036|RL10_MYCTA RecName: Full=50S ribosomal protein L10
 gi|254798391|sp|C1AKY4|RL10_MYCBT RecName: Full=50S ribosomal protein L10
 gi|1877389|emb|CAB07108.1| PROBABLE 50S RIBOSOMAL PROTEIN L10 RPLJ [Mycobacterium tuberculosis
           H37Rv]
 gi|13880201|gb|AAK44905.1| ribosomal protein L10 [Mycobacterium tuberculosis CDC1551]
 gi|31617422|emb|CAD93532.1| PROBABLE 50S RIBOSOMAL PROTEIN L10 RPLJ [Mycobacterium bovis
           AF2122/97]
 gi|121492219|emb|CAL70686.1| Probable 50S ribosomal protein L10 rplJ [Mycobacterium bovis BCG
           str. Pasteur 1173P2]
 gi|124600039|gb|EAY59049.1| 50S ribosomal protein L10 rplJ [Mycobacterium tuberculosis C]
 gi|134149116|gb|EBA41161.1| 50S ribosomal protein L10 rplJ [Mycobacterium tuberculosis str.
           Haarlem]
 gi|148504577|gb|ABQ72386.1| 50S ribosomal protein L10 [Mycobacterium tuberculosis H37Ra]
 gi|148720382|gb|ABR05007.1| 50S ribosomal protein L10 rplJ [Mycobacterium tuberculosis F11]
 gi|224772157|dbj|BAH24963.1| 50S ribosomal protein L10 [Mycobacterium bovis BCG str. Tokyo 172]
 gi|253319094|gb|ACT23697.1| 50S ribosomal protein L10 rplJ [Mycobacterium tuberculosis KZN
           1435]
 gi|289414965|gb|EFD12205.1| 50S ribosomal protein L10 rplJ [Mycobacterium tuberculosis T46]
 gi|289419166|gb|EFD16367.1| 50S ribosomal protein L10 rplJ [Mycobacterium tuberculosis CPHL_A]
 gi|289437537|gb|EFD20030.1| 50S ribosomal protein L10 rplJ [Mycobacterium tuberculosis KZN 605]
 gi|289537686|gb|EFD42264.1| 50S ribosomal protein L10 rplJ [Mycobacterium tuberculosis K85]
 gi|289684901|gb|EFD52389.1| ribosomal protein L10 [Mycobacterium tuberculosis 02_1987]
 gi|289689741|gb|EFD57170.1| 50S ribosomal protein L10 rplJ [Mycobacterium tuberculosis T92]
 gi|289693284|gb|EFD60713.1| 50S ribosomal protein L10 [Mycobacterium tuberculosis EAS054]
 gi|289708281|gb|EFD72297.1| 50S ribosomal protein L10 rplJ [Mycobacterium tuberculosis GM 1503]
 gi|289712300|gb|EFD76312.1| 50S ribosomal protein L10 [Mycobacterium tuberculosis T85]
 gi|298493936|gb|EFI29230.1| 50S ribosomal protein L10 [Mycobacterium tuberculosis 94_M4241A]
 gi|308216654|gb|EFO76053.1| 50S ribosomal protein L10 rplJ [Mycobacterium tuberculosis SUMu001]
 gi|308325802|gb|EFP14653.1| 50S ribosomal protein L10 rplJ [Mycobacterium tuberculosis SUMu002]
 gi|308331798|gb|EFP20649.1| 50S ribosomal protein L10 rplJ [Mycobacterium tuberculosis SUMu003]
 gi|308335581|gb|EFP24432.1| 50S ribosomal protein L10 rplJ [Mycobacterium tuberculosis SUMu004]
 gi|308337201|gb|EFP26052.1| 50S ribosomal protein L10 rplJ [Mycobacterium tuberculosis SUMu005]
 gi|308343067|gb|EFP31918.1| 50S ribosomal protein L10 rplJ [Mycobacterium tuberculosis SUMu006]
 gi|308346950|gb|EFP35801.1| 50S ribosomal protein L10 rplJ [Mycobacterium tuberculosis SUMu007]
 gi|308350928|gb|EFP39779.1| 50S ribosomal protein L10 rplJ [Mycobacterium tuberculosis SUMu008]
 gi|308355524|gb|EFP44375.1| 50S ribosomal protein L10 rplJ [Mycobacterium tuberculosis SUMu009]
 gi|308359485|gb|EFP48336.1| 50S ribosomal protein L10 rplJ [Mycobacterium tuberculosis SUMu010]
 gi|308363389|gb|EFP52240.1| 50S ribosomal protein L10 rplJ [Mycobacterium tuberculosis SUMu011]
 gi|308367116|gb|EFP55967.1| 50S ribosomal protein L10 rplJ [Mycobacterium tuberculosis SUMu012]
 gi|323720874|gb|EGB29940.1| 50S ribosomal protein L10 rplJ [Mycobacterium tuberculosis
           CDC1551A]
 gi|326905129|gb|EGE52062.1| 50S ribosomal protein L10 rplJ [Mycobacterium tuberculosis W-148]
 gi|328457372|gb|AEB02795.1| 50S ribosomal protein L10 rplJ [Mycobacterium tuberculosis KZN
           4207]
          Length = 178

 Score = 79.3 bits (194), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 46/169 (27%), Positives = 88/169 (52%), Gaps = 2/169 (1%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M R  K+  +++++  F  S + ++  Y+G++VA + +LR+ +        VAKN L+K 
Sbjct: 1   MARADKATAVADIAAQFKESTATLITEYRGLTVANLAELRRSLT-GSATYAVAKNTLIKR 59

Query: 61  AIRDTSIRGISDLFVGQSLIVY-SDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
           A  +  I G+ +LFVG + I + +  PV A K   +F+ ++    + GG ++   L    
Sbjct: 60  AASEAGIEGLDELFVGPTAIAFVTGEPVDAAKAIKTFAKEHKALVIKGGYMDGHPLTVAE 119

Query: 120 IKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDK 168
           +++IA L   E + A +  A++ N  +   L   P +Q+ R  +A  +K
Sbjct: 120 VERIADLESREVLLAKLAGAMKGNLAKAAGLFNAPASQLARLAAALQEK 168


>gi|322418355|ref|YP_004197578.1| 50S ribosomal protein L10 [Geobacter sp. M18]
 gi|320124742|gb|ADW12302.1| ribosomal protein L10 [Geobacter sp. M18]
          Length = 173

 Score = 79.3 bits (194), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 47/164 (28%), Positives = 88/164 (53%), Gaps = 2/164 (1%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           MN++ K   ++E+      + ++ +A ++G++V Q  +LR ++R+A    KV KN L++I
Sbjct: 1   MNKENKQELVAEMHDKLLRAKAVFLADFRGMNVGQATELRNELRKANAEYKVVKNTLLEI 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYS-DSPVIAPKISVSFSNDN-NEFRVLGGVVEKGVLNQD 118
           A + T   G++  + G + I    D PV A K+   F+ +N N F +  GV+    ++  
Sbjct: 61  ASKGTDKEGLNPYYAGPTAIALCYDDPVAAAKVLSRFNKENTNPFTLKAGVLTGKTIDVA 120

Query: 119 SIKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAI 162
            I+ +A LP  E + A ++ ++Q+ A   VR+L       VR +
Sbjct: 121 DIQALADLPSREVLLARMLGSMQAPAGNFVRVLAAVPGGFVRVL 164


>gi|238918141|ref|YP_002931655.1| 50S ribosomal protein L10 [Edwardsiella ictaluri 93-146]
 gi|269137532|ref|YP_003294232.1| 50S ribosomal protein L10 [Edwardsiella tarda EIB202]
 gi|294634223|ref|ZP_06712768.1| ribosomal protein L10 [Edwardsiella tarda ATCC 23685]
 gi|259645481|sp|C5BHE2|RL10_EDWI9 RecName: Full=50S ribosomal protein L10
 gi|238867709|gb|ACR67420.1| conserved hypothetical protein [Edwardsiella ictaluri 93-146]
 gi|267983192|gb|ACY83021.1| 50S ribosomal protein L10 [Edwardsiella tarda EIB202]
 gi|291092348|gb|EFE24909.1| ribosomal protein L10 [Edwardsiella tarda ATCC 23685]
 gi|304557605|gb|ADM40269.1| LSU ribosomal protein L10p (P0) [Edwardsiella tarda FL6-60]
          Length = 165

 Score = 79.3 bits (194), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 47/159 (29%), Positives = 89/159 (55%), Gaps = 2/159 (1%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           +N Q K   ++E++++   + S VVA  +G++V ++ +LRK  REAG  ++V +N L++ 
Sbjct: 3   LNLQDKQAIVAEVTEVAKGALSAVVADSRGVTVDKMTELRKAGREAGVYMRVVRNTLMRR 62

Query: 61  AIRDTSIRGISDLFVGQSLIVYS-DSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
            +  +    + D FVG +LI +S + P  A ++  +F+ DN +F V     E  ++    
Sbjct: 63  VVEGSQFECLKDTFVGPTLIAFSMEHPGAAARLFKAFAKDNAKFEVKAAAFEGELIPAAQ 122

Query: 120 IKQIASLPDLEGIRAGIISAIQSNAT-RLVRLLGTPQTQ 157
           I ++A+LP  E   A +++ ++  A  +LVR L   + Q
Sbjct: 123 IDRLATLPTYEEAIARLMATMKEAAAGKLVRTLAALRDQ 161


>gi|167758523|ref|ZP_02430650.1| hypothetical protein CLOSCI_00863 [Clostridium scindens ATCC 35704]
 gi|167663719|gb|EDS07849.1| hypothetical protein CLOSCI_00863 [Clostridium scindens ATCC 35704]
          Length = 193

 Score = 79.3 bits (194), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 43/133 (32%), Positives = 74/133 (55%), Gaps = 1/133 (0%)

Query: 20  SGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRGISDLFVGQSL 79
           + S+V+  Y+G++VAQ  +LRK++R+AG   KV KN ++K A   T +  + +   G S 
Sbjct: 21  AASVVLVDYRGLTVAQDTELRKQLRDAGIVYKVCKNTMMKRAFEGTELAALEEHLEGPSA 80

Query: 80  IVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASLPDLEGIRAGIIS 138
           I  S     AP +I   F+ D     +  GV+E  V + D + +++ +P  E + A ++ 
Sbjct: 81  IAISKDDATAPARILCKFAKDAKALELKAGVIEGAVYDVDGLTELSKIPSREELLAKLLG 140

Query: 139 AIQSNATRLVRLL 151
           ++QS  T L R+L
Sbjct: 141 SMQSPITNLARVL 153


>gi|317509035|ref|ZP_07966666.1| ribosomal protein L10 [Segniliparus rugosus ATCC BAA-974]
 gi|316252690|gb|EFV12129.1| ribosomal protein L10 [Segniliparus rugosus ATCC BAA-974]
          Length = 174

 Score = 79.3 bits (194), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 48/165 (29%), Positives = 89/165 (53%), Gaps = 4/165 (2%)

Query: 9   EISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKM-REAGGGVKVAKNRLVKIAIRDTSI 67
           ++++++K F  + + +V  Y+G++++ +  LR  + RE      VAKN LVK A  D  +
Sbjct: 9   KVADIAKRFEEANAAIVTEYRGLTMSSLTKLRTDLGRETT--YLVAKNTLVKRAAADAGV 66

Query: 68  RGISDLFVGQSLIVYSDSPVI-APKISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASL 126
            G+ +LFVG + + + +  ++ A K+   F+ +N    V GG ++  VLN+  + ++A L
Sbjct: 67  TGVDELFVGPTAVAFVNGDIVEAAKVIKGFAKENQALVVKGGYLDGAVLNEKEVIKLADL 126

Query: 127 PDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQQ 171
              E + A +  AI+      + LL  P +QV R   A  D+ Q+
Sbjct: 127 ESREVLLAKVAGAIKGALGSALGLLNAPLSQVARLSQALADQKQE 171


>gi|37521170|ref|NP_924547.1| 50S ribosomal protein L10 [Gloeobacter violaceus PCC 7421]
 gi|61215232|sp|Q7NK77|RL10_GLOVI RecName: Full=50S ribosomal protein L10
 gi|35212166|dbj|BAC89542.1| 50S ribosomal protein L10 [Gloeobacter violaceus PCC 7421]
          Length = 192

 Score = 79.3 bits (194), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 47/147 (31%), Positives = 77/147 (52%), Gaps = 1/147 (0%)

Query: 2   NRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIA 61
            R  K   + +L K+   S  ++V  Y+G+SVA+I  LR++MRE GG   VAKN L+ +A
Sbjct: 3   KRPVKEALVGDLQKLLEKSSVVMVIDYRGLSVAEITGLRRRMREHGGTCVVAKNTLMGVA 62

Query: 62  IRDTSIRGISDLFVGQSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
            R+T+ R I  L  G S  ++ +  +    K    F+ +  +    G VV+  ++  D +
Sbjct: 63  TRETAWRNIDPLLAGPSAFLFGNEKLKEMLKTYEDFARETKKTEFRGAVVDGTLVTLDGL 122

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRL 147
           K IA LP  E + A    A++   T++
Sbjct: 123 KAIADLPPKEVLLAQFAGALKVLPTKI 149


>gi|227874629|ref|ZP_03992792.1| 50S ribosomal protein L10 [Mobiluncus mulieris ATCC 35243]
 gi|306817913|ref|ZP_07451652.1| 50S ribosomal protein L10 [Mobiluncus mulieris ATCC 35239]
 gi|227844838|gb|EEJ54984.1| 50S ribosomal protein L10 [Mobiluncus mulieris ATCC 35243]
 gi|304649392|gb|EFM46678.1| 50S ribosomal protein L10 [Mobiluncus mulieris ATCC 35239]
          Length = 192

 Score = 79.3 bits (194), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 48/177 (27%), Positives = 93/177 (52%), Gaps = 8/177 (4%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVK--VAKNRLV 58
           M R  K   +  L+     + ++++  Y+G+SV Q+K+LR  +   GG V+  VAKN+L 
Sbjct: 18  MARPDKVAGVKSLADSAKDAAAVILTEYRGLSVKQMKELRLAL---GGEVRYAVAKNKLS 74

Query: 59  KIAIRDTSIRGISDLFVGQSLIVY---SDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVL 115
           K+A ++  + G+ +  VG + I +      PV A K+   F+ +N    V GG+++  V+
Sbjct: 75  KLAFKEAGVEGLDEYLVGPTAIAFVGHDGDPVAAAKVISKFAKENPALVVKGGLMDGNVM 134

Query: 116 NQDSIKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQQG 172
           + + +K++ASL   E + A     +++   R   ++  P ++ VR + A  +K  + 
Sbjct: 135 DAEDVKKLASLESREVLLAKSAGVLKALMYRAAAVMVAPASKTVRTVDALREKQAKA 191


>gi|269977572|ref|ZP_06184539.1| 50S ribosomal protein L10 [Mobiluncus mulieris 28-1]
 gi|307701376|ref|ZP_07638397.1| ribosomal protein L10 [Mobiluncus mulieris FB024-16]
 gi|269934175|gb|EEZ90742.1| 50S ribosomal protein L10 [Mobiluncus mulieris 28-1]
 gi|307613537|gb|EFN92785.1| ribosomal protein L10 [Mobiluncus mulieris FB024-16]
          Length = 175

 Score = 79.3 bits (194), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 48/177 (27%), Positives = 93/177 (52%), Gaps = 8/177 (4%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVK--VAKNRLV 58
           M R  K   +  L+     + ++++  Y+G+SV Q+K+LR  +   GG V+  VAKN+L 
Sbjct: 1   MARPDKVAGVKSLADSAKDAAAVILTEYRGLSVKQMKELRLAL---GGEVRYAVAKNKLS 57

Query: 59  KIAIRDTSIRGISDLFVGQSLIVY---SDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVL 115
           K+A ++  + G+ +  VG + I +      PV A K+   F+ +N    V GG+++  V+
Sbjct: 58  KLAFKEAGVEGLDEYLVGPTAIAFVGHDGDPVAAAKVISKFAKENPALVVKGGLMDGNVM 117

Query: 116 NQDSIKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQQG 172
           + + +K++ASL   E + A     +++   R   ++  P ++ VR + A  +K  + 
Sbjct: 118 DAEDVKKLASLESREVLLAKSAGVLKALMYRAAAVMVAPASKTVRTVDALREKQAKA 174


>gi|297172383|gb|ADI23358.1| hypothetical protein [uncultured Oceanospirillales bacterium
           HF0770_27O18]
          Length = 177

 Score = 79.3 bits (194), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 54/176 (30%), Positives = 92/176 (52%), Gaps = 9/176 (5%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           +N + K   +  ++   S + S VVA Y+G+SVA++ +LR K RE G  +KV +N L K 
Sbjct: 3   LNLEDKRAIVVSVNAAASEALSAVVADYRGLSVAEMTNLRLKARETGVYLKVVRNTLAKR 62

Query: 61  AIRDTSIRGISDLFVGQSLIVYS-DSPVIAPKISVSFSNDNNEFRV----LGGVVEKGVL 115
           A+  T    ++D  VG +++ +S D P  A ++   F+ D++   V    +GGV  +   
Sbjct: 63  AVAGTDYECLTDALVGPTVLAFSQDDPGAAARLIKDFAKDHDALEVKALAVGGVAYEA-- 120

Query: 116 NQDSIKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQQ 171
               I  +A LP  +   A ++S +Q+   + VR L     + VR ++A  D+ QQ
Sbjct: 121 --KDIDVLAKLPTRDEAIAQLMSVMQAPVAKFVRTLNEVPGKFVRTMAAVKDQKQQ 174


>gi|251799656|ref|YP_003014387.1| ribosomal protein L10 [Paenibacillus sp. JDR-2]
 gi|247547282|gb|ACT04301.1| ribosomal protein L10 [Paenibacillus sp. JDR-2]
          Length = 167

 Score = 79.3 bits (194), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 51/140 (36%), Positives = 83/140 (59%), Gaps = 1/140 (0%)

Query: 4   QGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIR 63
           Q K   + E++     S S VVA Y+G++VAQ+ +LRK++REAG   +V KN LV+ A  
Sbjct: 8   QEKQQAVEEITAKLRESSSTVVADYRGLNVAQVTELRKQLREAGVEFQVLKNSLVRRATE 67

Query: 64  DTSIRGISDLFVGQSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQ 122
              +  ++ + VG + I +S +  +AP KI   F+  N+  ++ GGVVE  V+    IK 
Sbjct: 68  AAELSDLNSILVGPTAIAFSVNDAVAPAKILNDFAKKNDALKLKGGVVEGKVVGAQEIKA 127

Query: 123 IASLPDLEGIRAGIISAIQS 142
           +A LP  EG+ + ++S +Q+
Sbjct: 128 LAELPSREGLLSMLLSVLQA 147


>gi|164686518|ref|ZP_02210546.1| hypothetical protein CLOBAR_00085 [Clostridium bartlettii DSM
           16795]
 gi|164604387|gb|EDQ97852.1| hypothetical protein CLOBAR_00085 [Clostridium bartlettii DSM
           16795]
          Length = 167

 Score = 79.3 bits (194), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 48/150 (32%), Positives = 84/150 (56%), Gaps = 2/150 (1%)

Query: 4   QGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIR 63
           Q KS  ++E+ +    S S +V  YKG++V ++ +LRKKMREAG   KV KN LV+ A +
Sbjct: 6   QMKSQVVAEIVEKLQKSSSTIVVDYKGLTVEEVTELRKKMREAGVEYKVYKNTLVRRAAK 65

Query: 64  DTSIRGI-SDLFVGQSLIVY-SDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSIK 121
           +  I    ++L VG + I +  D P+   ++   F   + + ++  GVVE    N+  I 
Sbjct: 66  EVGIEEFNNELLVGTNAIAFGYDDPIAPARVIKEFMEAHPKMQLKMGVVEGTFYNEAQIV 125

Query: 122 QIASLPDLEGIRAGIISAIQSNATRLVRLL 151
           + A++P  E + A ++ ++++  +  V LL
Sbjct: 126 EFANIPPREVLLAKLLGSLKAPMSNFVYLL 155


>gi|289644518|ref|ZP_06476592.1| ribosomal protein L10 [Frankia symbiont of Datisca glomerata]
 gi|289505680|gb|EFD26705.1| ribosomal protein L10 [Frankia symbiont of Datisca glomerata]
          Length = 190

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 51/171 (29%), Positives = 86/171 (50%), Gaps = 2/171 (1%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M +  K   ++E++  F  + + V+  Y+G++V+Q+ +LR+ + E G    V KN L KI
Sbjct: 1   MAKPEKVAAVTEIADSFRGASAAVLTEYRGLTVSQLTELRRSLGE-GTQYAVVKNTLTKI 59

Query: 61  AIRDTSIRGISDLFVGQSLIVY-SDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
           A     + G+ DL VG + + + +  PV A K    F+  N    V GGVVE   ++ D 
Sbjct: 60  AAGQAGVNGLDDLLVGPTAVAFVTGDPVEAAKGLRDFARANPALVVKGGVVEGRPVSADD 119

Query: 120 IKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQ 170
           I+++A L   E + A +  A+  +  + V L   P +Q  R   A   K +
Sbjct: 120 IRKLADLESREVLLAKLAGALNGSLAKAVGLFAAPLSQTARLAEALRAKRE 170


>gi|290477018|ref|YP_003469930.1| 50S ribosomal subunit protein L10 [Xenorhabdus bovienii SS-2004]
 gi|289176363|emb|CBJ83168.1| 50S ribosomal subunit protein L10 [Xenorhabdus bovienii SS-2004]
          Length = 165

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 47/159 (29%), Positives = 91/159 (57%), Gaps = 2/159 (1%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           +N Q K   ++E+S++   + S VVA  +G++V ++ +LRK  REAG  ++V +N L++ 
Sbjct: 3   LNLQDKQAIVAEVSEVAKGALSAVVADSRGVTVGKMTELRKAGREAGVYMRVVRNTLMRR 62

Query: 61  AIRDTSIRGISDLFVGQSLIVY-SDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
           A+  T    + + FVG +LI + S+ P  A ++   F+  N  F +     E   ++ ++
Sbjct: 63  AVEGTDYECLKEAFVGPTLIAFSSEHPGAAARLFKEFAKANPAFEIKAAAFEGEFISGEN 122

Query: 120 IKQIASLPDLEGIRAGIISAI-QSNATRLVRLLGTPQTQ 157
           I ++A+LP  E   A +++ + +++A +LVR L   + Q
Sbjct: 123 IDRLATLPTYEEAIARLMATMKEASAGKLVRTLAALRDQ 161


>gi|126654235|ref|ZP_01726029.1| 50S ribosomal protein L10 [Bacillus sp. B14905]
 gi|126589293|gb|EAZ83450.1| 50S ribosomal protein L10 [Bacillus sp. B14905]
          Length = 135

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 41/114 (35%), Positives = 70/114 (61%), Gaps = 1/114 (0%)

Query: 30  GISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRGISDLFVGQSLIVYSDSPVIA 89
           G++VAQ+ +LRK++REAG   KV KN L + A     + GI+D+ VG + I +S+  V+A
Sbjct: 1   GLNVAQVTELRKQLREAGVEFKVYKNTLTRRAAEAAGLAGINDVLVGPNAIAFSNEDVVA 60

Query: 90  P-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASLPDLEGIRAGIISAIQS 142
           P KI   F+  N    +  G++E  + + + +K +A LP  EG+ + ++S +Q+
Sbjct: 61  PAKIINEFAKKNEALEIKAGIIEGTISSVEDVKALAELPSREGLLSMLLSVLQA 114


>gi|312865100|ref|ZP_07725328.1| ribosomal protein L10 [Streptococcus downei F0415]
 gi|311099211|gb|EFQ57427.1| ribosomal protein L10 [Streptococcus downei F0415]
          Length = 166

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 44/122 (36%), Positives = 74/122 (60%), Gaps = 1/122 (0%)

Query: 22  SIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRGISDLFVGQSLIV 81
           S+VV   +G++V Q  +LR+ +REAG  +KV KN ++  A     +  + DLFVG S + 
Sbjct: 25  SLVVVDSRGLTVEQDTNLRRSLREAGVELKVIKNSILSRAAEKAGLDDMKDLFVGPSAVA 84

Query: 82  YSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASLPDLEGIRAGIISAI 140
           +S+  V+AP KI   F+ +     + GG VE  V + + IK +A+LP+ EG+ + ++S +
Sbjct: 85  FSNEDVVAPAKIINDFAKEAEALEIKGGAVEGAVSSVEEIKALAALPNREGMLSMLLSVL 144

Query: 141 QS 142
           Q+
Sbjct: 145 QA 146


>gi|152998280|ref|YP_001343115.1| 50S ribosomal protein L10 [Marinomonas sp. MWYL1]
 gi|189040921|sp|A6W3A1|RL10_MARMS RecName: Full=50S ribosomal protein L10
 gi|150839204|gb|ABR73180.1| ribosomal protein L10 [Marinomonas sp. MWYL1]
          Length = 166

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 46/155 (29%), Positives = 88/155 (56%), Gaps = 1/155 (0%)

Query: 4   QGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIR 63
           + K   ++E+S++  ++ S VVA  +G++V+ + +LRK+ REAG  V+V +N L + A+ 
Sbjct: 6   EDKKAIVAEVSEVAKTALSAVVADSRGVTVSSMTELRKEAREAGVYVRVVRNTLARRAVE 65

Query: 64  DTSIRGISDLFVGQSLIVYS-DSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQ 122
            T    +++ FVG +LI +S + P  A ++  +F+  N++F V        ++    I +
Sbjct: 66  GTDFECLAESFVGPTLIAFSNEHPGAAARLLKAFAKTNSKFEVKALAFNGELIPAGDIDR 125

Query: 123 IASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQ 157
           +A+LP  +   A ++S IQ   ++ VR L   + Q
Sbjct: 126 LATLPTYDEAIAKLMSVIQGATSKFVRTLAAVRDQ 160


>gi|326793549|ref|YP_004311369.1| 50S ribosomal protein L10 [Marinomonas mediterranea MMB-1]
 gi|326544313|gb|ADZ89533.1| 50S ribosomal protein L10 [Marinomonas mediterranea MMB-1]
          Length = 166

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 49/155 (31%), Positives = 84/155 (54%), Gaps = 1/155 (0%)

Query: 4   QGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIR 63
           + K   ++E+S++  S+ S VVA  +G++V  +  LRK+ REAG  V+V +N L + A+ 
Sbjct: 6   EDKKAIVAEVSEVAQSALSAVVADSRGVTVGDMTALRKEAREAGVYVRVVRNTLARRAVD 65

Query: 64  DTSIRGISDLFVGQSLIVYS-DSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQ 122
            T    + D FVG +LI +S + P  A ++   F+  N+ F V        ++    I +
Sbjct: 66  GTDFECLKDSFVGPTLIAFSNEHPGAAARLLKEFAKGNDAFEVKALAFNGELIAAGDIDR 125

Query: 123 IASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQ 157
           +ASLP  +   A ++S +Q   ++LVR L   + Q
Sbjct: 126 LASLPTYDEAIAKLMSVLQGATSKLVRTLAAVREQ 160


>gi|297180341|gb|ADI16558.1| ribosomal protein l10 [uncultured gamma proteobacterium
           HF0010_01E20]
          Length = 176

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 44/141 (31%), Positives = 82/141 (58%), Gaps = 1/141 (0%)

Query: 10  ISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRG 69
           ++E++   SS+ S V+A Y+G++VA++ +LR K RE G  ++V +N LVK A+  T    
Sbjct: 12  VAEVNDAASSALSAVLADYRGLTVAEMTELRVKARETGVYLRVVRNTLVKRAVEGTDFEC 71

Query: 70  ISDLFVGQSLIVYS-DSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASLPD 128
           + D  VG +L+ +S + P  A ++   ++ D  E  +    +   +L  D I ++A LP 
Sbjct: 72  LKDALVGPTLLAFSREDPGAAARLLKEYAQDLEELDIKALSIGGTLLPADQIDRVARLPT 131

Query: 129 LEGIRAGIISAIQSNATRLVR 149
           L+  R+ ++SA+Q+   +L +
Sbjct: 132 LDQARSMLMSAMQAPIIKLAQ 152


>gi|219848382|ref|YP_002462815.1| 50S ribosomal protein L10 [Chloroflexus aggregans DSM 9485]
 gi|254798368|sp|B8G989|RL10_CHLAD RecName: Full=50S ribosomal protein L10
 gi|219542641|gb|ACL24379.1| ribosomal protein L10 [Chloroflexus aggregans DSM 9485]
          Length = 181

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 54/176 (30%), Positives = 91/176 (51%), Gaps = 6/176 (3%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKG----ISVAQIKDLRKKMREAGGGVKVAKNR 56
           M  Q K   + EL++  S +  +VVA Y+G    +SVA + +LR+K+RE GG V VAKN 
Sbjct: 1   MPTQRKIETVQELTEKLSRAQLVVVADYRGEGRGMSVADMTELRRKLREHGGEVVVAKNT 60

Query: 57  LVKIAIRDTSIRGISDLFVGQSLIV--YSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGV 114
           L+KIA   T    +  L  G + +   Y D   +A  +     + N  F V G ++ + +
Sbjct: 61  LLKIAANHTGRGALDPLLAGPTAVTFAYDDVAKVAKALLDYLKSGNKSFTVRGALLGQAL 120

Query: 115 LNQDSIKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQ 170
           L  D+++Q+  LP  E   A ++  I +  + +V +L    + V+  + A +D+ Q
Sbjct: 121 LPADALEQVTKLPSREQALAQVVGGIAAPVSGVVGVLNAAISNVLYVLQARIDQLQ 176


>gi|308234980|ref|ZP_07665717.1| 50S ribosomal protein L10 [Gardnerella vaginalis ATCC 14018]
 gi|311114240|ref|YP_003985461.1| 50S ribosomal protein L10 [Gardnerella vaginalis ATCC 14019]
 gi|310945734|gb|ADP38438.1| 50S ribosomal protein L10 [Gardnerella vaginalis ATCC 14019]
          Length = 173

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 53/177 (29%), Positives = 88/177 (49%), Gaps = 10/177 (5%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKM-REAGGGVKVAKNRLVK 59
           M R  K   ++EL+ +F ++ ++ +  Y+G++V QI  LR+K+ R+      VAKN L +
Sbjct: 1   MKRPEKEAVVAELTDLFRNADAVYLTEYRGLTVPQISSLREKLGRDT--SYSVAKNTLAR 58

Query: 60  IAIRDTSIRGISDLFVGQSLIVYSDSPVI-APKISVSFSNDNNEFRVLGGVVEKGVLNQD 118
           IA ++  I G+ +L  G + I +     I A K    F+ +N    + GG  +  V + +
Sbjct: 59  IAAKEAGIEGLDELLAGPTAITFVKGDFIEAAKTLRDFAKENKTLVIKGGFADGTVYDAE 118

Query: 119 SIKQIASL---PDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQQG 172
             KQ+A L   P+L    AG +    S A  L   L    T+ VR I A  +K ++ 
Sbjct: 119 GAKQLADLKSRPELLSEMAGALKGTMSKAAYLFNAL---PTKAVRTIDALREKQEKA 172


>gi|224475687|ref|YP_002633293.1| 50S ribosomal protein L10 [Staphylococcus carnosus subsp. carnosus
           TM300]
 gi|254798399|sp|B9DKX2|RL10_STACT RecName: Full=50S ribosomal protein L10
 gi|222420294|emb|CAL27108.1| 50S ribosomal protein L10 [Staphylococcus carnosus subsp. carnosus
           TM300]
          Length = 166

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 36/134 (26%), Positives = 80/134 (59%), Gaps = 1/134 (0%)

Query: 10  ISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRG 69
           + +++    +S S V+ +Y+G++VA++ +LRK++REAG   KV KN +++ A     + G
Sbjct: 12  VEQIADQLKNSVSTVIVNYRGLTVAEVTELRKQLREAGVEYKVYKNTMMRRAAEQAGLEG 71

Query: 70  ISDLFVGQSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASLPD 128
           + +   G + +  S   V+AP K+   F+ ++    +  GV++  +++ + +K + SLP 
Sbjct: 72  LDEFLTGPTAVATSTEDVVAPAKVIAGFAKEHEALEIKTGVMDGSIISAEEVKTVGSLPS 131

Query: 129 LEGIRAGIISAIQS 142
            +G+ + ++S +Q+
Sbjct: 132 HDGLVSMLLSVLQA 145


>gi|113460317|ref|YP_718378.1| 50S ribosomal protein L10 [Haemophilus somnus 129PT]
 gi|123031074|sp|Q0I0V0|RL10_HAES1 RecName: Full=50S ribosomal protein L10
 gi|112822360|gb|ABI24449.1| LSU ribosomal protein L10P [Haemophilus somnus 129PT]
          Length = 163

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 49/177 (27%), Positives = 95/177 (53%), Gaps = 22/177 (12%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           +N Q K   ++E+++    + S V+A  +G++V ++ +LRK  REAG  ++V +N L++ 
Sbjct: 3   LNLQDKQAIVAEVNEAAKGALSAVIADSRGVTVDKMTELRKAAREAGVSMRVVRNTLLRR 62

Query: 61  AIRDTSIRGISDLFVGQSLIVYS-DSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
           A+  T+   ++D FVG +LI +S + P  A ++   F+  N++F + G   E  + N   
Sbjct: 63  AVEGTAFECLTDTFVGPTLIAFSNEHPGAAARLFKDFAKANDKFEIKGAAFEGKIQN--- 119

Query: 120 IKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQT----QVVRAISAFVDKNQQG 172
           ++ +A+LP  E                + RL+GT +     ++ R ++A+ DK Q+ 
Sbjct: 120 VEFLATLPTYE--------------EAIARLMGTMKEAAAGKLARTLAAYRDKLQEA 162


>gi|313890497|ref|ZP_07824125.1| ribosomal protein L10 [Streptococcus pseudoporcinus SPIN 20026]
 gi|313121014|gb|EFR44125.1| ribosomal protein L10 [Streptococcus pseudoporcinus SPIN 20026]
          Length = 166

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 43/127 (33%), Positives = 76/127 (59%), Gaps = 1/127 (0%)

Query: 17  FSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRGISDLFVG 76
             ++ SIVV   +G++V Q  +LR+ +RE+G   KV KN ++  A     + G+ D+FVG
Sbjct: 20  MKNAASIVVVDSRGLTVGQDTELRRSLRESGVEFKVIKNSILSRAAVKAGLEGMEDVFVG 79

Query: 77  QSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASLPDLEGIRAG 135
            S + +S+  VIAP KI   F+   +   + GG +E  V +++ I  +A+LP+ EG+ + 
Sbjct: 80  PSAVAFSNEDVIAPAKIINDFAKTADALEIKGGTIEGAVSSKEDIMALATLPNREGMLSM 139

Query: 136 IISAIQS 142
           ++S +Q+
Sbjct: 140 LLSVLQA 146


>gi|302671726|ref|YP_003831686.1| ribosomal protein L10 RplJ [Butyrivibrio proteoclasticus B316]
 gi|302396199|gb|ADL35104.1| ribosomal protein L10 RplJ [Butyrivibrio proteoclasticus B316]
          Length = 191

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 43/143 (30%), Positives = 80/143 (55%), Gaps = 1/143 (0%)

Query: 10  ISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRG 69
           ++E+S+    + ++V+  ++G++VAQ  +LRKK+RE G   KV KN ++  A + T    
Sbjct: 11  VAEISEKIKDAQAVVLVDHRGLTVAQDTELRKKLREEGVTYKVYKNTMMNFAFKGTDFEQ 70

Query: 70  ISDLFVGQSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASLPD 128
           +SDL  G S +  S++   AP ++   F+       + GGV+E    +  ++  IAS+P 
Sbjct: 71  LSDLLNGPSAMAVSETDPAAPARVLYEFAKKAKALEIKGGVIEGKFYDAAAMTDIASIPS 130

Query: 129 LEGIRAGIISAIQSNATRLVRLL 151
            E + + ++ ++QS  T   R+L
Sbjct: 131 KEVLLSRLLGSMQSPITNFARVL 153


>gi|84494798|ref|ZP_00993917.1| 50S ribosomal protein L10 [Janibacter sp. HTCC2649]
 gi|84384291|gb|EAQ00171.1| 50S ribosomal protein L10 [Janibacter sp. HTCC2649]
          Length = 211

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 51/166 (30%), Positives = 81/166 (48%), Gaps = 2/166 (1%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M+R  K+  I+EL+  F SS + V+  Y+G+SV QI DLR  +R       V KN L ++
Sbjct: 1   MSRADKTAAIAELADKFRSSNATVLTEYRGLSVKQITDLRGALR-GNATYAVVKNTLTEL 59

Query: 61  AIRDTSIRGISDLFVGQSLIVYSD-SPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
           A ++  +       VG S I + D  PV A K    F+  N    +  G+++   L    
Sbjct: 60  AAKEAGVTAFDGQLVGPSAIAFVDGDPVEAAKSLRDFAKANPLLVIKSGLLDGKALTAQE 119

Query: 120 IKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAF 165
           I ++A L   E + A +  A+ ++ T+ V L   P +Q  R + A 
Sbjct: 120 ITKLADLESREVLLAKLAGAMNASLTQAVYLFAAPLSQTARVVDAL 165


>gi|300714845|ref|YP_003739648.1| 50S ribosomal protein L10 [Erwinia billingiae Eb661]
 gi|299060681|emb|CAX57788.1| 50S ribosomal protein L10 [Erwinia billingiae Eb661]
          Length = 167

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 48/159 (30%), Positives = 88/159 (55%), Gaps = 2/159 (1%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           +N Q K   ++E+S++   + S VVA  +G+ V ++ +LRK  REAG  ++V +N L++ 
Sbjct: 3   LNLQDKQAIVAEVSEVAKGALSAVVADSRGVPVGKMTELRKAGREAGVYMRVVRNTLLRR 62

Query: 61  AIRDTSIRGISDLFVGQSLIVYS-DSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
            +  T    + D FVG +LI YS + P  A ++   F+  N +F V     E  +++   
Sbjct: 63  VVEGTQFECLKDTFVGPTLIAYSMEHPGAAARLFKDFAKANAKFEVKAAAFEGELISAAQ 122

Query: 120 IKQIASLPDLEGIRAGIISAI-QSNATRLVRLLGTPQTQ 157
           I ++A+LP  +   A +++ + ++ A +LVR L   + Q
Sbjct: 123 IDRLATLPTYDEAVARLMATMKEAAAGKLVRTLAAVRDQ 161


>gi|39997956|ref|NP_953907.1| 50S ribosomal protein L10 [Geobacter sulfurreducens PCA]
 gi|61215117|sp|Q748Y4|RL10_GEOSL RecName: Full=50S ribosomal protein L10
 gi|39984901|gb|AAR36257.1| ribosomal protein L10 [Geobacter sulfurreducens PCA]
 gi|298506897|gb|ADI85620.1| ribosomal protein L10 [Geobacter sulfurreducens KN400]
          Length = 174

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 50/166 (30%), Positives = 86/166 (51%), Gaps = 2/166 (1%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           MN++ K  +++EL      + ++ +A ++G++V Q   LR ++R A    KV KN L+++
Sbjct: 1   MNKETKQQQVAELHDKLQRAKAVFLADFRGMNVEQATTLRNELRSAAVEYKVVKNTLLEL 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYS-DSPVIAPKISVSFSNDN-NEFRVLGGVVEKGVLNQD 118
           A RDT    +S  F G + I  S D PV A K+   F+    N F++  GV+    ++  
Sbjct: 61  ASRDTDKESLSQHFAGPTAIALSYDDPVSAAKVLSKFAKTQPNTFKLKAGVLTGKAISVA 120

Query: 119 SIKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISA 164
            I+ +A LP  E + A ++  I +     V +L       VRA++A
Sbjct: 121 DIQSLADLPSREVLIAKLLGTINAPVANFVGVLAAVPGSFVRALNA 166


>gi|221632696|ref|YP_002521917.1| 50S ribosomal protein L10 [Thermomicrobium roseum DSM 5159]
 gi|254798407|sp|B9KYX5|RL10_THERP RecName: Full=50S ribosomal protein L10
 gi|221156940|gb|ACM06067.1| 50S ribosomal protein L10 [Thermomicrobium roseum DSM 5159]
          Length = 179

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 45/155 (29%), Positives = 84/155 (54%), Gaps = 1/155 (0%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M    K+ +I E+S+I  ++   ++  Y+G+SVA +   R++++E     +V KN L +I
Sbjct: 1   MPTPEKARQIEEISEILRTASLAILTDYRGLSVADMTAFRRRLQEQQANFRVVKNTLTRI 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYS-DSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
           A   T    I+ L  G + +VYS   PV A K+++ F+  +    V GG++   +L+   
Sbjct: 61  AAERTGTEVITPLLEGPTALVYSMGDPVAAAKLTLEFARQSRILSVKGGLLAGRLLSAAD 120

Query: 120 IKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTP 154
           ++ +A+LP  E + A ++  +Q+    LV +L  P
Sbjct: 121 VEALATLPPREELLAKVVGGLQAPLYGLVSVLSGP 155


>gi|312200030|ref|YP_004020091.1| ribosomal protein L10 [Frankia sp. EuI1c]
 gi|311231366|gb|ADP84221.1| ribosomal protein L10 [Frankia sp. EuI1c]
          Length = 188

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 50/158 (31%), Positives = 80/158 (50%), Gaps = 2/158 (1%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M    KS  ++E++  F  S + V+  Y+G++VAQI +LR+ + E      V KN L KI
Sbjct: 1   MANPEKSAAVAEITAEFRDSTAAVLTEYRGLTVAQITELRRSLGEKTK-YTVVKNTLTKI 59

Query: 61  AIRDTSIRGISDLFVGQSLIVY-SDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
           A     + G+ DL VG + + +    PV A K+   F+  N    V GG VE   ++ D 
Sbjct: 60  AAERAGVTGLDDLLVGPTGVAFVGGDPVEAAKVLREFARANQALIVKGGFVEGKAMSADD 119

Query: 120 IKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQ 157
           I+++A L   E + A +  A+  +  + V L   P +Q
Sbjct: 120 IRKLADLESREVLLAKLAGAMNGSLAKAVGLFAAPLSQ 157


>gi|154484470|ref|ZP_02026918.1| hypothetical protein EUBVEN_02184 [Eubacterium ventriosum ATCC
           27560]
 gi|149734318|gb|EDM50235.1| hypothetical protein EUBVEN_02184 [Eubacterium ventriosum ATCC
           27560]
          Length = 164

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 48/163 (29%), Positives = 84/163 (51%), Gaps = 12/163 (7%)

Query: 10  ISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRG 69
           + E+S++ + + + VV  Y+G++VA+  +LRK++REAG   KV KN ++  AI+DT    
Sbjct: 11  VEEISELLNGAATAVVVDYRGLTVAEDTELRKQLREAGVVYKVYKNTMINFAIKDTEFAD 70

Query: 70  ISDLFVGQSLI-VYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASLPD 128
           ++    G + I V  D    A ++   F+       + GGVV+    +   I QIAS+P 
Sbjct: 71  LAQHLEGPTAIAVCKDDATAAARVLAKFAKTAEALEIKGGVVDGIYYDAVGIGQIASIPS 130

Query: 129 LEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQQ 171
            E + + ++ ++QS           P T   R I    +KN++
Sbjct: 131 REVLLSKLLGSMQS-----------PVTNFARVIKQIAEKNEE 162


>gi|88704393|ref|ZP_01102107.1| 50S ribosomal protein L10 [Congregibacter litoralis KT71]
 gi|88701444|gb|EAQ98549.1| 50S ribosomal protein L10 [Congregibacter litoralis KT71]
          Length = 177

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 48/169 (28%), Positives = 93/169 (55%), Gaps = 1/169 (0%)

Query: 4   QGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIR 63
           + K   ++E+++  +S+ S+V+A  +G+SV  +  LRK+ RE+   V+V +N L K A+ 
Sbjct: 6   EDKKAIVAEVNETATSAMSLVIADARGVSVGGMTALRKEARESQVTVRVVRNTLAKRALE 65

Query: 64  DTSIRGISDLFVGQSLIVYS-DSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQ 122
            T    ++D  VG SL  +S + P  A ++   F+ DN+ F V    V   +L  D +  
Sbjct: 66  GTDYECVNDALVGPSLFGFSMEDPGAAARLFKDFAKDNDAFEVKALAVSGQMLGADQLDV 125

Query: 123 IASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQQ 171
           +A LP  +   + ++S +++  T+L + +     ++VR ++A  D+ +Q
Sbjct: 126 LAKLPTRDQALSMLMSVMKAPVTKLAQTMNEVPGKLVRTLAAVRDQKEQ 174


>gi|169351741|ref|ZP_02868679.1| hypothetical protein CLOSPI_02522 [Clostridium spiroforme DSM 1552]
 gi|169291963|gb|EDS74096.1| hypothetical protein CLOSPI_02522 [Clostridium spiroforme DSM 1552]
          Length = 191

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 41/149 (27%), Positives = 82/149 (55%), Gaps = 1/149 (0%)

Query: 4   QGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIR 63
           + KS  + E++     + S V+  Y+G+SVA++ +LR+ +R      K+ KN LV+ A  
Sbjct: 7   KAKSALVEEIATKLKDAQSAVIVEYRGLSVAEVTELRRNLRAEDVEFKIYKNTLVRRATE 66

Query: 64  DTSIRGISDLFVGQSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQ 122
            T    ++    G + I +  S  +AP ++   F+ D+    +  G+VE  VL+ + IK+
Sbjct: 67  STGYEELNAQLTGPNAIAFGHSDAVAPARVLAKFAKDHEALVIKAGMVEGKVLDVEEIKE 126

Query: 123 IASLPDLEGIRAGIISAIQSNATRLVRLL 151
           I+ LP+ EG+ + ++  +Q+  ++  R++
Sbjct: 127 ISKLPNREGMYSMLLGMLQAPVSKFARVV 155


>gi|153871197|ref|ZP_02000430.1| Ribosomal protein L10 [Beggiatoa sp. PS]
 gi|152072337|gb|EDN69570.1| Ribosomal protein L10 [Beggiatoa sp. PS]
          Length = 179

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 51/158 (32%), Positives = 85/158 (53%), Gaps = 3/158 (1%)

Query: 16  IFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRGISDLFV 75
           I S S S +VA Y+GI+  Q+  LR++ RE G  ++V +N L + A+ +TS   + ++ V
Sbjct: 18  IASRSHSAIVAEYRGITCVQMTQLRQQAREGGVYLRVVRNTLARRAVSNTSYECLQEMLV 77

Query: 76  GQSLIVYS-DSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASLPD-LEGIR 133
           G  ++ +S + P  A ++   F   N    V G  +   +L    I +IA LP  LE I 
Sbjct: 78  GPIILAFSMEDPGAAARVINKFVKTNKNLIVKGIALSGQLLPPTEIDKIAKLPTYLEAI- 136

Query: 134 AGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQQ 171
           + ++S + +  T+L R L  P  ++VR I+A  D  Q+
Sbjct: 137 SMLMSVMSAPITQLARTLHEPHAKLVRTIAAVGDSKQE 174


>gi|148269604|ref|YP_001244064.1| 50S ribosomal protein L10 [Thermotoga petrophila RKU-1]
 gi|170288280|ref|YP_001738518.1| ribosomal protein L10 [Thermotoga sp. RQ2]
 gi|281411678|ref|YP_003345757.1| ribosomal protein L10 [Thermotoga naphthophila RKU-10]
 gi|166230085|sp|A5IJW5|RL10_THEP1 RecName: Full=50S ribosomal protein L10
 gi|226700019|sp|B1L937|RL10_THESQ RecName: Full=50S ribosomal protein L10
 gi|147735148|gb|ABQ46488.1| LSU ribosomal protein L10P [Thermotoga petrophila RKU-1]
 gi|170175783|gb|ACB08835.1| ribosomal protein L10 [Thermotoga sp. RQ2]
 gi|281372781|gb|ADA66343.1| ribosomal protein L10 [Thermotoga naphthophila RKU-10]
          Length = 179

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 50/178 (28%), Positives = 91/178 (51%), Gaps = 7/178 (3%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREA---GGGVKVAKNRL 57
           + RQ K + + E+S+IF  +  I+ A + G +VA + +LR K+RE    G   +V KN L
Sbjct: 2   LTRQQKELIVEEMSEIFKKTSLILFADFLGFTVADLTELRSKLREKYGDGARFRVVKNTL 61

Query: 58  VKIAIRDTSIRGISDLFVGQSLIVY--SDSPVIAPKISVSFSNDN--NEFRVLGGVVEKG 113
           + +A+++    G  +   G + ++Y     PV A KI  +F  D   +  R+ GG +E  
Sbjct: 62  LNLALKNAEYEGYEEFLKGPTAVLYVTEGDPVEAVKIVYNFYKDKKADLSRLKGGFLEGK 121

Query: 114 VLNQDSIKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQQ 171
               + ++ IA LP  E + A ++  +++  T LV +L      +V  ++A  +K  +
Sbjct: 122 KFTAEEVENIAKLPSKEELYAMLVGRVKAPITGLVFVLSGILRNLVYVLNAIKEKKSE 179


>gi|108804983|ref|YP_644920.1| 50S ribosomal protein L10P [Rubrobacter xylanophilus DSM 9941]
 gi|122381568|sp|Q1AU20|RL10_RUBXD RecName: Full=50S ribosomal protein L10
 gi|108766226|gb|ABG05108.1| LSU ribosomal protein L10P [Rubrobacter xylanophilus DSM 9941]
          Length = 174

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 49/171 (28%), Positives = 93/171 (54%), Gaps = 2/171 (1%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M R+ K+  I EL+     + S+V+  Y+G+ VAQ  +LR++ REAG    VAKN L   
Sbjct: 1   MKREQKAQIIEELAGKLREN-SVVLVDYQGMDVAQSTELRRRSREAGVDFVVAKNTLTLR 59

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKG-VLNQDS 119
           A  +  +  +++  VG + + +S  PV A K+   ++++   FR+ GG++E   VLN+  
Sbjct: 60  AAEEAGLPSLTEFLVGPTALAFSRDPVAAAKLMAEYADEIETFRLKGGLLEGSRVLNEQE 119

Query: 120 IKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQ 170
           ++ ++ LP  + + A ++  + +  + LV +L      +V A+    ++ Q
Sbjct: 120 VEALSKLPGRDQLIAQVVGGMAAPISGLVSVLNNTIQGLVVALGQIAEQKQ 170


>gi|254369991|ref|ZP_04985998.1| hypothetical protein [Francisella tularensis subsp. tularensis
           FSC033]
 gi|151568236|gb|EDN33890.1| hypothetical protein FTBG_01645 [Francisella tularensis subsp.
           tularensis FSC033]
          Length = 150

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 45/147 (30%), Positives = 77/147 (52%), Gaps = 1/147 (0%)

Query: 22  SIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRGISDLFVGQSLIV 81
           S  VA Y+G++V ++  LRK+ RE+G  ++V +N L ++AI+ T    ++D   G  ++ 
Sbjct: 2   SAAVADYRGLTVNEMTSLRKQARESGVYLRVVRNNLARLAIKGTEFECLADALKGPLVLA 61

Query: 82  YS-DSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASLPDLEGIRAGIISAI 140
            S D P  A K+  +F  D+N F V    +   +   + +   A LP  E   A +++ +
Sbjct: 62  LSKDEPGAAAKLFKNFQKDHNAFEVKNLAMSGELFGPEKLDDFAKLPTREEALATLLNVM 121

Query: 141 QSNATRLVRLLGTPQTQVVRAISAFVD 167
           Q+  T+ VR L    +Q VR  +A  D
Sbjct: 122 QAPVTKFVRTLNEIPSQAVRVFAAVGD 148


>gi|170017871|ref|YP_001728790.1| ribosomal protein L10 [Leuconostoc citreum KM20]
 gi|226699971|sp|B1MVU2|RL10_LEUCK RecName: Full=50S ribosomal protein L10
 gi|169804728|gb|ACA83346.1| Ribosomal protein L10 [Leuconostoc citreum KM20]
          Length = 176

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 42/137 (30%), Positives = 80/137 (58%), Gaps = 1/137 (0%)

Query: 6   KSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDT 65
           K+ ++ E++  F ++ S VV   +G++VAQ  +LR ++RE G  ++V KN+++  A    
Sbjct: 9   KAQKVEEIADQFKNAASAVVVDARGLTVAQSTELRHQLREEGIVLEVIKNKILTRAAEKA 68

Query: 66  SIRGISDLFVGQSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIA 124
               ++D+F G S + +S+   +AP +I   F++ N +  + GGVV+  + N + I + A
Sbjct: 69  GFAELNDIFAGPSAVAFSNDDAVAPSRILKKFADANEKLEIKGGVVDGTIANIEDINKYA 128

Query: 125 SLPDLEGIRAGIISAIQ 141
           SLP  EG+   +++  Q
Sbjct: 129 SLPSREGLLGQLMAEFQ 145


>gi|283782733|ref|YP_003373487.1| ribosomal protein L10 [Gardnerella vaginalis 409-05]
 gi|283441671|gb|ADB14137.1| ribosomal protein L10 [Gardnerella vaginalis 409-05]
          Length = 173

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 53/177 (29%), Positives = 88/177 (49%), Gaps = 10/177 (5%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKM-REAGGGVKVAKNRLVK 59
           M R  K   ++EL+++F ++ +I +  Y+G++V QI  LR+K+ R+      VAKN L +
Sbjct: 1   MKRPEKEAVVAELTELFRNADAIYLTEYRGLTVPQISTLREKLGRDT--SYSVAKNTLAR 58

Query: 60  IAIRDTSIRGISDLFVGQSLIVYSDSPVI-APKISVSFSNDNNEFRVLGGVVEKGVLNQD 118
           IA ++  I G+ +L  G + + +     I A K    F+ +N    + GG  +  V + +
Sbjct: 59  IAAKEAGIEGLDELLAGPTAVTFVKGDFIEAAKTLRDFAKENKALVIKGGFADGTVYDAE 118

Query: 119 SIKQIASL---PDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQQG 172
             KQ+A L   P L    AG +    S A  L   L    T+ VR I A  +K ++ 
Sbjct: 119 GAKQLADLKSRPQLLSEMAGALKGTMSKAAYLFNAL---PTKAVRTIDALREKQEKA 172


>gi|226939177|ref|YP_002794248.1| 50S ribosomal protein L10 [Laribacter hongkongensis HLHK9]
 gi|254798384|sp|C1DAQ8|RL10_LARHH RecName: Full=50S ribosomal protein L10
 gi|226714101|gb|ACO73239.1| RplJ [Laribacter hongkongensis HLHK9]
          Length = 168

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 44/153 (28%), Positives = 85/153 (55%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           +N + K   ++E++   +++ +IVVA Y+GI V+ +  LR K RE G  ++V KN L + 
Sbjct: 3   LNLEDKKAVVAEIAAQVATAQTIVVAEYRGIEVSSMTKLRAKAREQGVYLRVLKNTLARR 62

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A+ DT   G++D  VG  +   S+ PV A K+   F+  +N+  +  G  +  VL    +
Sbjct: 63  AVADTPFAGLADQMVGPLVYGISEDPVAAAKVLNDFAKVDNKIVIKAGSYDGKVLGTAEV 122

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGT 153
            ++AS+P  + + + ++  +Q+  + + R+L  
Sbjct: 123 AELASIPSRDELLSKLLFVMQAPVSGMARVLAA 155


>gi|317472307|ref|ZP_07931635.1| ribosomal protein L10 [Anaerostipes sp. 3_2_56FAA]
 gi|316900264|gb|EFV22250.1| ribosomal protein L10 [Anaerostipes sp. 3_2_56FAA]
          Length = 173

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 43/143 (30%), Positives = 80/143 (55%), Gaps = 1/143 (0%)

Query: 10  ISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRG 69
           ++E+ ++ + + S V+  Y+GISV +   +RK++REAG   KV KN +++ A++DT    
Sbjct: 11  VNEIKELLTDAQSAVLVSYRGISVEEDTAMRKELREAGVEYKVYKNTMIRFAVKDTEFEP 70

Query: 70  ISDLFVGQSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASLPD 128
           +S    G + I  S +   AP +I   ++ +   F +   VVE    ++D ++ IAS+P 
Sbjct: 71  LSADLTGPTAIAVSKTDATAPARILAKYAKNIEVFSLKSAVVEGTFYDKDGVQVIASIPS 130

Query: 129 LEGIRAGIISAIQSNATRLVRLL 151
            + + A  + +IQS  T   R++
Sbjct: 131 RDELLAKFLGSIQSPITNFARVI 153


>gi|167748161|ref|ZP_02420288.1| hypothetical protein ANACAC_02905 [Anaerostipes caccae DSM 14662]
 gi|167652153|gb|EDR96282.1| hypothetical protein ANACAC_02905 [Anaerostipes caccae DSM 14662]
          Length = 173

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 43/143 (30%), Positives = 80/143 (55%), Gaps = 1/143 (0%)

Query: 10  ISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRG 69
           ++E+ ++ + + S V+  Y+GISV +   +RK++REAG   KV KN +++ A++DT    
Sbjct: 11  VNEIKELLTDAQSAVLVSYRGISVEEDTAMRKELREAGVEYKVYKNTMIRFAVKDTEFEP 70

Query: 70  ISDLFVGQSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASLPD 128
           +S    G + I  S +   AP +I   ++ +   F +   VVE    ++D ++ IAS+P 
Sbjct: 71  LSADLTGPTAIAVSKTDATAPARILAKYAKNIEVFSLKSAVVEGTFYDKDGVQVIASIPS 130

Query: 129 LEGIRAGIISAIQSNATRLVRLL 151
            + + A  + +IQS  T   R++
Sbjct: 131 RDELLAKFLGSIQSPITNFARVI 153


>gi|227832194|ref|YP_002833901.1| 50S ribosomal protein L10 [Corynebacterium aurimucosum ATCC 700975]
 gi|262183954|ref|ZP_06043375.1| 50S ribosomal protein L10 [Corynebacterium aurimucosum ATCC 700975]
 gi|254798372|sp|C3PKM7|RL10_CORA7 RecName: Full=50S ribosomal protein L10
 gi|227453210|gb|ACP31963.1| 50S ribosomal protein L10 [Corynebacterium aurimucosum ATCC 700975]
          Length = 173

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 47/165 (28%), Positives = 86/165 (52%), Gaps = 6/165 (3%)

Query: 7   SVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVK--VAKNRLVKIAIRD 64
           + +++ L +    + SIV+  Y+G++V Q+++LR  +   G  V+  VAKN L KIA  +
Sbjct: 7   TADLAALKEKLEGANSIVLTEYRGLTVGQLQELRNNL---GFDVEYSVAKNTLFKIAANE 63

Query: 65  TSIRGISDLFVGQSLIVY-SDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQI 123
             I G+ +   G + I +     V A K+   F++DN    + GG ++   L+ D ++ I
Sbjct: 64  AGIEGLDEHLTGPTAIAFIKGEAVDAAKVITKFADDNKALVIKGGYMDGNALSADQVEAI 123

Query: 124 ASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDK 168
           A L + E   A +  A++ +  +   +   P T++VR  +A  DK
Sbjct: 124 AKLDNRETTLAKLAGAMKGSMAKAAAVFNAPATKMVRTAAALQDK 168


>gi|300725141|ref|YP_003714469.1| 50S ribosomal subunit protein L10 [Xenorhabdus nematophila ATCC
           19061]
 gi|297631686|emb|CBJ92399.1| 50S ribosomal subunit protein L10 [Xenorhabdus nematophila ATCC
           19061]
          Length = 165

 Score = 78.2 bits (191), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 47/159 (29%), Positives = 89/159 (55%), Gaps = 2/159 (1%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           +N Q K   ++E+S++   + S VVA  +G++V ++ +LRK  REAG  V+V +N L++ 
Sbjct: 3   LNLQDKQAIVAEVSEVAKGALSAVVADSRGVTVDKMTELRKACREAGVNVRVVRNTLLRR 62

Query: 61  AIRDTSIRGISDLFVGQSLIVY-SDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
           A+  T    + + FVG +LI + S+ P  A ++   F+  N  F +     E   +   +
Sbjct: 63  AVEGTEYECLKEAFVGPTLIAFSSEHPGAAARLFKDFAKANPAFEIKAAAFEGEFIPGSN 122

Query: 120 IKQIASLPDLEGIRAGIISAI-QSNATRLVRLLGTPQTQ 157
           I ++A+LP  +   A +++ + +++A +LVR L   + Q
Sbjct: 123 IDRLATLPTYDEAIARLMATMKEASAGKLVRTLAALRDQ 161


>gi|260893760|ref|YP_003239857.1| ribosomal protein L10 [Ammonifex degensii KC4]
 gi|260865901|gb|ACX53007.1| ribosomal protein L10 [Ammonifex degensii KC4]
          Length = 176

 Score = 78.2 bits (191), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 47/170 (27%), Positives = 88/170 (51%), Gaps = 1/170 (0%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           + R  K   ++EL +    + ++ VA + GI VAQ+ +LR+++R     +KVAKN L++I
Sbjct: 3   LARAQKQEIVAELKEKLREAKAVFVADHTGIPVAQLTELRRRLRSNQSQLKVAKNTLIRI 62

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDS-PVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
           A ++  +  +     G   + +S + P +  KI   F+ +     + GGV+ K  L  D 
Sbjct: 63  AAQEVGLEELVPFLKGPVSLAFSFADPAVTAKILADFNKEYKLLEIKGGVLGKKALTPDQ 122

Query: 120 IKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKN 169
           +K +A LP  E +   ++  +++    LV +L  P  ++V A+ A  +K 
Sbjct: 123 VKALADLPPYEVLIGKVVGGMKAPLYGLVGILSGPIRKLVYALEAIREKQ 172


>gi|312864294|ref|ZP_07724528.1| ribosomal protein L10 [Streptococcus vestibularis F0396]
 gi|322372458|ref|ZP_08046994.1| ribosomal protein L10 [Streptococcus sp. C150]
 gi|311100295|gb|EFQ58504.1| ribosomal protein L10 [Streptococcus vestibularis F0396]
 gi|321277500|gb|EFX54569.1| ribosomal protein L10 [Streptococcus sp. C150]
          Length = 167

 Score = 78.2 bits (191), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 49/168 (29%), Positives = 90/168 (53%), Gaps = 12/168 (7%)

Query: 6   KSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDT 65
           K+ +++ +++   ++ SIVV   +G++V Q   LR+ +RE+G   KV KN ++  A  + 
Sbjct: 9   KAEQVAIVAEKMKAAASIVVVDSRGLTVDQDTVLRRNLRESGVEFKVIKNSILSRAAEEA 68

Query: 66  SIRGISDLFVGQSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIA 124
            +  + +LFVG S + +S+  VIAP K+   F+ D     + GGVV+    + + I  +A
Sbjct: 69  GLEDLKELFVGPSAVAFSNEDVIAPAKVISEFAKDAEALEIKGGVVDGAFTSVEEINALA 128

Query: 125 SLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQQG 172
           SLP+ EG+ + ++S +Q+           P   V  A+ A  +  + G
Sbjct: 129 SLPNKEGMLSMLLSVLQA-----------PVRNVAYAVKAVAESKEDG 165


>gi|253577168|ref|ZP_04854488.1| ribosomal protein L10 [Paenibacillus sp. oral taxon 786 str. D14]
 gi|251843412|gb|EES71440.1| ribosomal protein L10 [Paenibacillus sp. oral taxon 786 str. D14]
          Length = 170

 Score = 78.2 bits (191), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 49/140 (35%), Positives = 81/140 (57%), Gaps = 1/140 (0%)

Query: 4   QGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIR 63
           Q K   +  ++     S + VVA Y+G++VAQ+ +LRK++REAG   +V KN L++ A  
Sbjct: 11  QAKQEAVEAVTSKLRESATTVVADYRGLNVAQVTELRKQLREAGVEFQVLKNTLIRRATA 70

Query: 64  DTSIRGISDLFVGQSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQ 122
              +  + ++  G + I +S    +AP KI   F+  N+  +V GGVVE  V+  D IK 
Sbjct: 71  AAELTELDEVLTGPTAIAFSKEDAVAPAKILSEFAKKNDALKVKGGVVEGRVVGVDQIKA 130

Query: 123 IASLPDLEGIRAGIISAIQS 142
           +A LP  EG+ + ++S +Q+
Sbjct: 131 LADLPSREGLLSMLLSVLQA 150


>gi|238794961|ref|ZP_04638558.1| 50S ribosomal protein L10 [Yersinia intermedia ATCC 29909]
 gi|238725719|gb|EEQ17276.1| 50S ribosomal protein L10 [Yersinia intermedia ATCC 29909]
          Length = 167

 Score = 78.2 bits (191), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 48/159 (30%), Positives = 88/159 (55%), Gaps = 2/159 (1%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           +N QGK   ++E+ ++   + S VVA  +G++V ++ +LRK  REAG  ++V +N L+  
Sbjct: 3   LNLQGKQAIVAEVKEVAKGALSAVVADSRGVTVDKMTELRKAGREAGVHMQVVRNTLLCR 62

Query: 61  AIRDTSIRGISDLFVGQSLIVY-SDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
            +  T    + D FVG +LI + S+ P  A ++  +F+ +N +F V     E  ++    
Sbjct: 63  IVEGTQFECLKDTFVGPTLIAFSSEHPGAAARLFKAFAKENAKFEVKAAAFEGELIPAAQ 122

Query: 120 IKQIASLPDLEGIRAGIISAI-QSNATRLVRLLGTPQTQ 157
           I ++A+LP  E   A ++  + ++ A +LVR L   + Q
Sbjct: 123 IDRLATLPTYEEAIARLMGTMKEAAAGKLVRTLAALRDQ 161


>gi|167856582|ref|ZP_02479286.1| 50S ribosomal protein L7/L12 [Haemophilus parasuis 29755]
 gi|219871556|ref|YP_002475931.1| 50S ribosomal protein L10 [Haemophilus parasuis SH0165]
 gi|254798381|sp|B8F6N1|RL10_HAEPS RecName: Full=50S ribosomal protein L10
 gi|167852299|gb|EDS23609.1| 50S ribosomal protein L7/L12 [Haemophilus parasuis 29755]
 gi|219691760|gb|ACL32983.1| 50S ribosomal protein L10 [Haemophilus parasuis SH0165]
          Length = 163

 Score = 78.2 bits (191), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 53/177 (29%), Positives = 92/177 (51%), Gaps = 22/177 (12%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           +N Q K   ++E+++    + S VVA  +G++V ++ +LRK  REAG  ++V +N L++ 
Sbjct: 3   LNLQDKQAIVAEVNEAAKGALSAVVADSRGVTVEKMTELRKAAREAGVSMRVVRNTLLRR 62

Query: 61  AIRDTSIRGISDLFVGQSLIVYS-DSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
           A+  T    + D F G +LI +S + P  A ++   F+  N EF V G   E  +  QD 
Sbjct: 63  AVEGTEFECLKDTFTGPTLIAFSNEHPGAAARLFKDFAKANKEFEVKGAAFEGKI--QD- 119

Query: 120 IKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQT----QVVRAISAFVDKNQQG 172
           ++ +A+LP  E                + RL+GT +     ++VR ++A  DK Q+ 
Sbjct: 120 VEFLATLPTYE--------------EAIARLMGTMKEAAAGKLVRTLAALRDKLQEA 162


>gi|170718518|ref|YP_001783393.1| 50S ribosomal protein L10 [Haemophilus somnus 2336]
 gi|189040919|sp|B0UUZ6|RL10_HAES2 RecName: Full=50S ribosomal protein L10
 gi|168826647|gb|ACA32018.1| ribosomal protein L10 [Haemophilus somnus 2336]
          Length = 163

 Score = 78.2 bits (191), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 49/177 (27%), Positives = 94/177 (53%), Gaps = 22/177 (12%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           +N Q K   ++E+++    + S V+A  +G++V ++ +LRK  REAG  ++V +N L++ 
Sbjct: 3   LNLQDKQAIVAEVNEAAKGALSAVIADSRGVTVDKMTELRKAAREAGVSMRVVRNTLLRR 62

Query: 61  AIRDTSIRGISDLFVGQSLIVYS-DSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
           A+  T    ++D FVG +LI +S + P  A ++   F+  N++F + G   E  + N   
Sbjct: 63  AVEGTDFECLTDTFVGPTLIAFSNEHPGAAARLFKDFAKANDKFEIKGAAFEGKIQN--- 119

Query: 120 IKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQT----QVVRAISAFVDKNQQG 172
           ++ +A+LP  E                + RL+GT +     ++ R ++A+ DK Q+ 
Sbjct: 120 VEFLATLPTYE--------------EAIARLMGTMKEAAAGKLARTLAAYRDKLQEA 162


>gi|296137523|ref|YP_003644765.1| ribosomal protein L10 [Thiomonas intermedia K12]
 gi|294341868|emb|CAZ90297.1| 50S ribosomal subunit protein L10 [Thiomonas sp. 3As]
 gi|295797645|gb|ADG32435.1| ribosomal protein L10 [Thiomonas intermedia K12]
          Length = 165

 Score = 78.2 bits (191), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 47/152 (30%), Positives = 82/152 (53%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           +NR  K   + E+S + + + S+V+A Y+GI+V Q+  LRK+ RE G  ++V KN L K 
Sbjct: 3   LNRSEKQASVEEISALAAKAQSLVLAEYRGIAVEQMTKLRKQARENGVHLQVFKNTLAKR 62

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A+  TS   I+    G  +  +S+  V A ++   F+  N++  +  GVV    L+   +
Sbjct: 63  AVSGTSCEVIAGEMAGPLIYGFSEDAVAAARVINDFAKTNDKLVIRSGVVNGKALDAAGV 122

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLG 152
           K +AS+P  E + A ++  +Q+  +     LG
Sbjct: 123 KTLASIPSREVLLARLLGVMQAPVSGFAVALG 154


>gi|322517230|ref|ZP_08070109.1| 50S ribosomal protein L10 [Streptococcus vestibularis ATCC 49124]
 gi|322124136|gb|EFX95670.1| 50S ribosomal protein L10 [Streptococcus vestibularis ATCC 49124]
          Length = 180

 Score = 78.2 bits (191), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 49/168 (29%), Positives = 90/168 (53%), Gaps = 12/168 (7%)

Query: 6   KSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDT 65
           K+ +++ +++   ++ SIVV   +G++V Q   LR+ +RE+G   KV KN ++  A  + 
Sbjct: 22  KAEQVAIVAEKMKAAASIVVVDSRGLTVDQDTVLRRNLRESGVEFKVIKNSILSRAAEEA 81

Query: 66  SIRGISDLFVGQSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIA 124
            +  + +LFVG S + +S+  VIAP K+   F+ D     + GGVV+    + + I  +A
Sbjct: 82  GLEDLKELFVGPSAVAFSNEDVIAPAKVISEFAKDAEALEIKGGVVDGAFTSVEEINALA 141

Query: 125 SLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQQG 172
           SLP+ EG+ + ++S +Q+           P   V  A+ A  +  + G
Sbjct: 142 SLPNKEGMLSMLLSVLQA-----------PVRNVAYAVKAVAESKEDG 178


>gi|310829148|ref|YP_003961505.1| ribosomal protein L10 [Eubacterium limosum KIST612]
 gi|308740882|gb|ADO38542.1| ribosomal protein L10 [Eubacterium limosum KIST612]
          Length = 175

 Score = 78.2 bits (191), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 45/168 (26%), Positives = 88/168 (52%), Gaps = 1/168 (0%)

Query: 2   NRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIA 61
           N + K   + E++    ++   VV  Y+G++V ++ +LRKK RE     KV KN +++ A
Sbjct: 3   NIEAKQAIVQEIADKMKNAQGTVVVDYRGLNVEEVTELRKKARENNIDYKVYKNSMMRFA 62

Query: 62  IRDTSIRGISDLFVGQSLIVYS-DSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
            ++  + G+ D+ VG + I +  D PV   K+   F+ ++    +  GVVE  VL+   +
Sbjct: 63  AKEAGVEGLLDVLVGPTAIAFCEDDPVAPAKLINDFAGEHKALEIKAGVVEGKVLDVAGV 122

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDK 168
           K++A LP  E + A ++  + +  +    +L      +V A++A  ++
Sbjct: 123 KELAELPPREVLVAKVLGGLNAPISGFANVLNANLKGLVVALNAIAEQ 170


>gi|296138483|ref|YP_003645726.1| ribosomal protein L10 [Tsukamurella paurometabola DSM 20162]
 gi|296026617|gb|ADG77387.1| ribosomal protein L10 [Tsukamurella paurometabola DSM 20162]
          Length = 176

 Score = 78.2 bits (191), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 55/169 (32%), Positives = 88/169 (52%), Gaps = 2/169 (1%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M    K   ++E+++ FS S + VV  Y+G+SV  I +LR+ +  AG    VAKN LVK 
Sbjct: 1   MANPEKVAAVAEIAEQFSKSTATVVTEYRGLSVGSITELRRSLG-AGTTYSVAKNTLVKR 59

Query: 61  AIRDTSIRGISDLFVGQSLIVYSD-SPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
           A  D  + G+ +LF G + I + +  PV A K    F+ DN    + GG ++   L+   
Sbjct: 60  AAADAGVVGLDELFEGPTAIAFIEGEPVDAAKAIKKFAKDNKALVIKGGYMDGKALSVAE 119

Query: 120 IKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDK 168
           +++IA L   E + A +  A++ N  +   L   P +QV R  +A  +K
Sbjct: 120 VERIADLESREVLLAKLAGAMKGNLAKAAGLFNAPASQVARLAAALQEK 168


>gi|34499650|ref|NP_903865.1| 50S ribosomal protein L10 [Chromobacterium violaceum ATCC 12472]
 gi|61215233|sp|Q7NQE4|RL10_CHRVO RecName: Full=50S ribosomal protein L10
 gi|34105500|gb|AAQ61855.1| 50S ribosomal protein L10 [Chromobacterium violaceum ATCC 12472]
          Length = 164

 Score = 78.2 bits (191), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 47/172 (27%), Positives = 88/172 (51%), Gaps = 11/172 (6%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           +N + K   ++E+S   + + ++V+A Y+GI V+ +  LR + RE G  ++V KN LV+ 
Sbjct: 3   LNIEDKKAVVAEVSAQLAEAQTLVIAEYRGIEVSSMTKLRAQARENGVYLRVLKNTLVRR 62

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A+  T   G++D  VG  +   S  PV A K+   F+  +++  V  G  +  VLN   +
Sbjct: 63  AVEGTPFAGLADQMVGPLVYAVSADPVAAAKVLHQFAKADDKIIVKAGSYDGQVLNAAQV 122

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQQG 172
            ++AS+P  E +            ++L+ ++  P     RA++A  +K  + 
Sbjct: 123 AELASIPSREELL-----------SKLLYVMQAPVAGFARALAALAEKQAEA 163


>gi|121534749|ref|ZP_01666570.1| ribosomal protein L10 [Thermosinus carboxydivorans Nor1]
 gi|121306769|gb|EAX47690.1| ribosomal protein L10 [Thermosinus carboxydivorans Nor1]
          Length = 176

 Score = 78.2 bits (191), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 45/145 (31%), Positives = 84/145 (57%), Gaps = 3/145 (2%)

Query: 10  ISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRG 69
           ++EL +  +++   V+ +Y+G++VAQ   LR+K+REAG   +V KN L +IA ++  + G
Sbjct: 11  VAELKEKLANTKGAVITNYRGLTVAQDTKLRRKLREAGVEYRVVKNTLTRIAAKEVGLEG 70

Query: 70  ISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVL---GGVVEKGVLNQDSIKQIASL 126
           +     G + I  S +  +AP   +S     N+ +V+    G+VE  V++ D +K +A+L
Sbjct: 71  LEPYLEGPTAIAMSYNDPVAPAKVISDFIKENKLQVMEIKAGLVEGKVIDVDGVKALANL 130

Query: 127 PDLEGIRAGIISAIQSNATRLVRLL 151
           P  E + A +++ +Q+    LV +L
Sbjct: 131 PPREVLIAQVLAGMQAPIAGLVNVL 155


>gi|90581315|ref|ZP_01237112.1| 50S ribosomal protein L10 [Vibrio angustum S14]
 gi|90437554|gb|EAS62748.1| 50S ribosomal protein L10 [Vibrio angustum S14]
          Length = 164

 Score = 78.2 bits (191), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 50/159 (31%), Positives = 88/159 (55%), Gaps = 5/159 (3%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           +N Q K   ++E+++  + + S VVA  +G++V  +  LRK+ REAG  VKV +N L + 
Sbjct: 3   LNLQDKKAIVAEVNEAANGALSAVVADSRGVTVGAMTTLRKQAREAGVYVKVVRNTLARR 62

Query: 61  AIRDTSIRGISDLFVGQSLIVYS-DSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
           A+  T    + D+FVG SLI +S + P  A ++   F+ +N +F +     E  V N   
Sbjct: 63  AVEGTDFECLQDVFVGPSLIGFSNEHPGAAARLFKDFAKENKDFEIKAAAFEGAVAN--- 119

Query: 120 IKQIASLPDL-EGIRAGIISAIQSNATRLVRLLGTPQTQ 157
           ++ +A+LP   E I   ++   +++A +LVR +   + Q
Sbjct: 120 VEVLATLPTYDEAIARLMMCMKEASAGKLVRTIAAVRDQ 158


>gi|222152939|ref|YP_002562116.1| 50S ribosomal protein L10 [Streptococcus uberis 0140J]
 gi|254798402|sp|B9DU77|RL10_STRU0 RecName: Full=50S ribosomal protein L10
 gi|222113752|emb|CAR41762.1| 50S ribosomal protein L10 [Streptococcus uberis 0140J]
          Length = 166

 Score = 78.2 bits (191), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 43/138 (31%), Positives = 82/138 (59%), Gaps = 1/138 (0%)

Query: 6   KSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDT 65
           K+ ++  +++   ++ SIVV   +G++V Q  +LR+ +RE+G   KV KN ++  A    
Sbjct: 9   KAEQVDLVAEKMKAAASIVVVDSRGLTVGQDTELRRSLRESGVEFKVIKNSILSRAAEQA 68

Query: 66  SIRGISDLFVGQSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIA 124
            +  + DLFVG S + +S+  V+AP KI   F+   +   + GG +E    +++ I+ +A
Sbjct: 69  GLGDMKDLFVGPSAVAFSNEDVVAPAKIINDFAKTADALEIKGGAIEGAASSKEDIQALA 128

Query: 125 SLPDLEGIRAGIISAIQS 142
           SLP+ EG+ + ++S +Q+
Sbjct: 129 SLPNREGMLSMLLSVLQA 146


>gi|113474158|ref|YP_720219.1| 50S ribosomal protein L10 [Trichodesmium erythraeum IMS101]
 gi|123057154|sp|Q119S8|RL10_TRIEI RecName: Full=50S ribosomal protein L10
 gi|110165206|gb|ABG49746.1| LSU ribosomal protein L10P [Trichodesmium erythraeum IMS101]
          Length = 190

 Score = 78.2 bits (191), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 56/169 (33%), Positives = 88/169 (52%), Gaps = 13/169 (7%)

Query: 17  FSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIR-DTSIRGISDLFV 75
            S S   +V +Y+G+SVA+I DLR+++   G    +AKN L+ IA++ D++ + + DL  
Sbjct: 19  LSESQLALVINYQGLSVAEITDLRRRLIPTGSICSIAKNTLMGIAVKEDSNWQPMEDLLA 78

Query: 76  GQSLIVYSDSPV-IAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASLPDLEGIRA 134
           G +  ++  + +  A K    F     +    GGV+E  +L++D +K IA LP  E + A
Sbjct: 79  GSNAFLFLKNDIGGAIKAYQDFQKATKKTEFKGGVMEGRLLDKDQVKAIADLPSKEELLA 138

Query: 135 GIISAIQSNATRLVRLLGTPQTQVV-----------RAISAFVDKNQQG 172
            +  AI + AT+L   L    TQ+            RAI A  DK QQG
Sbjct: 139 QVAGAINNIATKLAISLDAVPTQLATGINEVPASVNRAIKAISDKEQQG 187


>gi|71894435|ref|YP_278543.1| 50S ribosomal protein L10 [Mycoplasma synoviae 53]
 gi|97181766|sp|Q4A5Y9|RL10_MYCS5 RecName: Full=50S ribosomal protein L10
 gi|71851223|gb|AAZ43832.1| 50S ribosomal protein L10 [Mycoplasma synoviae 53]
          Length = 165

 Score = 78.2 bits (191), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 46/130 (35%), Positives = 77/130 (59%), Gaps = 3/130 (2%)

Query: 3   RQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAI 62
           +  K V +SE++   SS+ +I  A Y+G++VAQ+K++R + ++ G  +KV KNRL K+A 
Sbjct: 7   KLAKKVTVSEITNKISSAKAIAFAEYRGLTVAQLKEMRVEAKKVGVELKVYKNRLFKLAT 66

Query: 63  RDTSIRGISDLFVGQSLIVYS-DSPVIAPKISVSFSNDNNEFRVL-GGVVEKGVLNQDSI 120
            D     +S   VG ++  +S D  + A K+ V F+  + EF VL  G  E  V++   +
Sbjct: 67  -DKLGYDLSSFLVGANIFAFSNDDDMSAAKLLVKFAKKHKEFVVLKAGTFEGKVVDTQEL 125

Query: 121 KQIASLPDLE 130
           K++A+LP  E
Sbjct: 126 KKVAALPSYE 135


>gi|255527832|ref|ZP_05394681.1| ribosomal protein L10 [Clostridium carboxidivorans P7]
 gi|296187256|ref|ZP_06855652.1| ribosomal protein L10 [Clostridium carboxidivorans P7]
 gi|255508473|gb|EET84864.1| ribosomal protein L10 [Clostridium carboxidivorans P7]
 gi|296048127|gb|EFG87565.1| ribosomal protein L10 [Clostridium carboxidivorans P7]
          Length = 166

 Score = 78.2 bits (191), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 43/151 (28%), Positives = 82/151 (54%), Gaps = 1/151 (0%)

Query: 2   NRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIA 61
           NRQ K  ++SE+ +    +  I+ A Y+G++V +   LR K+REAG   KV KN L  +A
Sbjct: 4   NRQLKEAKVSEIKEKMEKAQGIIFAQYQGLTVEEDTVLRSKLREAGVEYKVYKNTLTTLA 63

Query: 62  IRDTSIRGISDLFVGQSLIVYS-DSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
            ++  +  I  +  G   + +  + P    +I   F+ D+ +  + GG+V+  + + D +
Sbjct: 64  AKELGLGEIESVLQGPLSVAFGYEDPTAPARILNDFAKDHKKLELKGGIVQGEIFDVDKV 123

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLL 151
           KQ+A++P  E + A ++ + ++  + L  LL
Sbjct: 124 KQLATIPPKEVLIAKLLGSFKAPLSNLAYLL 154


>gi|306833683|ref|ZP_07466810.1| 50S ribosomal protein L10 [Streptococcus bovis ATCC 700338]
 gi|304424453|gb|EFM27592.1| 50S ribosomal protein L10 [Streptococcus bovis ATCC 700338]
          Length = 167

 Score = 78.2 bits (191), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 44/138 (31%), Positives = 81/138 (58%), Gaps = 1/138 (0%)

Query: 6   KSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDT 65
           K+ ++  +++   ++ SIVV   +G++V Q   LR+ +RE+G   KV KN ++  A    
Sbjct: 9   KAEQVEAVAEKMKAAASIVVVDSRGLTVEQDTVLRRNLRESGVEFKVIKNSILTRAAEKA 68

Query: 66  SIRGISDLFVGQSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIA 124
            +  + DLFVG S + +S+  V+AP KI   F+ D     + GG +E  V +++ I  +A
Sbjct: 69  GLGDMKDLFVGPSAVAFSNEDVVAPAKIINDFAKDAEALEIKGGAIEGSVSSKEEILALA 128

Query: 125 SLPDLEGIRAGIISAIQS 142
           +LP+ EG+ + ++S +Q+
Sbjct: 129 TLPNREGLLSMLLSVLQA 146


>gi|331091898|ref|ZP_08340730.1| hypothetical protein HMPREF9477_01373 [Lachnospiraceae bacterium
           2_1_46FAA]
 gi|330402797|gb|EGG82364.1| hypothetical protein HMPREF9477_01373 [Lachnospiraceae bacterium
           2_1_46FAA]
          Length = 178

 Score = 78.2 bits (191), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 44/131 (33%), Positives = 72/131 (54%), Gaps = 1/131 (0%)

Query: 22  SIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRGISDLFVGQSLIV 81
           S V+  Y+G++VA+  +LRK++REAG   KV KN ++K A   T   G+ +   G S + 
Sbjct: 23  SAVLVDYRGLTVAEDTELRKQLREAGVIYKVCKNTMMKRAFEGTEFAGLEEYLEGPSALA 82

Query: 82  YSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASLPDLEGIRAGIISAI 140
            S     AP +I   F+ D     V GGVVE  V +   I++++ +P  E + + ++ +I
Sbjct: 83  ISKDDATAPARILCKFAKDAKALEVKGGVVEGAVYDVAGIQELSKIPSREELLSKLLGSI 142

Query: 141 QSNATRLVRLL 151
           QS  T   R++
Sbjct: 143 QSPITNFARVI 153


>gi|153864726|ref|ZP_01997528.1| Ribosomal protein L10 [Beggiatoa sp. SS]
 gi|152145777|gb|EDN72470.1| Ribosomal protein L10 [Beggiatoa sp. SS]
          Length = 178

 Score = 78.2 bits (191), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 46/163 (28%), Positives = 90/163 (55%), Gaps = 1/163 (0%)

Query: 10  ISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRG 69
           ++ ++ + +++ S VVA Y+G++ A++  LR+  R  G  ++V +N L + AI +T    
Sbjct: 12  VASVNDVANTAHSAVVAEYRGMTCAEMTQLRQNARGTGVYLRVVRNTLARRAILNTHFEC 71

Query: 70  ISDLFVGQSLIVYS-DSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASLPD 128
           + ++ VG  ++ +S + P  A ++   F+  NN+  V G  +    L+ + I  +A+LP 
Sbjct: 72  LQEILVGPVVLAFSVEEPSAAARLIGHFAKSNNKLVVKGIALGGQRLSANEIDFVATLPT 131

Query: 129 LEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQQ 171
                + ++S IQ+  T+LVR L  P  ++VR  +A  D  Q+
Sbjct: 132 KNEAISQLMSVIQAPLTQLVRTLKEPSAKLVRTFAAVRDSKQE 174


>gi|298346151|ref|YP_003718838.1| 50S ribosomal protein L10 [Mobiluncus curtisii ATCC 43063]
 gi|304390089|ref|ZP_07372043.1| 50S ribosomal protein L10 [Mobiluncus curtisii subsp. curtisii ATCC
           35241]
 gi|315654730|ref|ZP_07907636.1| 50S ribosomal protein L10 [Mobiluncus curtisii ATCC 51333]
 gi|315657346|ref|ZP_07910228.1| 50S ribosomal protein L10 [Mobiluncus curtisii subsp. holmesii ATCC
           35242]
 gi|298236212|gb|ADI67344.1| 50S ribosomal protein L10 [Mobiluncus curtisii ATCC 43063]
 gi|304326571|gb|EFL93815.1| 50S ribosomal protein L10 [Mobiluncus curtisii subsp. curtisii ATCC
           35241]
 gi|315491194|gb|EFU80813.1| 50S ribosomal protein L10 [Mobiluncus curtisii ATCC 51333]
 gi|315491818|gb|EFU81427.1| 50S ribosomal protein L10 [Mobiluncus curtisii subsp. holmesii ATCC
           35242]
          Length = 173

 Score = 78.2 bits (191), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 50/176 (28%), Positives = 98/176 (55%), Gaps = 14/176 (7%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVK--VAKNRLV 58
           M R  K  ++  L+     S ++++  Y+G++V Q+K+LR  +   G  V+  VAKN+L 
Sbjct: 1   MARPDKVTDVQSLAASAKDSAAVILTEYRGLTVKQMKELRTSL---GTDVRYSVAKNKLA 57

Query: 59  KIAIRDTSIRGISDLFVGQSLIVY--SDSPVIA-PKISVSFSNDNNEFRVLGGVVEKGVL 115
           K+A+++  + G+ +  VG + I +  +D  V++  K   +F+ +N    +  G+++  +L
Sbjct: 58  KLAMKEAGLEGLDEYLVGPTAIAFVPADGDVVSVAKALDTFAKENKALVLKAGIMDGEIL 117

Query: 116 NQDSIKQIASLPDLEGI---RAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDK 168
           + D++K++ASL   E +    AG++ A+Q   TR   L     ++ VR I A+ +K
Sbjct: 118 DTDAVKKLASLESREVLLAKSAGLLKALQ---TRAAGLFQASASKTVRTIDAYREK 170


>gi|312915256|dbj|BAJ39230.1| 50S ribosomal protein L10 [Salmonella enterica subsp. enterica
           serovar Typhimurium str. T000240]
          Length = 165

 Score = 77.8 bits (190), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 47/154 (30%), Positives = 87/154 (56%), Gaps = 2/154 (1%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           +N Q K   ++E+S++   + S VVA  +G++V ++ +LRK  REAG  ++V +N L++ 
Sbjct: 3   LNLQDKQAIVAEVSEVAKGALSAVVADSRGVTVDKMTELRKAGREAGVYMRVVRNTLLRR 62

Query: 61  AIRDTSIRGISDLFVGQSLIVYS-DSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
            +  T    + + FVG +LI YS + P  A ++   F+  N +F V     E  ++    
Sbjct: 63  VVEGTQFECLKNTFVGPTLIAYSMEHPGAAARLFKEFAKANAKFEVKAAAFEGELIPASQ 122

Query: 120 IKQIASLPDLEGIRAGIISAI-QSNATRLVRLLG 152
           I ++A+LP  E   A +++ + +++A +LVR L 
Sbjct: 123 IDRLATLPTYEEAIARLMATMKEASAGKLVRTLA 156


>gi|297242996|ref|ZP_06926934.1| ribosomal protein L10 [Gardnerella vaginalis AMD]
 gi|296889207|gb|EFH27941.1| ribosomal protein L10 [Gardnerella vaginalis AMD]
          Length = 173

 Score = 77.8 bits (190), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 53/177 (29%), Positives = 88/177 (49%), Gaps = 10/177 (5%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKM-REAGGGVKVAKNRLVK 59
           M R  K   ++EL+++F ++ +I +  Y+G++V QI  LR+K+ R+      VAKN L +
Sbjct: 1   MKRPEKEAVVAELTELFRNADAIYLTEYRGLTVPQISTLREKLGRDT--SYSVAKNTLAR 58

Query: 60  IAIRDTSIRGISDLFVGQSLIVYSDSPVI-APKISVSFSNDNNEFRVLGGVVEKGVLNQD 118
           IA ++  I G+ +L  G + + +     I A K    F+ +N    + GG  +  V + +
Sbjct: 59  IAAKEAGIEGLDELLAGPTAVTFVKGDFIEAAKTLRDFAKENKALVIKGGFADGTVYDAE 118

Query: 119 SIKQIASL---PDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQQG 172
             KQ+A L   P L    AG +    S A  L   L    T+ VR I A  +K ++ 
Sbjct: 119 GAKQLADLKSRPQLLSEMAGALKGTMSKAACLFNAL---PTKAVRTIDALREKQEKA 172


>gi|309806524|ref|ZP_07700528.1| ribosomal protein L10 [Lactobacillus iners LactinV 03V1-b]
 gi|312873887|ref|ZP_07733925.1| ribosomal protein L10 [Lactobacillus iners LEAF 2052A-d]
 gi|325913140|ref|ZP_08175510.1| ribosomal protein L10 [Lactobacillus iners UPII 60-B]
 gi|308167123|gb|EFO69298.1| ribosomal protein L10 [Lactobacillus iners LactinV 03V1-b]
 gi|311090563|gb|EFQ48969.1| ribosomal protein L10 [Lactobacillus iners LEAF 2052A-d]
 gi|325477561|gb|EGC80703.1| ribosomal protein L10 [Lactobacillus iners UPII 60-B]
          Length = 166

 Score = 77.8 bits (190), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 43/136 (31%), Positives = 80/136 (58%), Gaps = 3/136 (2%)

Query: 10  ISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRG 69
           +   S+   ++ S++V  Y G++V ++  LRK++RE+   +KV KN  +K A     I G
Sbjct: 13  VDAFSEELKAAKSLLVVDYLGLTVDEVTSLRKELRESDVKMKVVKNTYLKRAAEKAGIEG 72

Query: 70  ISDLFVGQSLIVYSDSP--VIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASL 126
           + + F G S +VY+D+   +  P +I   ++ D     + GG++E  V +++ IKQIAS+
Sbjct: 73  LDETFSGPSAVVYTDNADDITEPARIVSKYAKDIEALSIKGGLLEGKVTSEEEIKQIASI 132

Query: 127 PDLEGIRAGIISAIQS 142
           P  EG+ + ++S +Q+
Sbjct: 133 PGREGLLSMLVSVLQA 148


>gi|119899715|ref|YP_934928.1| 50S ribosomal protein L10 [Azoarcus sp. BH72]
 gi|166229704|sp|A1KB36|RL10_AZOSB RecName: Full=50S ribosomal protein L10
 gi|119672128|emb|CAL96042.1| 50S ribosomal protein L10 [Azoarcus sp. BH72]
          Length = 167

 Score = 77.8 bits (190), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 44/142 (30%), Positives = 80/142 (56%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           +N   K   ++E+S   +++ +I VA Y+GI+V  +  LR K RE+G  ++V KN LV+ 
Sbjct: 3   LNLDDKKAVVAEVSAQVANAQTIAVAEYRGIAVGDLTALRAKARESGVYLRVLKNTLVRR 62

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           AI +T   G++D   G  +   S+ PV A K+   F+  N++  +  G     VL++  +
Sbjct: 63  AIAETPFAGLADQLTGPLIYGISEDPVAAAKVLNDFAKGNDKLVLKAGSYAGNVLDKAGV 122

Query: 121 KQIASLPDLEGIRAGIISAIQS 142
           + +AS+P  E + A ++  +Q+
Sbjct: 123 QALASIPSREELLAKLLGVMQA 144


>gi|212709024|ref|ZP_03317152.1| hypothetical protein PROVALCAL_00056 [Providencia alcalifaciens DSM
           30120]
 gi|212688313|gb|EEB47841.1| hypothetical protein PROVALCAL_00056 [Providencia alcalifaciens DSM
           30120]
          Length = 165

 Score = 77.8 bits (190), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 47/159 (29%), Positives = 89/159 (55%), Gaps = 2/159 (1%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           +N Q K   ++E+S++   + S VVA  +G++VA++ +LRK  REAG  ++V +N L++ 
Sbjct: 3   LNLQDKQAIVAEVSEVAKGALSAVVADSRGVTVAKMTELRKAGREAGVYIRVVRNTLIRR 62

Query: 61  AIRDTSIRGISDLFVGQSLIVYS-DSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
           A+  T+   + D FVG +LI +S + P    ++   F+  N  F +     E  ++    
Sbjct: 63  AVEGTAYDVLKDAFVGPTLIAFSNEHPGAGARLFKEFAKANPAFEIKAAAFEGELIQAKD 122

Query: 120 IKQIASLPDLEGIRAGIISAI-QSNATRLVRLLGTPQTQ 157
           I ++A+LP  +   A +++ + ++ A +LVR L   + Q
Sbjct: 123 IDRLATLPTYDEAIARLMATMKEAAAGKLVRTLAALRDQ 161


>gi|147676643|ref|YP_001210858.1| 50S ribosomal protein L10 [Pelotomaculum thermopropionicum SI]
 gi|189040925|sp|A5D5H8|RL10_PELTS RecName: Full=50S ribosomal protein L10
 gi|146272740|dbj|BAF58489.1| ribosomal protein L10 [Pelotomaculum thermopropionicum SI]
          Length = 175

 Score = 77.8 bits (190), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 42/142 (29%), Positives = 73/142 (51%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           + R  K   I EL + F  +   V+A Y+G++VA+   LR+++REAG   KVAKN L  +
Sbjct: 3   ITRAEKEAIIQELKEKFKEARVAVLADYRGLNVAEATRLRRRLREAGCEFKVAKNTLTGL 62

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A R   + G+     G   I +   PV   K+   F  +  +  +  GV+E  +++   +
Sbjct: 63  AARQAGLEGLDPYLEGPIAIAFGVDPVAPAKVLSDFIRETRKMEIKAGVLEGTIIDARRV 122

Query: 121 KQIASLPDLEGIRAGIISAIQS 142
           + +A LP  E + A ++  +Q+
Sbjct: 123 RDLADLPPREVLLARVLGGMQA 144


>gi|154503739|ref|ZP_02040799.1| hypothetical protein RUMGNA_01563 [Ruminococcus gnavus ATCC 29149]
 gi|153795839|gb|EDN78259.1| hypothetical protein RUMGNA_01563 [Ruminococcus gnavus ATCC 29149]
          Length = 181

 Score = 77.8 bits (190), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 44/143 (30%), Positives = 78/143 (54%), Gaps = 1/143 (0%)

Query: 10  ISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRG 69
           +  +S+    + S+V+  Y+G++VAQ  +LRKK+REAG   +V KN ++K A   T   G
Sbjct: 11  VEAISEELKGAQSVVLVDYRGLTVAQDTELRKKLREAGVTYRVYKNTMMKRAFEGTEFEG 70

Query: 70  ISDLFVGQSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASLPD 128
           +     G S I  S     AP +I   F+   ++  + GGVVE  V +  ++ ++A +P 
Sbjct: 71  LEGCLEGPSAIAISKEDATAPARILCEFAKGADKLELKGGVVEGTVYDVAALSELAKIPS 130

Query: 129 LEGIRAGIISAIQSNATRLVRLL 151
            E + + ++ ++QS  T   R++
Sbjct: 131 REVLLSRLLGSMQSPITNFARVI 153


>gi|330718914|ref|ZP_08313514.1| 50S ribosomal protein L10 [Leuconostoc fallax KCTC 3537]
          Length = 178

 Score = 77.8 bits (190), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 45/137 (32%), Positives = 79/137 (57%), Gaps = 1/137 (0%)

Query: 6   KSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDT 65
           K+ ++  +++ F +S S VV   +G++VAQ  DLR ++RE G  ++V KN+++  A    
Sbjct: 9   KAEKVEAVAEQFKNSASAVVVDTRGLTVAQSTDLRHQLREEGIVLEVIKNKVLTRAADKA 68

Query: 66  SIRGISDLFVGQSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIA 124
               ++D+FVG S + +S    +AP +I   F++ N    + GGVV+  V + D I + A
Sbjct: 69  GYGEMNDIFVGPSAVAFSSEDAVAPARILKKFADANEALEIKGGVVDGNVSDIDEINKYA 128

Query: 125 SLPDLEGIRAGIISAIQ 141
           SLP  EG+   +++  Q
Sbjct: 129 SLPSREGLFGQLLAEFQ 145


>gi|223041763|ref|ZP_03611956.1| 50S ribosomal protein L10 [Actinobacillus minor 202]
 gi|240948033|ref|ZP_04752450.1| 50S ribosomal protein L10 [Actinobacillus minor NM305]
 gi|223017447|gb|EEF15865.1| 50S ribosomal protein L10 [Actinobacillus minor 202]
 gi|240297649|gb|EER48126.1| 50S ribosomal protein L10 [Actinobacillus minor NM305]
          Length = 163

 Score = 77.8 bits (190), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 52/177 (29%), Positives = 91/177 (51%), Gaps = 22/177 (12%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           +N Q K   ++E+++    + S VVA  +G++V ++ +LRK  REAG  ++V +N L++ 
Sbjct: 3   LNLQDKQAIVAEVNEAAKGALSAVVADSRGVTVEKMTELRKSAREAGVTMRVVRNTLLRR 62

Query: 61  AIRDTSIRGISDLFVGQSLIVYS-DSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
           A+  T    + D F G +LI +S + P  A ++   F+  N EF + G   E  +  QD 
Sbjct: 63  AVEGTEFECLKDTFTGPTLIAFSHEHPGAAARLFTEFAKANKEFELKGAAFEGKI--QD- 119

Query: 120 IKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQT----QVVRAISAFVDKNQQG 172
           +  +A+LP  E                + RL+GT +     ++VR ++A  DK Q+ 
Sbjct: 120 VAFLATLPTYEEA--------------IARLMGTMKEAAAGKLVRTLAALRDKLQEA 162


>gi|291303403|ref|YP_003514681.1| 50S ribosomal protein L10 [Stackebrandtia nassauensis DSM 44728]
 gi|290572623|gb|ADD45588.1| ribosomal protein L10 [Stackebrandtia nassauensis DSM 44728]
          Length = 178

 Score = 77.8 bits (190), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 51/166 (30%), Positives = 88/166 (53%), Gaps = 2/166 (1%)

Query: 6   KSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDT 65
           K   ++EL++ F  S + V+  Y+G+SV Q+K LR+ + E G   +VAKN L K A  D 
Sbjct: 10  KVAAVTELTEKFRDSNATVLTEYRGLSVPQLKALRQALGE-GASYRVAKNTLAKRAASDA 68

Query: 66  SIRGISDLFVGQSLIVYSDSPVI-APKISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIA 124
            +  + + F G + + +    V+ A K    F+ DN    + GGV++   ++ D IK+IA
Sbjct: 69  GLSDLDEYFTGPTALTFVTGEVVDAAKALRDFAKDNEALVIKGGVMDGLPVSADEIKKIA 128

Query: 125 SLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQ 170
            L   E + + +  A++ + ++   L   P +QV R  +A  DK +
Sbjct: 129 DLDSREVLLSKMAGAMKGSMSKAAALFAAPASQVARMAAALRDKKE 174


>gi|269796266|ref|YP_003315721.1| 50S ribosomal protein L10P [Sanguibacter keddieii DSM 10542]
 gi|269098451|gb|ACZ22887.1| LSU ribosomal protein L10P [Sanguibacter keddieii DSM 10542]
          Length = 176

 Score = 77.8 bits (190), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 50/169 (29%), Positives = 83/169 (49%), Gaps = 2/169 (1%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M R  K+  ++EL+ +F  S + V+  Y+G++VAQ+K LR+ +        V KN L  I
Sbjct: 1   MARPDKAAAVAELTDLFRESNAAVLTEYRGLTVAQLKQLRRSL-SGNATYAVVKNTLTAI 59

Query: 61  AIRDTSIRGISDLFVGQSLIVY-SDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
           A ++  + G+     G S I + S  PV A K    F+  N +  +  GV++   L  + 
Sbjct: 60  AAKEAGVEGLDADLAGPSAIAFVSGDPVEAAKGLRDFAKANPQLVIKAGVLDGRPLTAED 119

Query: 120 IKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDK 168
           I ++A L   E + A    A +++  +   L   P +Q VR I A  +K
Sbjct: 120 INKLADLESREVLLAKAAGAFKASLFQAAYLFTAPASQAVRTIDALREK 168


>gi|259500950|ref|ZP_05743852.1| 50S ribosomal protein L10 [Lactobacillus iners DSM 13335]
 gi|315653969|ref|ZP_07906885.1| 50S ribosomal protein L10 [Lactobacillus iners ATCC 55195]
 gi|259167644|gb|EEW52139.1| 50S ribosomal protein L10 [Lactobacillus iners DSM 13335]
 gi|315488665|gb|EFU78311.1| 50S ribosomal protein L10 [Lactobacillus iners ATCC 55195]
          Length = 187

 Score = 77.8 bits (190), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 43/136 (31%), Positives = 80/136 (58%), Gaps = 3/136 (2%)

Query: 10  ISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRG 69
           +   S+   ++ S++V  Y G++V ++  LRK++RE+   +KV KN  +K A     I G
Sbjct: 34  VDAFSEELKAAKSLLVVDYLGLTVDEVTSLRKELRESDVKMKVVKNTYLKRAAEKAGIEG 93

Query: 70  ISDLFVGQSLIVYSDSP--VIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASL 126
           + + F G S +VY+D+   +  P +I   ++ D     + GG++E  V +++ IKQIAS+
Sbjct: 94  LDETFSGPSAVVYTDNADDITEPARIVSKYAKDIEALSIKGGLLEGRVTSEEEIKQIASI 153

Query: 127 PDLEGIRAGIISAIQS 142
           P  EG+ + ++S +Q+
Sbjct: 154 PGREGLLSMLVSVLQA 169


>gi|309778355|ref|ZP_07673280.1| ribosomal protein L10 [Erysipelotrichaceae bacterium 3_1_53]
 gi|313898205|ref|ZP_07831743.1| ribosomal protein L10 [Clostridium sp. HGF2]
 gi|308913886|gb|EFP59701.1| ribosomal protein L10 [Erysipelotrichaceae bacterium 3_1_53]
 gi|312956969|gb|EFR38599.1| ribosomal protein L10 [Clostridium sp. HGF2]
          Length = 173

 Score = 77.8 bits (190), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 41/133 (30%), Positives = 76/133 (57%)

Query: 10  ISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRG 69
           +SE+++    S S VV  Y+G+SVA++ +LR+ +RE G   KV KN L + A  +     
Sbjct: 13  VSEIAQKMKESQSTVVVEYRGLSVAEVTELRRNLREEGVEFKVYKNSLAQRAAVEAGADD 72

Query: 70  ISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASLPDL 129
           ++   +G + I +    V   ++   F+  +    +  G+VE  V+  D+IK+++SLP+ 
Sbjct: 73  LTKDLIGPNAIAFGGDAVAPARVLAKFAKKHEHLVLKSGIVEGKVVGVDTIKELSSLPNR 132

Query: 130 EGIRAGIISAIQS 142
           EG+ + ++S +QS
Sbjct: 133 EGMLSMLLSCLQS 145


>gi|302190598|ref|ZP_07266852.1| 50S ribosomal protein L10 [Lactobacillus iners AB-1]
 gi|309803798|ref|ZP_07697884.1| ribosomal protein L10 [Lactobacillus iners LactinV 11V1-d]
 gi|309804660|ref|ZP_07698725.1| ribosomal protein L10 [Lactobacillus iners LactinV 09V1-c]
 gi|309808526|ref|ZP_07702425.1| ribosomal protein L10 [Lactobacillus iners LactinV 01V1-a]
 gi|309809232|ref|ZP_07703102.1| ribosomal protein L10 [Lactobacillus iners SPIN 2503V10-D]
 gi|312871547|ref|ZP_07731640.1| ribosomal protein L10 [Lactobacillus iners LEAF 3008A-a]
 gi|312872594|ref|ZP_07732662.1| ribosomal protein L10 [Lactobacillus iners LEAF 2062A-h1]
 gi|312874775|ref|ZP_07734794.1| ribosomal protein L10 [Lactobacillus iners LEAF 2053A-b]
 gi|325912410|ref|ZP_08174805.1| ribosomal protein L10 [Lactobacillus iners UPII 143-D]
 gi|329920402|ref|ZP_08277134.1| ribosomal protein L10 [Lactobacillus iners SPIN 1401G]
 gi|308164207|gb|EFO66468.1| ribosomal protein L10 [Lactobacillus iners LactinV 11V1-d]
 gi|308166052|gb|EFO68270.1| ribosomal protein L10 [Lactobacillus iners LactinV 09V1-c]
 gi|308168354|gb|EFO70473.1| ribosomal protein L10 [Lactobacillus iners LactinV 01V1-a]
 gi|308170466|gb|EFO72489.1| ribosomal protein L10 [Lactobacillus iners SPIN 2503V10-D]
 gi|311089520|gb|EFQ47945.1| ribosomal protein L10 [Lactobacillus iners LEAF 2053A-b]
 gi|311091956|gb|EFQ50332.1| ribosomal protein L10 [Lactobacillus iners LEAF 2062A-h1]
 gi|311092942|gb|EFQ51293.1| ribosomal protein L10 [Lactobacillus iners LEAF 3008A-a]
 gi|325475752|gb|EGC78923.1| ribosomal protein L10 [Lactobacillus iners UPII 143-D]
 gi|328936078|gb|EGG32531.1| ribosomal protein L10 [Lactobacillus iners SPIN 1401G]
          Length = 166

 Score = 77.8 bits (190), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 43/136 (31%), Positives = 80/136 (58%), Gaps = 3/136 (2%)

Query: 10  ISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRG 69
           +   S+   ++ S++V  Y G++V ++  LRK++RE+   +KV KN  +K A     I G
Sbjct: 13  VDAFSEELKAAKSLLVVDYLGLTVDEVTSLRKELRESDVKMKVVKNTYLKRAAEKAGIEG 72

Query: 70  ISDLFVGQSLIVYSDSP--VIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASL 126
           + + F G S +VY+D+   +  P +I   ++ D     + GG++E  V +++ IKQIAS+
Sbjct: 73  LDETFSGPSAVVYTDNADDITEPARIVSKYAKDIEALSIKGGLLEGRVTSEEEIKQIASI 132

Query: 127 PDLEGIRAGIISAIQS 142
           P  EG+ + ++S +Q+
Sbjct: 133 PGREGLLSMLVSVLQA 148


>gi|15640353|ref|NP_229980.1| 50S ribosomal protein L10 [Vibrio cholerae O1 biovar El Tor str.
           N16961]
 gi|121591010|ref|ZP_01678328.1| ribosomal protein L10 [Vibrio cholerae 2740-80]
 gi|121728868|ref|ZP_01681877.1| ribosomal protein L10 [Vibrio cholerae V52]
 gi|147674689|ref|YP_001218594.1| 50S ribosomal protein L10 [Vibrio cholerae O395]
 gi|153216327|ref|ZP_01950405.1| ribosomal protein L10 [Vibrio cholerae 1587]
 gi|153819681|ref|ZP_01972348.1| ribosomal protein L10 [Vibrio cholerae NCTC 8457]
 gi|153823151|ref|ZP_01975818.1| ribosomal protein L10 [Vibrio cholerae B33]
 gi|153827141|ref|ZP_01979808.1| ribosomal protein L10 [Vibrio cholerae MZO-2]
 gi|153831461|ref|ZP_01984128.1| ribosomal protein L10 [Vibrio cholerae 623-39]
 gi|227080538|ref|YP_002809089.1| ribosomal protein L10 [Vibrio cholerae M66-2]
 gi|229506879|ref|ZP_04396387.1| LSU ribosomal protein L10p (P0) [Vibrio cholerae BX 330286]
 gi|229508684|ref|ZP_04398178.1| LSU ribosomal protein L10p (P0) [Vibrio cholerae B33]
 gi|229512397|ref|ZP_04401872.1| LSU ribosomal protein L10p (P0) [Vibrio cholerae TMA 21]
 gi|229516066|ref|ZP_04405517.1| LSU ribosomal protein L10p (P0) [Vibrio cholerae RC9]
 gi|229519864|ref|ZP_04409297.1| LSU ribosomal protein L10p (P0) [Vibrio cholerae TM 11079-80]
 gi|229526888|ref|ZP_04416291.1| LSU ribosomal protein L10p (P0) [Vibrio cholerae bv. albensis
           VL426]
 gi|229527013|ref|ZP_04416409.1| LSU ribosomal protein L10p (P0) [Vibrio cholerae 12129(1)]
 gi|229606393|ref|YP_002877041.1| 50S ribosomal protein L10 [Vibrio cholerae MJ-1236]
 gi|254292042|ref|ZP_04962819.1| ribosomal protein L10 [Vibrio cholerae AM-19226]
 gi|254851635|ref|ZP_05240985.1| ribosomal protein L10 [Vibrio cholerae MO10]
 gi|255747127|ref|ZP_05421070.1| LSU ribosomal protein L10p (P0) [Vibrio cholera CIRS 101]
 gi|258620705|ref|ZP_05715740.1| 50S ribosomal protein L10 [Vibrio mimicus VM573]
 gi|258624490|ref|ZP_05719436.1| 50S ribosomal protein L10 [Vibrio mimicus VM603]
 gi|262149003|ref|ZP_06028148.1| LSU ribosomal protein L10p (P0) [Vibrio cholerae INDRE 91/1]
 gi|262163612|ref|ZP_06031355.1| LSU ribosomal protein L10p (P0) [Vibrio mimicus VM223]
 gi|262166947|ref|ZP_06034667.1| LSU ribosomal protein L10p (P0) [Vibrio cholerae RC27]
 gi|262172576|ref|ZP_06040254.1| LSU ribosomal protein L10p (P0) [Vibrio mimicus MB-451]
 gi|262401581|ref|ZP_06078148.1| LSU ribosomal protein L10p (P0) [Vibrio sp. RC586]
 gi|297582230|ref|ZP_06944146.1| ribosomal protein L10 [Vibrio cholerae RC385]
 gi|298501287|ref|ZP_07011084.1| ribosomal protein L10 [Vibrio cholerae MAK 757]
 gi|13959487|sp|Q9KV32|RL10_VIBCH RecName: Full=50S ribosomal protein L10
 gi|172047474|sp|A5F3P3|RL10_VIBC3 RecName: Full=50S ribosomal protein L10
 gi|254798409|sp|C3LR58|RL10_VIBCM RecName: Full=50S ribosomal protein L10
 gi|9654740|gb|AAF93499.1| ribosomal protein L10 [Vibrio cholerae O1 biovar El Tor str.
           N16961]
 gi|121547151|gb|EAX57281.1| ribosomal protein L10 [Vibrio cholerae 2740-80]
 gi|121628836|gb|EAX61296.1| ribosomal protein L10 [Vibrio cholerae V52]
 gi|124114322|gb|EAY33142.1| ribosomal protein L10 [Vibrio cholerae 1587]
 gi|126509769|gb|EAZ72363.1| ribosomal protein L10 [Vibrio cholerae NCTC 8457]
 gi|126519338|gb|EAZ76561.1| ribosomal protein L10 [Vibrio cholerae B33]
 gi|146316572|gb|ABQ21111.1| ribosomal protein L10 [Vibrio cholerae O395]
 gi|148873056|gb|EDL71191.1| ribosomal protein L10 [Vibrio cholerae 623-39]
 gi|149738969|gb|EDM53285.1| ribosomal protein L10 [Vibrio cholerae MZO-2]
 gi|150422028|gb|EDN13998.1| ribosomal protein L10 [Vibrio cholerae AM-19226]
 gi|227008426|gb|ACP04638.1| ribosomal protein L10 [Vibrio cholerae M66-2]
 gi|227012182|gb|ACP08392.1| ribosomal protein L10 [Vibrio cholerae O395]
 gi|229335536|gb|EEO01017.1| LSU ribosomal protein L10p (P0) [Vibrio cholerae 12129(1)]
 gi|229336057|gb|EEO01076.1| LSU ribosomal protein L10p (P0) [Vibrio cholerae bv. albensis
           VL426]
 gi|229343105|gb|EEO08090.1| LSU ribosomal protein L10p (P0) [Vibrio cholerae TM 11079-80]
 gi|229346969|gb|EEO11936.1| LSU ribosomal protein L10p (P0) [Vibrio cholerae RC9]
 gi|229350612|gb|EEO15557.1| LSU ribosomal protein L10p (P0) [Vibrio cholerae TMA 21]
 gi|229354319|gb|EEO19248.1| LSU ribosomal protein L10p (P0) [Vibrio cholerae B33]
 gi|229355984|gb|EEO20903.1| LSU ribosomal protein L10p (P0) [Vibrio cholerae BX 330286]
 gi|229369048|gb|ACQ59471.1| LSU ribosomal protein L10p (P0) [Vibrio cholerae MJ-1236]
 gi|254847340|gb|EET25754.1| ribosomal protein L10 [Vibrio cholerae MO10]
 gi|255735176|gb|EET90578.1| LSU ribosomal protein L10p (P0) [Vibrio cholera CIRS 101]
 gi|258583239|gb|EEW08042.1| 50S ribosomal protein L10 [Vibrio mimicus VM603]
 gi|258586903|gb|EEW11617.1| 50S ribosomal protein L10 [Vibrio mimicus VM573]
 gi|261893652|gb|EEY39638.1| LSU ribosomal protein L10p (P0) [Vibrio mimicus MB-451]
 gi|262024652|gb|EEY43333.1| LSU ribosomal protein L10p (P0) [Vibrio cholerae RC27]
 gi|262027979|gb|EEY46641.1| LSU ribosomal protein L10p (P0) [Vibrio mimicus VM223]
 gi|262031193|gb|EEY49812.1| LSU ribosomal protein L10p (P0) [Vibrio cholerae INDRE 91/1]
 gi|262352296|gb|EEZ01425.1| LSU ribosomal protein L10p (P0) [Vibrio sp. RC586]
 gi|297533531|gb|EFH72376.1| ribosomal protein L10 [Vibrio cholerae RC385]
 gi|297539978|gb|EFH76042.1| ribosomal protein L10 [Vibrio cholerae MAK 757]
 gi|327483192|gb|AEA77599.1| LSU ribosomal protein L10p (P0) [Vibrio cholerae LMA3894-4]
          Length = 162

 Score = 77.8 bits (190), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 51/159 (32%), Positives = 89/159 (55%), Gaps = 5/159 (3%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           +N Q K   ++E+++  S + S VVA  +G+ VA + +LRK+ REAG  +KV +N L + 
Sbjct: 3   LNLQDKKAIVAEVNEAASGALSAVVADSRGVQVAAMTNLRKQAREAGVYLKVVRNTLARR 62

Query: 61  AIRDTSIRGISDLFVGQSLIVYS-DSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
           A+  T+   + D+FVG +LI +S + P  A ++   F+ +N  F +     E GVL    
Sbjct: 63  AVEGTAYECLKDVFVGPTLIGFSNEHPGAAARLFKDFAKENKAFEIKAAAFE-GVLTDPE 121

Query: 120 IKQIASLPDL-EGIRAGIISAIQSNATRLVRLLGTPQTQ 157
           +  +A+LP   E I   ++   +++A +LVR +   + Q
Sbjct: 122 V--LATLPTYDEAIARLMMCMKEASAGKLVRTIAAVRDQ 158


>gi|163847743|ref|YP_001635787.1| 50S ribosomal protein L10 [Chloroflexus aurantiacus J-10-fl]
 gi|222525606|ref|YP_002570077.1| 50S ribosomal protein L10 [Chloroflexus sp. Y-400-fl]
 gi|189040910|sp|A9WFP8|RL10_CHLAA RecName: Full=50S ribosomal protein L10
 gi|254798370|sp|B9LI31|RL10_CHLSY RecName: Full=50S ribosomal protein L10
 gi|163669032|gb|ABY35398.1| ribosomal protein L10 [Chloroflexus aurantiacus J-10-fl]
 gi|222449485|gb|ACM53751.1| ribosomal protein L10 [Chloroflexus sp. Y-400-fl]
          Length = 182

 Score = 77.4 bits (189), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 51/167 (30%), Positives = 88/167 (52%), Gaps = 6/167 (3%)

Query: 10  ISELSKIFSSSGSIVVAHY----KGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDT 65
           +S L++  + +  +VVA Y    KG+SVA + +LR+K+RE GG V VAKN L+KIA  +T
Sbjct: 10  VSTLTEKLNRAQLVVVADYRGDGKGMSVADMTELRRKLREHGGEVVVAKNTLLKIAAHNT 69

Query: 66  SIRGISDLFVGQSLIV--YSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQI 123
               +  L  G + +   Y D   +A  +     + N  F V G ++   +L  D+++Q+
Sbjct: 70  GHEALDPLLAGPTAVTLGYDDVSKVAKALLDYLKSGNKSFTVRGALLGNTLLPADALEQV 129

Query: 124 ASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQ 170
             LP  E   A ++  I +  + +V +L    + V+  + A +D+ Q
Sbjct: 130 TKLPSREQALAQVVGGIAAPVSGVVGVLNAAISNVLYVLQARIDQLQ 176


>gi|307718198|ref|YP_003873730.1| 50S ribosomal protein L10 [Spirochaeta thermophila DSM 6192]
 gi|306531923|gb|ADN01457.1| 50S ribosomal protein L10 [Spirochaeta thermophila DSM 6192]
 gi|315186339|gb|EFU20100.1| ribosomal protein L10 [Spirochaeta thermophila DSM 6578]
          Length = 176

 Score = 77.4 bits (189), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 44/170 (25%), Positives = 84/170 (49%), Gaps = 2/170 (1%)

Query: 4   QGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIR 63
           + K   + E+ KI       + A Y+G++V QI  LR ++R+    +KV KNR  K+A  
Sbjct: 8   EKKRARVEEIKKILEEGKGYIFADYRGLTVEQITRLRNELRQQQAILKVVKNRFAKLAFS 67

Query: 64  DTSIRGISDLFVGQSLI-VYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQ 122
           +  I G+ ++ +G +++ V  + P +  K    + N+    +V  G ++  +     ++ 
Sbjct: 68  ELEITGLDEVLLGPTVVAVAKEDPAVVAKTIFKYVNE-TPIKVKAGYIDGQLYGAQQVEA 126

Query: 123 IASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQQG 172
           I+ LP    + A ++  + +    LV  L    T++VR + A  DK +QG
Sbjct: 127 ISKLPSRAELLATLMGTMNAPLQNLVYALNGVTTKLVRTLKALADKMEQG 176


>gi|254361436|ref|ZP_04977576.1| ribosomal protein L10 [Mannheimia haemolytica PHL213]
 gi|261491934|ref|ZP_05988511.1| ribosomal protein L10 [Mannheimia haemolytica serotype A2 str.
           BOVINE]
 gi|261496262|ref|ZP_05992667.1| ribosomal protein L10 [Mannheimia haemolytica serotype A2 str.
           OVINE]
 gi|153092946|gb|EDN73972.1| ribosomal protein L10 [Mannheimia haemolytica PHL213]
 gi|261308093|gb|EEY09391.1| ribosomal protein L10 [Mannheimia haemolytica serotype A2 str.
           OVINE]
 gi|261312401|gb|EEY13527.1| ribosomal protein L10 [Mannheimia haemolytica serotype A2 str.
           BOVINE]
          Length = 163

 Score = 77.4 bits (189), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 47/160 (29%), Positives = 87/160 (54%), Gaps = 5/160 (3%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           +N Q K   ++E+++    + S VVA  +G++V ++ +LRK  REAG  ++V +N L++ 
Sbjct: 3   LNLQDKQAIVAEVNEAAKGALSAVVADSRGVTVEKMTELRKAAREAGVTMQVVRNTLLRR 62

Query: 61  AIRDTSIRGISDLFVGQSLIVYS-DSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
           A+  T    ++D F G +LI +S + P  A ++   F+  N EF + G   E     +  
Sbjct: 63  AVEGTEFECLTDTFTGPTLIAFSNEHPGAAARLFTEFAKTNKEFELKGAAFEG---KKQD 119

Query: 120 IKQIASLPDLEGIRAGIISAI-QSNATRLVRLLGTPQTQV 158
           +  +A+LP  E   A ++  + ++ A +LVR L   + Q+
Sbjct: 120 VAFLATLPTYEEAIARLMGTMKEAAAGKLVRTLAALRDQM 159


>gi|330962534|gb|EGH62794.1| 50S ribosomal protein L10 [Pseudomonas syringae pv. maculicola str.
           ES4326]
          Length = 166

 Score = 77.4 bits (189), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 48/155 (30%), Positives = 84/155 (54%), Gaps = 1/155 (0%)

Query: 4   QGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIR 63
           + K   ++E+++   +  S VVA  +G++V+ +  LRK+ REAG  V+V +N L+K A+ 
Sbjct: 6   EDKKAIVAEVNEAAKAGLSAVVADARGVTVSAMTGLRKEAREAGVYVRVVRNTLLKRAVA 65

Query: 64  DTSIRGISDLFVGQSLIVYS-DSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQ 122
           DT    ++D+F G +LI +S + P  A ++   FS   ++F +     E   L  + I  
Sbjct: 66  DTEFSVLNDVFTGPTLIAFSNEHPGAAARLFKEFSKGQDKFEIKAAAFEGKFLAANQIDV 125

Query: 123 IASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQ 157
           +ASLP      + ++S IQ   ++L R L   + Q
Sbjct: 126 LASLPTRNEAISQLMSVIQGATSKLARTLAAVRDQ 160


>gi|297618395|ref|YP_003703554.1| ribosomal protein L10 [Syntrophothermus lipocalidus DSM 12680]
 gi|297146232|gb|ADI02989.1| ribosomal protein L10 [Syntrophothermus lipocalidus DSM 12680]
          Length = 174

 Score = 77.4 bits (189), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 46/162 (28%), Positives = 87/162 (53%), Gaps = 1/162 (0%)

Query: 10  ISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRG 69
           + +L   FS S   +   Y+G++VA++ +LR ++R+AG  +KV KN L + A+R+  +  
Sbjct: 11  VDDLKNRFSRSTVAIFTDYRGLTVAEMTELRNRLRKAGVELKVVKNTLARFALRECGLEE 70

Query: 70  ISDLFVGQSLIVYS-DSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASLPD 128
           +     G + +V+  + PV   KI   F  +  +  V  G++++ V+    I+ +A+LP 
Sbjct: 71  VEPHLEGPNAVVFGYEDPVEPAKIVNDFIKEFKKLEVKAGILDRRVIKVKDIESLAALPP 130

Query: 129 LEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQ 170
            E I A ++  +Q     LV +L    + + RAI+A  +K +
Sbjct: 131 KEVIIAMVLGGLQGPVRGLVYVLNANLSGLARAINAIKEKRE 172


>gi|238897915|ref|YP_002923594.1| 50S ribosomal subunit protein L10 [Candidatus Hamiltonella defensa
           5AT (Acyrthosiphon pisum)]
 gi|259645484|sp|C4K4F3|RL10_HAMD5 RecName: Full=50S ribosomal protein L10
 gi|229465672|gb|ACQ67446.1| 50S ribosomal subunit protein L10 [Candidatus Hamiltonella defensa
           5AT (Acyrthosiphon pisum)]
          Length = 165

 Score = 77.4 bits (189), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 47/154 (30%), Positives = 84/154 (54%), Gaps = 2/154 (1%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           +N Q K   + E+ +I   + S VVA  +G++VA++  LRK  REAG  ++V +N L++ 
Sbjct: 3   LNLQDKKAIVDEVKEIAKGALSAVVADTRGVTVAKMTGLRKAAREAGVYMRVVRNTLMRR 62

Query: 61  AIRDTSIRGISDLFVGQSLIVYS-DSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
            +  T    + D FVG +LI +S + P  A ++   F+  N EF +     E  ++    
Sbjct: 63  VVFSTDFECLQDTFVGPTLIAFSTEHPGAAARLFKEFAKLNKEFEIKAAAFEGTLIPVSD 122

Query: 120 IKQIASLPDLEGIRAGIISAI-QSNATRLVRLLG 152
           I ++A+LP  E   A +++ + +++  +LVR L 
Sbjct: 123 IDRLATLPTYEEAIARLMATLKEASVGKLVRTLA 156


>gi|37524446|ref|NP_927790.1| 50S ribosomal protein L10 [Photorhabdus luminescens subsp.
           laumondii TTO1]
 gi|61215228|sp|Q7N9A6|RL10_PHOLL RecName: Full=50S ribosomal protein L10
 gi|36783870|emb|CAE12732.1| 50S ribosomal subunit protein L10 [Photorhabdus luminescens subsp.
           laumondii TTO1]
          Length = 168

 Score = 77.4 bits (189), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 47/154 (30%), Positives = 87/154 (56%), Gaps = 2/154 (1%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           +N Q K   ++E+S++   + S VVA  +G++V ++ +LRK  REAG  ++V +N L++ 
Sbjct: 3   LNLQDKQAIVAEVSEVAKGALSAVVADSRGVTVDKMTELRKAGREAGVYIRVVRNTLIRR 62

Query: 61  AIRDTSIRGISDLFVGQSLIVYS-DSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
           A+  T+   + + FVG +LI +S + P  A ++   F+  N  F +     E   +   +
Sbjct: 63  AVEGTAYECLKEAFVGPTLIAFSNEHPGAAARLFKEFAKANPAFEIKAAAFEGEFIPAAN 122

Query: 120 IKQIASLPDLEGIRAGIISAI-QSNATRLVRLLG 152
           I ++A+LP  E   A ++S + ++ A +LVR L 
Sbjct: 123 IDRLATLPTYEEAIARLMSTMKEAVAGKLVRTLA 156


>gi|212634819|ref|YP_002311344.1| 50S ribosomal protein L10 [Shewanella piezotolerans WP3]
 gi|226700003|sp|B8CNC3|RL10_SHEPW RecName: Full=50S ribosomal protein L10
 gi|212556303|gb|ACJ28757.1| Ribosomal protein L10 [Shewanella piezotolerans WP3]
          Length = 165

 Score = 77.4 bits (189), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 48/156 (30%), Positives = 84/156 (53%), Gaps = 2/156 (1%)

Query: 4   QGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIR 63
           + K   ++E+++    + S VVA  +G++V  +  LRK  REAG  VKV +N LVK A+ 
Sbjct: 6   EDKKAIVAEVNEAAKGALSAVVADSRGVTVGDMTGLRKAAREAGVYVKVVRNTLVKRAVA 65

Query: 64  DTSIRGISDLFVGQSLIVYS-DSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQ 122
            T    ++D F G +LI +S + P  A ++   F+ +  +F +     E  ++  D+I +
Sbjct: 66  GTDFECLADTFTGPTLIAFSNEHPGAAARLLKDFAKEQEKFEIKAAAFEGELIPADNIDR 125

Query: 123 IASLPDLEGIRAGIISAI-QSNATRLVRLLGTPQTQ 157
           +A LP  E   A  +  + +++A +LVR L   + Q
Sbjct: 126 LAKLPTYEEALAQFMMTLKEASAGKLVRTLAALRDQ 161


>gi|132641|sp|P29343|RL10_STRAT RecName: Full=50S ribosomal protein L10
 gi|153437|gb|AAA26810.1| ribosomal protein L10 [Streptomyces antibioticus]
          Length = 176

 Score = 77.4 bits (189), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 54/168 (32%), Positives = 87/168 (51%), Gaps = 5/168 (2%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M R  K+  ++EL+  F SS + V+  Y+G++VAQ+K LR+ + E      V KN L KI
Sbjct: 1   MARPDKAAAVAELTDKFRSSNAAVLTEYRGLTVAQLKTLRRSLGE-NAQYAVVKNTLTKI 59

Query: 61  AIRDTSIRGISDLFVGQSLIVY-SDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
           A ++  I     LF G + + + +  PV + K    F+ +N    + GGV++   L+ D 
Sbjct: 60  AAKEAGITLEDQLFAGPTAVAFVTGDPVESAKGLRDFAKENPNLVIKGGVLDGKALSADE 119

Query: 120 IKQIASLPDLEGI---RAGIISAIQSNATRLVRLLGTPQTQVVRAISA 164
           IK++A L   E +    AG   A QS A  + + L +   + V A+ A
Sbjct: 120 IKKLADLESREVLLSKLAGAFKAKQSQAASVFQALPSKLVRTVDALRA 167


>gi|253987830|ref|YP_003039186.1| 50S ribosomal protein L10 [Photorhabdus asymbiotica subsp.
           asymbiotica ATCC 43949]
 gi|253779280|emb|CAQ82441.1| 50s ribosomal subunit protein l10 [Photorhabdus asymbiotica]
          Length = 165

 Score = 77.4 bits (189), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 46/154 (29%), Positives = 88/154 (57%), Gaps = 2/154 (1%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           +N Q K   ++E+S++   + S VVA  +G++V ++ +LRK  REAG  ++V +N L++ 
Sbjct: 3   LNLQDKQAIVAEVSEVAKGALSAVVADSRGVAVDKMTELRKAGREAGVYIRVVRNTLIRR 62

Query: 61  AIRDTSIRGISDLFVGQSLIVYS-DSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
           A+  T+   + + F+G +LI +S + P  A ++   F+  N  F +     E   ++  +
Sbjct: 63  AVEGTAYECLKEAFIGPTLIAFSNEHPGAAARLFKEFAKANPAFEIKAAAFEGEFISAAN 122

Query: 120 IKQIASLPDLEGIRAGIISAI-QSNATRLVRLLG 152
           I ++A+LP  E   A ++S + ++ A +LVR L 
Sbjct: 123 IDRLATLPTYEEAIARLMSTMKEAVAGKLVRTLA 156


>gi|257054439|ref|YP_003132271.1| 50S ribosomal protein L10P [Saccharomonospora viridis DSM 43017]
 gi|256584311|gb|ACU95444.1| LSU ribosomal protein L10P [Saccharomonospora viridis DSM 43017]
          Length = 181

 Score = 77.0 bits (188), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 52/171 (30%), Positives = 92/171 (53%), Gaps = 2/171 (1%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M +  K   ++E++  F +S + VV  Y G+SV+Q+ +LR+ +       +VAKN LVK 
Sbjct: 1   MAKPDKVAAVAEIADKFRNSSAAVVTQYSGLSVSQLNELRRALGNTAK-YRVAKNTLVKR 59

Query: 61  AIRDTSIRGISDLFVGQSLIVYSD-SPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
           A  +  + GI +LFVG + I + +  PV A K+   F+ DN+   + GG ++   L+   
Sbjct: 60  AAAEAGVEGIDELFVGPTAIAFVEGEPVEAAKVLRDFAKDNSALVIKGGYMDGAPLSVSE 119

Query: 120 IKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQ 170
           I++IA L   E + A    A+++  ++   L   P ++V R  +A  +K +
Sbjct: 120 IEKIADLESREVLLAKAAGAMKAKLSQAAALFQAPASKVARLSAALEEKRK 170


>gi|323358930|ref|YP_004225326.1| ribosomal protein L10 [Microbacterium testaceum StLB037]
 gi|323275301|dbj|BAJ75446.1| ribosomal protein L10 [Microbacterium testaceum StLB037]
          Length = 171

 Score = 77.0 bits (188), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 47/164 (28%), Positives = 83/164 (50%), Gaps = 2/164 (1%)

Query: 6   KSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDT 65
           K   ++EL+K F +S ++++  Y+G++VAQ+K LR  +R+      V KN L KIA  + 
Sbjct: 4   KDASVAELTKNFENSTAVLLTEYRGLTVAQLKQLRNDIRQ-DADYAVVKNTLTKIAAANA 62

Query: 66  SIRGISDLFVGQSLIVY-SDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIA 124
            + G+ D   G S I +    PV   K   +F+  N +  V GG  +   L  D + ++A
Sbjct: 63  GVTGLDDELKGPSAIAFVHGDPVAVAKGLRAFAKANPQLVVKGGYFDGAALTADEVNKLA 122

Query: 125 SLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDK 168
            L   E + A +  A+++  T+   +     ++ VR + A  +K
Sbjct: 123 DLESREVLLAKLAGAMKATMTKAAYVFQALPSKAVRTVDALREK 166


>gi|302877792|ref|YP_003846356.1| 50S ribosomal protein L10 [Gallionella capsiferriformans ES-2]
 gi|302580581|gb|ADL54592.1| ribosomal protein L10 [Gallionella capsiferriformans ES-2]
          Length = 176

 Score = 77.0 bits (188), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 46/152 (30%), Positives = 78/152 (51%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           +N Q K   ++E+S   + S +IV+A Y+GI VA I  LR   RE+G  + V KN L + 
Sbjct: 3   LNLQEKQTVVAEVSAQVAQSQTIVLAEYRGIKVADITKLRATARESGVYLHVLKNTLARR 62

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A++ TS   ++D  VG  +   S   V A K+   F+  N    V  G +   V++ D +
Sbjct: 63  AVQGTSFEALADSMVGPLVYSMSADAVAAAKVMCEFAKTNPLLVVKAGSMAGSVMSADQV 122

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLG 152
             +A+ P  + + A +++ + +   + VR L 
Sbjct: 123 AVLAATPSRDELIARLMATMNATTAKFVRTLA 154


>gi|330444939|ref|ZP_08308593.1| 50S ribosomal protein L10 [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
 gi|328493057|dbj|GAA03090.1| 50S ribosomal protein L10 [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
          Length = 164

 Score = 77.0 bits (188), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 50/159 (31%), Positives = 87/159 (54%), Gaps = 5/159 (3%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           +N Q K   ++E+++  + + S VVA  +G++V  +  LRK+ REAG  VKV +N L + 
Sbjct: 3   LNLQDKKAIVAEVNEAANGALSAVVADSRGVTVGAMTTLRKQAREAGVYVKVVRNTLARR 62

Query: 61  AIRDTSIRGISDLFVGQSLIVYS-DSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
           A+  T    + D+FVG SLI +S + P  A ++   F+ +N  F +     E  V N   
Sbjct: 63  AVEGTDFECLKDVFVGPSLIGFSNEHPGAAARLFKDFAKENKSFEIKAAAFEGAVAN--- 119

Query: 120 IKQIASLPDL-EGIRAGIISAIQSNATRLVRLLGTPQTQ 157
           ++ +A+LP   E I   ++   +++A +LVR +   + Q
Sbjct: 120 VEVLATLPTYDEAIARLMMCMKEASAGKLVRTIAAVRDQ 158


>gi|90417544|ref|ZP_01225465.1| ribosomal protein L10 [marine gamma proteobacterium HTCC2207]
 gi|90330636|gb|EAS45926.1| ribosomal protein L10 [marine gamma proteobacterium HTCC2207]
          Length = 176

 Score = 77.0 bits (188), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 53/176 (30%), Positives = 89/176 (50%), Gaps = 7/176 (3%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           +N +GK   ++E+S+  +++ S+V+A  +G+ V  +  LR K R     ++V +N L K 
Sbjct: 3   LNLEGKKAIVAEVSETAANALSLVIADARGVDVTAMNALRAKARAENVQLRVVRNTLAKR 62

Query: 61  AIRDTSIRGISDLFVGQSLIVYS-DSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
           A  +T    + D+ VG SL  +S + P  A ++   F+ DN EF V    V   +L    
Sbjct: 63  AFAETDYACVEDVLVGPSLFGFSMEDPGAAARLFKDFAKDNKEFEVKALSVSGQLLESGQ 122

Query: 120 IKQIASLPDLE---GIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQQG 172
           I  +A LP L    G+ AG+  A     T+LVR      T+V R ++A   + ++ 
Sbjct: 123 IDMLAKLPTLHEALGMLAGVTLA---PITKLVRTFNEVPTKVTRVVAAVKTQKEEA 175


>gi|169830424|ref|YP_001716406.1| ribosomal protein L10 [Candidatus Desulforudis audaxviator MP104C]
 gi|169637268|gb|ACA58774.1| ribosomal protein L10 [Candidatus Desulforudis audaxviator MP104C]
          Length = 175

 Score = 77.0 bits (188), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 49/172 (28%), Positives = 90/172 (52%), Gaps = 1/172 (0%)

Query: 2   NRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIA 61
            ++ K   +++L +    +  IV++ Y+G+SVA+I  LR+K+RE G  + V KN L ++A
Sbjct: 3   QKKDKVATVADLRERMHRARVIVLSDYRGMSVAEITALRRKVRETGSQMLVVKNTLARLA 62

Query: 62  IRDTSIRGISDLFVGQSLIVYSDSPVIA-PKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
            R+  I+ +  L  G + + +     IA  K+ V F  D  +F + GGV++  +L ++SI
Sbjct: 63  AREAGIKEMESLLTGPTALAFGYEDEIALSKLMVQFEKDYKQFDLKGGVMKGRLLPRESI 122

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQQG 172
            ++A LP  + +   +  A Q+    L  +L      +V  + A  +K   G
Sbjct: 123 LKLADLPPRQVLLGQVTGAFQAPIAALANVLQGNIRNLVYVLEAVREKKAAG 174


>gi|328949971|ref|YP_004367306.1| 50S ribosomal protein L10 [Marinithermus hydrothermalis DSM 14884]
 gi|328450295|gb|AEB11196.1| 50S ribosomal protein L10 [Marinithermus hydrothermalis DSM 14884]
          Length = 176

 Score = 77.0 bits (188), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 42/157 (26%), Positives = 84/157 (53%), Gaps = 2/157 (1%)

Query: 18  SSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRGISDLFVGQ 77
           ++ GS  + +Y+G+       LRK ++E G  + VAKN L++IA+++  +  +     G 
Sbjct: 19  AADGSFFLVNYQGLPAGDEFQLRKALKEKGARLLVAKNTLIRIALQELGLPELDGALAGP 78

Query: 78  SLIVYSDSPVIAPKISVSFSNDNNE--FRVLGGVVEKGVLNQDSIKQIASLPDLEGIRAG 135
           + +V  + PV A K  + F+  N +       G+++  +L+ + IK +A LP L+ +RA 
Sbjct: 79  TAVVVFEDPVAAAKALLDFAEKNEKKIPEAKAGLLQGQLLSPEDIKALAKLPTLDELRAE 138

Query: 136 IISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQQG 172
           ++  +Q+    +V +LG    + V  + A+V K ++ 
Sbjct: 139 LVGTLQAPMAEMVGVLGGAAREFVGILDAYVKKQKEA 175


>gi|238916247|ref|YP_002929764.1| large subunit ribosomal protein L10 [Eubacterium eligens ATCC
           27750]
 gi|238871607|gb|ACR71317.1| large subunit ribosomal protein L10 [Eubacterium eligens ATCC
           27750]
          Length = 167

 Score = 77.0 bits (188), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 51/167 (30%), Positives = 81/167 (48%), Gaps = 12/167 (7%)

Query: 6   KSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDT 65
           K+  I E+   F  +  +VV +Y G++V Q   LRK++REAG   KV KN LVK  +  T
Sbjct: 10  KTSTIDEIKDNFDGAQGVVVVNYSGLTVEQDTQLRKQLREAGVVYKVYKNTLVKRVVAGT 69

Query: 66  SIRGISDLFVGQSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIA 124
               I+D   G + I +  +   AP +I  +F+   +   +  GVVE    +   I  IA
Sbjct: 70  EFEPIADTLEGTNAIAFCKTDATAPARILANFAKTADALELKCGVVEGTFYDAAGIATIA 129

Query: 125 SLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQQ 171
           ++P  E + + ++ +IQS           P T   R I    +KN++
Sbjct: 130 TIPSREELLSKLLGSIQS-----------PITNFARVIKQIAEKNEE 165


>gi|323486274|ref|ZP_08091600.1| 50S ribosomal protein L10 [Clostridium symbiosum WAL-14163]
 gi|323693935|ref|ZP_08108122.1| 50S ribosomal protein L10 [Clostridium symbiosum WAL-14673]
 gi|323400384|gb|EGA92756.1| 50S ribosomal protein L10 [Clostridium symbiosum WAL-14163]
 gi|323502032|gb|EGB17907.1| 50S ribosomal protein L10 [Clostridium symbiosum WAL-14673]
          Length = 162

 Score = 77.0 bits (188), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 40/143 (27%), Positives = 79/143 (55%), Gaps = 1/143 (0%)

Query: 10  ISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRG 69
           ++E+S++F+ + + VV  Y+G++V Q   LRK++REAG   KV KN +++ A + T+   
Sbjct: 11  VAEISELFNGAKTAVVVDYRGLTVEQDTQLRKQLREAGVTYKVYKNTMIRFAAKGTAFEA 70

Query: 70  ISDLFVGQS-LIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASLPD 128
           +     G + L V  D   +  +I   F+   ++  + GG+VE    +   ++ IA++P 
Sbjct: 71  LEPHLEGPTALAVSKDDATVPARILAEFAKKADKLEIKGGIVEDTYYDAKGMQVIATIPS 130

Query: 129 LEGIRAGIISAIQSNATRLVRLL 151
            E +   ++ ++QS  T   R++
Sbjct: 131 REVLLGRLLGSMQSPITNFARVI 153


>gi|328953167|ref|YP_004370501.1| 50S ribosomal protein L10 [Desulfobacca acetoxidans DSM 11109]
 gi|328453491|gb|AEB09320.1| 50S ribosomal protein L10 [Desulfobacca acetoxidans DSM 11109]
          Length = 174

 Score = 77.0 bits (188), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 54/170 (31%), Positives = 86/170 (50%), Gaps = 2/170 (1%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M +  KS  I EL +    +   V+A +KG+ VA+   LR++++ AGG + VAKN L+K+
Sbjct: 1   MQKAKKSEIIEELQQKLERASFNVLADFKGMKVAEFTQLRRELKNAGGELIVAKNTLLKL 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYS-DSPVIAPKISVSFSNDN-NEFRVLGGVVEKGVLNQD 118
           A  +T    +    VG + I     +PV   KI   ++ D  + F +  G +   VL + 
Sbjct: 61  AAGNTEAAALESFLVGPTAIALGYQNPVEIAKILAKYAKDKPDNFFLKAGRLNASVLAKQ 120

Query: 119 SIKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDK 168
            I  I+ LPD E + A ++ A+Q   T LV +L     Q +  + A  DK
Sbjct: 121 DIIDISKLPDREVLLAKLLGALQGVPTSLVSVLSGIIRQFLYTLQAIADK 170


>gi|145596446|ref|YP_001160743.1| 50S ribosomal protein L10 [Salinispora tropica CNB-440]
 gi|145305783|gb|ABP56365.1| LSU ribosomal protein L10P [Salinispora tropica CNB-440]
          Length = 181

 Score = 77.0 bits (188), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 47/174 (27%), Positives = 89/174 (51%), Gaps = 10/174 (5%)

Query: 3   RQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVK----VAKNRLV 58
           R  K+  ++EL++ F ++G+ V+  Y+G++V+Q+  LR+ +     G +    +AKN L 
Sbjct: 7   RADKATAVAELTESFRNAGATVLTEYRGLTVSQLTQLRRSL-----GTETTYTIAKNTLA 61

Query: 59  KIAIRDTSIRGISDLFVGQSLIVYSDSPVI-APKISVSFSNDNNEFRVLGGVVEKGVLNQ 117
           K A  D  I G+ +LF G + + +    V+ A K    F+  N +  + GGV E   ++ 
Sbjct: 62  KRAAVDAGISGLDELFTGPTALTFVSGDVVEAAKGLREFAKTNPKLVIKGGVFEGKAISA 121

Query: 118 DSIKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQQ 171
             + ++A L   E + A +  A++ N ++   L   P  +  R  +A  DK ++
Sbjct: 122 AEVTKLADLESREVLLAKLAGAMKGNLSKAASLFQAPMAKTARLAAALQDKREK 175


>gi|149195230|ref|ZP_01872320.1| 50S ribosomal protein L10 [Caminibacter mediatlanticus TB-2]
 gi|149134663|gb|EDM23149.1| 50S ribosomal protein L10 [Caminibacter mediatlanticus TB-2]
          Length = 160

 Score = 77.0 bits (188), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 50/143 (34%), Positives = 81/143 (56%), Gaps = 7/143 (4%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M ++ K   I ELSK F+S  SI  A YKG +V  ++ LRK +REAGG  +V KN L +I
Sbjct: 1   MKKELKKQIIEELSKEFTSDVSIFYADYKGQTVKDLETLRKSVREAGGKARVVKNTLARI 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSND-NNEFRVLGGVVEKGVLNQDS 119
           A+++    GI   F   ++ ++ +  +   KI V  + D  + F++ G VVE  V +   
Sbjct: 61  ALKNN---GIEADFEENNIFIWGEDQITLAKIVVKHAKDYKDTFKIKGAVVEGEVKDAAY 117

Query: 120 IKQIASLP---DLEGIRAGIISA 139
           I++++ LP   +L G+ A ++ A
Sbjct: 118 IEEVSKLPTKDELLGMVAFMMKA 140


>gi|257483176|ref|ZP_05637217.1| 50S ribosomal protein L10 [Pseudomonas syringae pv. tabaci ATCC
           11528]
 gi|330988291|gb|EGH86394.1| 50S ribosomal protein L10 [Pseudomonas syringae pv. lachrymans str.
           M301315]
 gi|331012403|gb|EGH92459.1| 50S ribosomal protein L10 [Pseudomonas syringae pv. tabaci ATCC
           11528]
          Length = 166

 Score = 77.0 bits (188), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 47/155 (30%), Positives = 84/155 (54%), Gaps = 1/155 (0%)

Query: 4   QGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIR 63
           + K   ++E+++   +  S VVA  +G++V  +  LRK+ REAG  V+V +N L+K A+ 
Sbjct: 6   EDKKAIVAEVNEAAKAGLSAVVADARGVTVGAMTGLRKEAREAGVYVRVVRNTLLKRAVA 65

Query: 64  DTSIRGISDLFVGQSLIVYS-DSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQ 122
           DT    ++D+F G +LI +S + P  A ++   F+   ++F +     E   L  + I  
Sbjct: 66  DTEFSVLNDVFTGPTLIAFSNEHPGAAARLFKEFAKGQDKFEIKAAAFEGKFLAANQIDV 125

Query: 123 IASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQ 157
           +ASLP  +   + ++S IQ   ++L R L   + Q
Sbjct: 126 LASLPTRDEAISQLMSVIQGATSKLARTLAAVRDQ 160


>gi|237735200|ref|ZP_04565681.1| 50S ribosomal protein L10 [Mollicutes bacterium D7]
 gi|229381976|gb|EEO32067.1| 50S ribosomal protein L10 [Coprobacillus sp. D7]
          Length = 198

 Score = 77.0 bits (188), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 43/149 (28%), Positives = 81/149 (54%), Gaps = 1/149 (0%)

Query: 4   QGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIR 63
           + KS  + E++     + S VV  Y+G+SVA++ +LR  +R     +KV KN LV+ A  
Sbjct: 7   KAKSALVEEIAAKLKGAQSAVVVEYRGLSVAEMTELRNNLRAEDVELKVYKNSLVQRATV 66

Query: 64  DTSIRGISDLFVGQSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQ 122
            T   G++    G + I   +S  +AP ++   F+ D+    +   VVE  +L  D +K+
Sbjct: 67  ATEYEGLNAELTGPNAIALGNSDAVAPARVIAKFAKDHEALVIKAAVVEGKLLTVDEVKE 126

Query: 123 IASLPDLEGIRAGIISAIQSNATRLVRLL 151
           I+ LP+ EG+ + ++  +Q+  ++  R++
Sbjct: 127 ISKLPNREGMYSMLLGMLQAPVSKFARVV 155


>gi|167757653|ref|ZP_02429780.1| hypothetical protein CLORAM_03203 [Clostridium ramosum DSM 1402]
 gi|167702650|gb|EDS17229.1| hypothetical protein CLORAM_03203 [Clostridium ramosum DSM 1402]
          Length = 199

 Score = 77.0 bits (188), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 43/149 (28%), Positives = 81/149 (54%), Gaps = 1/149 (0%)

Query: 4   QGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIR 63
           + KS  + E++     + S VV  Y+G+SVA++ +LR  +R     +KV KN LV+ A  
Sbjct: 7   KAKSALVEEIAAKLKGAQSAVVVEYRGLSVAEMTELRNNLRAEDVELKVYKNSLVQRATV 66

Query: 64  DTSIRGISDLFVGQSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQ 122
            T   G++    G + I   +S  +AP ++   F+ D+    +   VVE  +L  D +K+
Sbjct: 67  ATEYEGLNAELTGPNAIALGNSDAVAPARVIAKFAKDHEALVIKAAVVEGKLLTVDEVKE 126

Query: 123 IASLPDLEGIRAGIISAIQSNATRLVRLL 151
           I+ LP+ EG+ + ++  +Q+  ++  R++
Sbjct: 127 ISKLPNREGMYSMLLGMLQAPVSKFARVV 155


>gi|320540636|ref|ZP_08040286.1| putative 50S ribosomal subunit protein L10 [Serratia symbiotica
           str. Tucson]
 gi|320029567|gb|EFW11596.1| putative 50S ribosomal subunit protein L10 [Serratia symbiotica
           str. Tucson]
          Length = 165

 Score = 76.6 bits (187), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 47/159 (29%), Positives = 88/159 (55%), Gaps = 2/159 (1%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           +N Q K   ++E++++   + S VVA  +G++V ++ +LRK  REAG  ++V +N L++ 
Sbjct: 3   LNLQDKQAIVAEVNEVAKGALSAVVADSRGVTVDKMTELRKAGREAGVYMRVVRNTLMRR 62

Query: 61  AIRDTSIRGISDLFVGQSLIVY-SDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
            +  T    + D FVG +LI + S+ P  A ++   F+  N EF V     E  ++    
Sbjct: 63  VVEGTPFECLKDTFVGPTLIAFSSEHPGAAARLFKEFAKANAEFEVKAAAFEGELIPAAQ 122

Query: 120 IKQIASLPDLEGIRAGIISAI-QSNATRLVRLLGTPQTQ 157
           I ++A+LP  +   A +++ + ++ A +LVR L   + Q
Sbjct: 123 IDRLATLPTYDEAIARLMATMKEAAAGKLVRTLAALRDQ 161


>gi|24379400|ref|NP_721355.1| 50S ribosomal protein L10 [Streptococcus mutans UA159]
 gi|290580598|ref|YP_003484990.1| 50S ribosomal protein L10 [Streptococcus mutans NN2025]
 gi|29336665|sp|Q8DUH2|RL10_STRMU RecName: Full=50S ribosomal protein L10
 gi|24377331|gb|AAN58661.1|AE014936_1 50S ribosomal protein L10 [Streptococcus mutans UA159]
 gi|254997497|dbj|BAH88098.1| 50S ribosomal protein L10 [Streptococcus mutans NN2025]
          Length = 167

 Score = 76.6 bits (187), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 41/122 (33%), Positives = 71/122 (58%), Gaps = 1/122 (0%)

Query: 22  SIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRGISDLFVGQSLIV 81
           SIVV   +G++V Q   LR+ +RE+    KV KN +++ A     + G  D+F G S + 
Sbjct: 25  SIVVVDSRGLTVEQDTVLRRNLRESAVEFKVIKNSILRRAAEKAGLEGFDDIFTGPSAVA 84

Query: 82  YSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASLPDLEGIRAGIISAI 140
           +S+  V+AP KI   F+ D     + GG +E  V  ++ I+ +A+LP+ EG+ + ++S +
Sbjct: 85  FSNEDVVAPAKIINDFAKDAEALEIKGGAIEGAVSTKEEIQALAALPNREGLLSMLLSVL 144

Query: 141 QS 142
           Q+
Sbjct: 145 QA 146


>gi|257867891|ref|ZP_05647544.1| ribosomal protein L10 [Enterococcus casseliflavus EC30]
 gi|257874220|ref|ZP_05653873.1| ribosomal protein L10 [Enterococcus casseliflavus EC10]
 gi|257801974|gb|EEV30877.1| ribosomal protein L10 [Enterococcus casseliflavus EC30]
 gi|257808384|gb|EEV37206.1| ribosomal protein L10 [Enterococcus casseliflavus EC10]
          Length = 166

 Score = 76.6 bits (187), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 50/168 (29%), Positives = 91/168 (54%), Gaps = 12/168 (7%)

Query: 6   KSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDT 65
           KS  + E+S  FS + S+VV  Y+G++V ++  LRK++R+A   +KV KN ++  A    
Sbjct: 9   KSAIVDEVSAKFSVAASVVVVDYRGLTVDEVTRLRKQLRDANVEMKVIKNSILSRAAEKA 68

Query: 66  SIRGISDLFVGQSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIA 124
            + G+ ++F G + + +S+  V+AP KI   F+ D     + GG++E  V + + I  +A
Sbjct: 69  GLEGLGEVFTGPTAVAFSNEDVVAPAKIINDFAKDAKALEIKGGIIEGKVSSLEEITALA 128

Query: 125 SLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQQG 172
            LP+ EG+ + ++S +Q+           P   V  A+ A  +K +  
Sbjct: 129 KLPNREGLLSMLLSVLQA-----------PIRNVAYAVKAVAEKEEDA 165


>gi|197336371|ref|YP_002157206.1| ribosomal protein L10 [Vibrio fischeri MJ11]
 gi|226700022|sp|B5FC90|RL10_VIBFM RecName: Full=50S ribosomal protein L10
 gi|197317861|gb|ACH67308.1| ribosomal protein L10 [Vibrio fischeri MJ11]
          Length = 164

 Score = 76.6 bits (187), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 49/159 (30%), Positives = 86/159 (54%), Gaps = 5/159 (3%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           +N Q K   ++E+++  S + S VVA  +G+ VA +  LRK+ REAG  +KV +N L + 
Sbjct: 3   LNLQDKKAIVAEVNEAASGALSAVVADSRGVPVAAMTVLRKQAREAGVYMKVVRNTLARR 62

Query: 61  AIRDTSIRGISDLFVGQSLIVYS-DSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
           A+  T    ++D F G SL+ +S + P  A ++   F+ +N +F +     E  V + D 
Sbjct: 63  AVEGTEYECLTDTFTGPSLLAFSNEHPGAAARLFKDFAKENKDFEIKAAAFEGAVTDADV 122

Query: 120 IKQIASLPDL-EGIRAGIISAIQSNATRLVRLLGTPQTQ 157
              +A+LP   E I   ++   +++A +LVR +   + Q
Sbjct: 123 ---LATLPTYDEAIARLMMCMKEASAGKLVRTIAAVRDQ 158


>gi|221130972|ref|XP_002164923.1| PREDICTED: similar to mitochondrial ribosomal protein L10 [Hydra
           magnipapillata]
          Length = 192

 Score = 76.6 bits (187), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 40/155 (25%), Positives = 80/155 (51%), Gaps = 2/155 (1%)

Query: 15  KIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRGISDLF 74
           K+F ++  I +  Y  +S  +  D R  M +    VKV  N + ++ ++D+  + I+ LF
Sbjct: 39  KVFETNEKIFIFQYNSLSALEWNDFRYDMGKEHISVKVFPNEISRVYLKDSPYKNIAPLF 98

Query: 75  VGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASLPDLEGIRA 134
             Q+ + + +   I  K  +   N N    +LG V+E  ++N+D+I   A+LP L+ + +
Sbjct: 99  FTQTAVAFGNQVNI--KSVLKLFNRNPRIHLLGAVIENTIMNKDNIASYANLPSLKDMHS 156

Query: 135 GIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKN 169
            ++S +   +  L RLL T  + +  ++  F+ +N
Sbjct: 157 ELLSMLSQPSQELSRLLETNSSNLSISLEQFLKQN 191


>gi|270308260|ref|YP_003330318.1| ribosomal protein L10 [Dehalococcoides sp. VS]
 gi|270154152|gb|ACZ61990.1| ribosomal protein L10 [Dehalococcoides sp. VS]
          Length = 176

 Score = 76.6 bits (187), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 45/154 (29%), Positives = 84/154 (54%), Gaps = 2/154 (1%)

Query: 3   RQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAI 62
           R+ K + + EL+   + + S V   Y+GIS +++  +R K+REAG G +V KN L + A 
Sbjct: 6   REKKKIAVDELTDALAVAQSAVFTDYRGISTSELTTIRVKLREAGVGYRVLKNTLARRAA 65

Query: 63  RDTSIRGISDLFVGQSLIVYSDSPVIAP-KISVSF-SNDNNEFRVLGGVVEKGVLNQDSI 120
            +T    I   F G   + YS S V+AP ++ + + ++  +  +V GG +   +++ D +
Sbjct: 66  DNTHHTNIKSAFEGPVAMAYSSSDVVAPARVLMDYLASSKSTLKVTGGYLSNKLISVDEV 125

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTP 154
            ++A LP  E + + +++ +QS    L  +L  P
Sbjct: 126 AELAKLPSREVLISKVLAGMQSPIAGLAMVLNGP 159


>gi|118579110|ref|YP_900360.1| 50S ribosomal protein L10 [Pelobacter propionicus DSM 2379]
 gi|166230044|sp|A1ALT2|RL10_PELPD RecName: Full=50S ribosomal protein L10
 gi|118501820|gb|ABK98302.1| LSU ribosomal protein L10P [Pelobacter propionicus DSM 2379]
          Length = 174

 Score = 76.6 bits (187), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 50/166 (30%), Positives = 88/166 (53%), Gaps = 2/166 (1%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           MNR  K   ++++ +  S + ++ +A ++G++V Q   LR ++R A    KV KN L+ +
Sbjct: 1   MNRDNKQELVTQMHERLSRAKAVFLADFRGMAVGQATSLRNELRGASVEYKVFKNTLLDL 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYS-DSPVIAPKISVSFSNDN-NEFRVLGGVVEKGVLNQD 118
           A + T +  IS    G + I  S D PV A K+   F+ D   +F +  GV+   +L+  
Sbjct: 61  AAKGTDVECISPYLAGPTAIAISYDDPVSAAKVLSKFAKDPAGKFVLKAGVLSGKLLDVT 120

Query: 119 SIKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISA 164
            I+ +A LP  E + A ++ ++Q+ AT  V +L      +VR + A
Sbjct: 121 QIQALADLPSREVLIAKMLGSMQAPATNFVGVLAALPGSLVRVLDA 166


>gi|70732891|ref|YP_262659.1| 50S ribosomal protein L10 [Pseudomonas fluorescens Pf-5]
 gi|97181852|sp|Q4K524|RL10_PSEF5 RecName: Full=50S ribosomal protein L10
 gi|68347190|gb|AAY94796.1| ribosomal protein L10 [Pseudomonas fluorescens Pf-5]
          Length = 166

 Score = 76.6 bits (187), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 48/149 (32%), Positives = 81/149 (54%), Gaps = 1/149 (0%)

Query: 10  ISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRG 69
           ++E+++   ++ S VVA  +G++V  +  LRK+ REAG  V+V +N L+K A+  T    
Sbjct: 12  VAEVNEAAKAALSAVVADARGVTVGAMTGLRKEAREAGVYVRVVRNTLLKRAVEGTQYDV 71

Query: 70  ISDLFVGQSLIVYS-DSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASLPD 128
           ++D FVG +LI +S + P  A +I   F+    +F +     E   L  + I  +ASLP 
Sbjct: 72  LNDAFVGPTLIAFSKEHPGAAARIFKEFAKGQEKFEIKAAAFEGKYLAANEIDVLASLPT 131

Query: 129 LEGIRAGIISAIQSNATRLVRLLGTPQTQ 157
            +   A ++S IQ   ++L R L   + Q
Sbjct: 132 RDEAIAKLMSVIQGATSKLARTLAAIRDQ 160


>gi|297180661|gb|ADI16870.1| ribosomal protein l10 [uncultured gamma proteobacterium
           HF0010_16J05]
          Length = 180

 Score = 76.6 bits (187), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 45/162 (27%), Positives = 94/162 (58%), Gaps = 1/162 (0%)

Query: 10  ISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRG 69
           ++E++++ +S+ S V+A Y+G++VA++ ++R K RE+G  ++V +N L K A+  T    
Sbjct: 16  VAEVNEVAASALSAVLADYRGLTVAEMTEMRVKARESGVYLRVVRNTLAKRAVEGTEYEC 75

Query: 70  ISDLFVGQSLIVYS-DSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASLPD 128
           ++D FVG +L+ +S + P  A ++   ++ D  +  +    +   VL  D + ++A LP 
Sbjct: 76  LNDAFVGPTLLAFSQEDPGAAARLLKDYAKDLEDLEIKALSIGGEVLPADQLDRVAKLPT 135

Query: 129 LEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQ 170
           L+  R+ ++S +Q+   +L R       ++ R ++A  D+ Q
Sbjct: 136 LDEARSLLMSVMQAPVVKLARTFNEVPGKLTRTVAAIRDQKQ 177


>gi|21223034|ref|NP_628813.1| 50S ribosomal protein L10 [Streptomyces coelicolor A3(2)]
 gi|256785868|ref|ZP_05524299.1| 50S ribosomal protein L10 [Streptomyces lividans TK24]
 gi|289769760|ref|ZP_06529138.1| ribosomal protein L10 [Streptomyces lividans TK24]
 gi|730522|sp|P41103|RL10_STRCO RecName: Full=50S ribosomal protein L10
 gi|404081|gb|AAC36896.1| ribosomal protein L10 [Streptomyces coelicolor A3(2)]
 gi|7248346|emb|CAB77426.1| 50S ribosomal protein L10 [Streptomyces coelicolor A3(2)]
 gi|289699959|gb|EFD67388.1| ribosomal protein L10 [Streptomyces lividans TK24]
          Length = 176

 Score = 76.6 bits (187), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 49/169 (28%), Positives = 89/169 (52%), Gaps = 3/169 (1%)

Query: 6   KSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDT 65
           K+  ++EL+  F SS + V+  Y+G++VAQ+K LR+ + E      V KN L KIA  + 
Sbjct: 6   KAAAVAELTDKFRSSNAAVLTEYRGLTVAQLKTLRRSLGE-NAQYAVVKNTLTKIAANEA 64

Query: 66  SIRGISDLFVGQSLIVY-SDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIA 124
            I     LF G + + + +  PV + K    F+ DN    + GGV++   ++ D IK++A
Sbjct: 65  GITLDDQLFAGPTAVAFVTGDPVESAKGLRDFAKDNPNLVIKGGVLDGKAMSADEIKKLA 124

Query: 125 SLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAF-VDKNQQG 172
            L   E + + +  A +   ++  +L     +++VR + A    +++QG
Sbjct: 125 DLESREVLLSKLAGAFKGKQSQTAQLFQALPSKLVRTVDALRAKQDEQG 173


>gi|239918210|ref|YP_002957768.1| LSU ribosomal protein L10P [Micrococcus luteus NCTC 2665]
 gi|281415599|ref|ZP_06247341.1| LSU ribosomal protein L10P [Micrococcus luteus NCTC 2665]
 gi|289705069|ref|ZP_06501480.1| ribosomal protein L10 [Micrococcus luteus SK58]
 gi|259645487|sp|C5CC73|RL10_MICLC RecName: Full=50S ribosomal protein L10
 gi|239839417|gb|ACS31214.1| LSU ribosomal protein L10P [Micrococcus luteus NCTC 2665]
 gi|289558232|gb|EFD51512.1| ribosomal protein L10 [Micrococcus luteus SK58]
          Length = 173

 Score = 76.6 bits (187), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 45/166 (27%), Positives = 84/166 (50%), Gaps = 2/166 (1%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M    K   ++EL+ +F  S + V+  Y+G++V ++K LR  +R+      VAKN L +I
Sbjct: 1   MATSAKESAVAELTDLFRESSAAVLTEYRGLTVTELKQLRDSIRQ-DATYAVAKNTLAEI 59

Query: 61  AIRDTSIRGISDLFVGQSLIVY-SDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
           A +D  + G+     G + I + +  PV   K    F+ D+ +  + GG ++   L++  
Sbjct: 60  AAKDAGLEGLEAHLSGPTAIAFVTGDPVNVAKALRDFAKDHEKLVLKGGYMDGQPLDEAG 119

Query: 120 IKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAF 165
           IK++A L   E + A    A++ + ++   L   P ++ VR + A 
Sbjct: 120 IKKLADLESREVLLAKFAGAMKGSMSKAAALFQAPLSKTVRTVEAL 165


>gi|297625767|ref|YP_003687530.1| 50S ribosomal protein L10 [Propionibacterium freudenreichii subsp.
           shermanii CIRM-BIA1]
 gi|296921532|emb|CBL56086.1| 50S ribosomal protein L10 [Propionibacterium freudenreichii subsp.
           shermanii CIRM-BIA1]
          Length = 215

 Score = 76.6 bits (187), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 44/172 (25%), Positives = 90/172 (52%), Gaps = 4/172 (2%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M R  K+  ++EL++ F+ S + V+  Y+G+SV  ++DLR+ + +      V KN L K+
Sbjct: 1   MARPDKAAAVAELTEKFTESNATVLTEYRGLSVQDLQDLRRSLGD-NASYAVVKNTLTKL 59

Query: 61  AIRDTSIRGISDLFVGQSLIVY--SDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQD 118
           A ++  + G+ D   G + + +   D   +A  +   F+  N    + GGV++  +L+ +
Sbjct: 60  AAKEAGVEGLDDQLTGPTAVAFISGDIATVAKGLR-DFAKANPLLVIKGGVMDGQILDAE 118

Query: 119 SIKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQ 170
           ++ ++A +   E + A + SA++++ +  V     P +Q  R + A   K Q
Sbjct: 119 TVTKLADIGSREELLAKLASAMKASMSNAVATFAAPLSQAARLMGALESKAQ 170


>gi|16330009|ref|NP_440737.1| 50S ribosomal protein L10 [Synechocystis sp. PCC 6803]
 gi|132642|sp|P23350|RL10_SYNY3 RecName: Full=50S ribosomal protein L10
 gi|47475|emb|CAA37317.1| unnamed protein product [Synechocystis sp. PCC 6803]
 gi|1652496|dbj|BAA17417.1| 50S ribosomal protein L10 [Synechocystis sp. PCC 6803]
 gi|227224|prf||1617100A ribosomal protein L10
          Length = 173

 Score = 76.6 bits (187), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 50/170 (29%), Positives = 85/170 (50%), Gaps = 2/170 (1%)

Query: 2   NRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIA 61
            R+ K+  IS++ ++F  +   V+  Y+G++VA+I DLR ++R  GG  K+AKN LV+ A
Sbjct: 4   TRENKATVISDVQELFQDAQMTVIIDYQGLTVAEITDLRNRLRPLGGTCKIAKNTLVRRA 63

Query: 62  IR-DTSIRGISDLFVGQS-LIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
           +    +   + +   G + ++V  +    A K    F  D  +  + GGV+E   L Q  
Sbjct: 64  LAGQEAWSPMEEFLTGTTAILVLKEDLGGAIKAYKKFQKDTKKTELRGGVLEGKSLTQAD 123

Query: 120 IKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKN 169
           ++ I  LP  E +   I   I + AT++   +      V R + A VDK 
Sbjct: 124 VEAIGDLPSKEQLMGQIAGGINALATKIALGIKEVPASVARGLQAHVDKE 173


>gi|148361062|ref|YP_001252269.1| hypothetical protein LPC_3023 [Legionella pneumophila str. Corby]
 gi|166229739|sp|A5IHS3|RL10_LEGPC RecName: Full=50S ribosomal protein L10
 gi|148282835|gb|ABQ56923.1| hypothetical protein LPC_3023 [Legionella pneumophila str. Corby]
          Length = 177

 Score = 76.6 bits (187), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 45/169 (26%), Positives = 89/169 (52%), Gaps = 1/169 (0%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           +N   K   + E++ + S + S VVA Y+G++V Q+  LR + R++G  ++V +N L + 
Sbjct: 3   LNLAAKKAVVEEVTAVASKAISAVVADYRGLTVNQMTQLRSEARKSGVYLRVVRNTLTRR 62

Query: 61  AIRDTSIRGISDLFVGQSLIVYS-DSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
           A+++T    ++DL VG   I  S ++P  A ++   ++    +  +    V   V N + 
Sbjct: 63  ALKNTEFECLNDLLVGPVFIALSLEAPSDAARLLKDYAKTFEKLEIRALSVGGKVYNANQ 122

Query: 120 IKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDK 168
           I  +ASLP  +   + ++  +++   + VR L  P  ++ R ++A  DK
Sbjct: 123 IDAVASLPTRDEAISKLMYVMKAPIEKFVRTLAEPHAKLARTLAAVKDK 171


>gi|317153966|ref|YP_004122014.1| 50S ribosomal protein L10 [Desulfovibrio aespoeensis Aspo-2]
 gi|316944217|gb|ADU63268.1| ribosomal protein L10 [Desulfovibrio aespoeensis Aspo-2]
          Length = 173

 Score = 76.6 bits (187), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 47/171 (27%), Positives = 84/171 (49%), Gaps = 1/171 (0%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           MNRQ K+  I +L K  + +   VV  +KG++V +I  LR K  E G   +V KN L ++
Sbjct: 1   MNRQEKAQIIEQLHKKAARASIAVVTDFKGLTVEEITQLRAKCYEVGVDYQVVKNTLARL 60

Query: 61  AIRDTSIRGISDLFVGQSLIVY-SDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
           A++DT    +S+       I    D PV   K    F   N +F +  G +E   L+ D 
Sbjct: 61  ALKDTDHGELSEHLKENCAIALGYDDPVALAKTLAEFDRTNKKFALRFGSLEGDFLDSDG 120

Query: 120 IKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQ 170
           +K++A +P    + + ++  +Q+     V L    + + + A++A  ++ +
Sbjct: 121 VKELAKMPSKPELLSSVLGTMQAVPRNFVCLFANIERKFLYALTAIKEQKE 171


>gi|330720887|gb|EGG99074.1| LSU ribosomal protein L10p (P0) [gamma proteobacterium IMCC2047]
          Length = 176

 Score = 76.6 bits (187), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 47/162 (29%), Positives = 90/162 (55%), Gaps = 1/162 (0%)

Query: 10  ISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRG 69
           ++E+++   ++ S V+A Y+G+SV ++  LRK+ RE G  ++V +N L+K A+  T    
Sbjct: 12  VAEVNEAAGNALSAVLADYQGLSVEEMTSLRKQARENGVYLRVVRNTLLKRAVEGTEYEC 71

Query: 70  ISDLFVGQSLIVYS-DSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASLPD 128
           I +  VG +++ +S + P  A ++   F+ +N++  V    V   +L  D I  +A LP 
Sbjct: 72  IKEALVGPTILAFSQEDPGAAARVIKDFAKENDKLEVKALSVGGQLLGADQIDVLAKLPT 131

Query: 129 LEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQ 170
            +   + ++S +Q+  T+L R L     ++VR ++A  D  Q
Sbjct: 132 RDQAISMLMSVMQAPVTKLARTLNEVPGKLVRTLAAVRDDKQ 173


>gi|167967503|ref|ZP_02549780.1| 50S ribosomal protein L10 [Mycobacterium tuberculosis H37Ra]
          Length = 178

 Score = 76.6 bits (187), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 45/169 (26%), Positives = 87/169 (51%), Gaps = 2/169 (1%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M    K+  +++++  F  S + ++  Y+G++VA + +LR+ +        VAKN L+K 
Sbjct: 1   MAXADKATAVADIAAQFKESTATLITEYRGLTVANLAELRRSLT-GSATYAVAKNTLIKR 59

Query: 61  AIRDTSIRGISDLFVGQSLIVY-SDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
           A  +  I G+ +LFVG + I + +  PV A K   +F+ ++    + GG ++   L    
Sbjct: 60  AASEAGIEGLDELFVGPTAIAFVTGEPVDAAKAIKTFAKEHKALVIKGGYMDGHPLTVAE 119

Query: 120 IKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDK 168
           +++IA L   E + A +  A++ N  +   L   P +Q+ R  +A  +K
Sbjct: 120 VERIADLESREVLLAKLAGAMKGNLAKAAGLFNAPASQLARLAAALQEK 168


>gi|302536239|ref|ZP_07288581.1| 50S ribosomal protein L10 [Streptomyces sp. C]
 gi|302445134|gb|EFL16950.1| 50S ribosomal protein L10 [Streptomyces sp. C]
          Length = 176

 Score = 76.6 bits (187), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 50/174 (28%), Positives = 87/174 (50%), Gaps = 3/174 (1%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M    K+  ++EL   F SS + V+  Y+G++VAQ+K LR+ + E      V KN L KI
Sbjct: 1   MPTPNKAASVAELKDAFQSSNAAVLTEYRGLTVAQLKTLRRSLGE-NAQYAVVKNTLTKI 59

Query: 61  AIRDTSIRGISDLFVGQSLIVY-SDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
           A     I  + + F G + + + +  PV + K    F+ DN    +  GV++   L+ D 
Sbjct: 60  AANQAGITALDEHFAGPTAVAFITGDPVESAKSLRDFAKDNPNLIIKAGVLDGKALSADD 119

Query: 120 IKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKN-QQG 172
           IK++A L   E + + +  A +   ++  +L     +++VR + A   K  +QG
Sbjct: 120 IKKLADLESREVLLSKLAGAFKGKQSQAAQLFQALPSKLVRTVDALRAKQAEQG 173


>gi|322434562|ref|YP_004216774.1| ribosomal protein L10 [Acidobacterium sp. MP5ACTX9]
 gi|321162289|gb|ADW67994.1| ribosomal protein L10 [Acidobacterium sp. MP5ACTX9]
          Length = 245

 Score = 76.3 bits (186), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 49/152 (32%), Positives = 83/152 (54%), Gaps = 1/152 (0%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           ++R  K+ ++  L+K   +S S +V  +KG++ ++  +LRK +R AGG   V KN+L   
Sbjct: 3   ISRATKTEKVKFLTKELETSTSAIVGTFKGLTASKDFELRKAIRAAGGSYHVIKNKLAAK 62

Query: 61  AIRDTSIRGISDLFVGQSLIVY-SDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
           A + + I        G S + Y S  PV+  K   ++  DN+EF    G+V+  VLN   
Sbjct: 63  ASQGSKIEAALQNLKGVSAVAYTSGDPVVLAKALSTWVKDNSEFTFKVGIVDGQVLNVQE 122

Query: 120 IKQIASLPDLEGIRAGIISAIQSNATRLVRLL 151
           I ++AS+P  E + + ++  IQS A RL  ++
Sbjct: 123 ITELASMPGKEELFSKLLFLIQSPAQRLATVI 154


>gi|302384850|ref|YP_003820672.1| ribosomal protein L10 [Clostridium saccharolyticum WM1]
 gi|302195478|gb|ADL03049.1| ribosomal protein L10 [Clostridium saccharolyticum WM1]
          Length = 167

 Score = 76.3 bits (186), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 44/143 (30%), Positives = 76/143 (53%), Gaps = 1/143 (0%)

Query: 10  ISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRG 69
           +SE+ ++   + S VV  Y+GI+VAQ   LRKK+REAG   KV KN +++ A + T+   
Sbjct: 11  VSEIKELLDGAESAVVVDYRGITVAQDTALRKKLREAGVSYKVYKNTMIRFAAKGTAFEA 70

Query: 70  ISDLFVGQSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASLPD 128
           +     G + I  S +   AP +I   F+       + GGVVE    +   +++I+ +P 
Sbjct: 71  LDPNLEGPTAIAVSKTDATAPARILAEFAKTAPALEIKGGVVEGNYYDAKGMEKISGIPS 130

Query: 129 LEGIRAGIISAIQSNATRLVRLL 151
            E +   ++ ++QS    + R+L
Sbjct: 131 REILLGKLLGSMQSPIANIARVL 153


>gi|119511569|ref|ZP_01630677.1| 50S ribosomal protein L10 [Nodularia spumigena CCY9414]
 gi|119463804|gb|EAW44733.1| 50S ribosomal protein L10 [Nodularia spumigena CCY9414]
          Length = 192

 Score = 76.3 bits (186), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 56/166 (33%), Positives = 89/166 (53%), Gaps = 6/166 (3%)

Query: 10  ISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIR-DTSIR 68
           +++L    S S   +V  Y+G++VAQI DLR+K+R +G   KV KN L+ IAI  D + +
Sbjct: 12  VADLKNSLSESTLALVIDYQGLTVAQITDLRQKLRPSGAVCKVTKNTLMGIAIDGDENWQ 71

Query: 69  GISDLFVGQS--LIVYSD-SPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIAS 125
            +S+L  G S  L+V  D S  I  K    F     +  + GGV+E  +L +  +K +  
Sbjct: 72  PLSELLQGSSAFLLVKEDFSSAI--KAYQEFQKVTKKTELRGGVMEGRLLKETDVKALGD 129

Query: 126 LPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQQ 171
           LP  E + A I  AI + AT++   +    + + RA+ A  DK ++
Sbjct: 130 LPSKEQLMAQIAGAINALATKVAVGINEVPSSLARALQAVADKEKE 175


>gi|317501868|ref|ZP_07960053.1| 50S ribosomal protein L10 [Lachnospiraceae bacterium 8_1_57FAA]
 gi|331088619|ref|ZP_08337530.1| hypothetical protein HMPREF1025_01113 [Lachnospiraceae bacterium
           3_1_46FAA]
 gi|316896758|gb|EFV18844.1| 50S ribosomal protein L10 [Lachnospiraceae bacterium 8_1_57FAA]
 gi|330407576|gb|EGG87076.1| hypothetical protein HMPREF1025_01113 [Lachnospiraceae bacterium
           3_1_46FAA]
          Length = 176

 Score = 76.3 bits (186), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 41/131 (31%), Positives = 72/131 (54%), Gaps = 1/131 (0%)

Query: 22  SIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRGISDLFVGQSLIV 81
           S+V+  Y+G++VAQ  +LRKK+REAG   KV KN ++K A   T   G+ +   G S + 
Sbjct: 23  SVVIVDYRGLTVAQDTELRKKLREAGVTYKVCKNTMMKRAFEGTEFAGLDEYLEGPSALC 82

Query: 82  YSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASLPDLEGIRAGIISAI 140
            S     AP +I   F+   ++  +  GV+E  V +   + ++A +P  E + + ++ ++
Sbjct: 83  VSKEDATAPARILAEFAKTADKLEMKAGVIEGTVYDVAGLNELAKIPSREVLLSKLLGSL 142

Query: 141 QSNATRLVRLL 151
           QS  T   R++
Sbjct: 143 QSPITNFARVI 153


>gi|311693262|gb|ADP96135.1| 50S ribosomal protein L10 [marine bacterium HP15]
          Length = 176

 Score = 76.3 bits (186), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 46/170 (27%), Positives = 86/170 (50%), Gaps = 1/170 (0%)

Query: 4   QGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIR 63
           + K   ++E+++    + S+V+A Y+G++   +  LR K R     +KV +N L KIAIR
Sbjct: 6   EDKKAIVAEVNETAGGALSVVMADYRGVTSGDMTALRAKARAENVRLKVVRNNLAKIAIR 65

Query: 64  DTSIRGISDLFVGQSLIVYS-DSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQ 122
            T    I +  VG +++ +S + P  A ++   F+ +   F +    V   ++  D I +
Sbjct: 66  GTEFECIDEALVGPTILAFSMEDPGAAARLLKDFAKEKEAFEIKALAVGGELMGADQIDR 125

Query: 123 IASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQQG 172
           +A LP        + +  Q+  T+L R L    ++V RA++A  D+ Q+ 
Sbjct: 126 LAKLPTRHEALTMLAAVTQAPITKLARTLNEVPSKVTRAVAAVRDQKQEA 175


>gi|291457150|ref|ZP_06596540.1| ribosomal protein L10 [Bifidobacterium breve DSM 20213]
 gi|291380985|gb|EFE88503.1| ribosomal protein L10 [Bifidobacterium breve DSM 20213]
          Length = 173

 Score = 76.3 bits (186), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 52/177 (29%), Positives = 89/177 (50%), Gaps = 10/177 (5%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKM-REAGGGVKVAKNRLVK 59
           M R  K   +++L++ F ++ ++ +  Y+G++V QI DLR+K+ R+      VAKN L +
Sbjct: 1   MKRPEKEAVVAQLTEEFRNADAVYLTEYRGLTVPQISDLREKLGRDT--SYTVAKNTLAR 58

Query: 60  IAIRDTSIRGISDLFVGQSLIVYSDSPVI-APKISVSFSNDNNEFRVLGGVVEKGVLNQD 118
           IA ++  I G+ ++  G + I +     I A K+   F+ DN    + G   +  V + +
Sbjct: 59  IAAKEAGIEGLDEILAGPTAITFVKGDFIEAAKVIRDFAKDNKALVIKGAAADGTVYDAE 118

Query: 119 SIKQIASL---PDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQQG 172
             K++A L   P L    AG + A  + A  L   L    T+ VR I A  DK ++ 
Sbjct: 119 GAKKLADLKSRPQLLAEFAGDVKASMAKAAYLFNAL---PTKAVRTIDALRDKQEKA 172


>gi|153815048|ref|ZP_01967716.1| hypothetical protein RUMTOR_01265 [Ruminococcus torques ATCC 27756]
 gi|145847616|gb|EDK24534.1| hypothetical protein RUMTOR_01265 [Ruminococcus torques ATCC 27756]
          Length = 195

 Score = 76.3 bits (186), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 41/131 (31%), Positives = 72/131 (54%), Gaps = 1/131 (0%)

Query: 22  SIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRGISDLFVGQSLIV 81
           S+V+  Y+G++VAQ  +LRKK+REAG   KV KN ++K A   T   G+ +   G S + 
Sbjct: 42  SVVIVDYRGLTVAQDTELRKKLREAGVTYKVCKNTMMKRAFEGTEFAGLDEYLEGPSALC 101

Query: 82  YSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASLPDLEGIRAGIISAI 140
            S     AP +I   F+   ++  +  GV+E  V +   + ++A +P  E + + ++ ++
Sbjct: 102 VSKEDATAPARILAEFAKTADKLEMKAGVIEGTVYDVAGLNELAKIPSREVLLSKLLGSL 161

Query: 141 QSNATRLVRLL 151
           QS  T   R++
Sbjct: 162 QSPITNFARVI 172


>gi|49081500|gb|AAT50150.1| PA4272 [synthetic construct]
          Length = 167

 Score = 76.3 bits (186), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 47/149 (31%), Positives = 82/149 (55%), Gaps = 1/149 (0%)

Query: 10  ISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRG 69
           ++E+++   ++ S VVA  +G++V  +  LRK+ REAG  VKV +N L+K A+  T    
Sbjct: 12  VAEVNEAAKAALSAVVADARGVTVGAMTGLRKEAREAGVYVKVVRNTLLKRAVEGTQFDV 71

Query: 70  ISDLFVGQSLIVYS-DSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASLPD 128
           ++D+F G +LI +S + P  A +I   F+   ++F +     E   L  + I  +ASLP 
Sbjct: 72  LNDVFKGPTLIAFSNEHPGAAARIFREFAKGQDKFEIKAAAFEGQFLAANQIDVLASLPT 131

Query: 129 LEGIRAGIISAIQSNATRLVRLLGTPQTQ 157
            +   + ++S IQ   ++L R L   + Q
Sbjct: 132 YDEAVSQLMSVIQGATSKLARTLAAIRDQ 160


>gi|227549805|ref|ZP_03979854.1| 50S ribosomal protein L10 [Corynebacterium lipophiloflavum DSM
           44291]
 gi|227078060|gb|EEI16023.1| 50S ribosomal protein L10 [Corynebacterium lipophiloflavum DSM
           44291]
          Length = 173

 Score = 76.3 bits (186), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 48/165 (29%), Positives = 86/165 (52%), Gaps = 6/165 (3%)

Query: 7   SVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVK--VAKNRLVKIAIRD 64
           + E++ L   F  + SIV+  Y+G++V Q+++LR ++   G  V+  VAKN LVKIA  +
Sbjct: 7   TAELAVLKDKFQEASSIVLTEYRGLTVGQLQELRGEL---GFDVEYHVAKNTLVKIAASE 63

Query: 65  TSIRGISDLFVGQSLIVY-SDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQI 123
             + G+ +L  G + + +     V A K+   F+  ++ F + GG ++  VL+   +  I
Sbjct: 64  NGMEGLDELLTGPTAVAFIKGEAVDAAKVMKKFNKAHDAFVIKGGYMDGNVLSAAQVDAI 123

Query: 124 ASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDK 168
           A + + E   A I  A Q +  +   L   P ++  R ++A  DK
Sbjct: 124 AEMDNRETTLAKIAGAFQGSLAKAAGLFQAPASKTARLVAALQDK 168


>gi|192362406|ref|YP_001981199.1| 50S ribosomal protein L10 [Cellvibrio japonicus Ueda107]
 gi|190688571|gb|ACE86249.1| 50S ribosomal protein L10 [Cellvibrio japonicus Ueda107]
          Length = 164

 Score = 76.3 bits (186), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 50/169 (29%), Positives = 92/169 (54%), Gaps = 14/169 (8%)

Query: 4   QGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIR 63
           +GK   ++E+ +    + S V+A  +G++V ++  LRK+ REAG  VKV +N L + A++
Sbjct: 6   EGKKAIVAEVQEAAQGALSAVIADSRGVTVGKMTALRKQAREAGVWVKVVRNTLARRAVQ 65

Query: 64  DTSIRGISDLFVGQSLIVYS-DSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQ 122
            T+   ++D FVG +LI +S + P    +I   F+ +N++F V     E  ++N   +  
Sbjct: 66  GTAYECLADKFVGPTLIAFSKEHPGAGARILQDFAKENDKFEVKAAAFEGELVN---VAV 122

Query: 123 IASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQQ 171
           +ASLP  +   A ++S ++  A            ++VR I+A  D+ +Q
Sbjct: 123 LASLPTYDEAIARLMSVMKEAAA----------GKLVRTIAAVRDQKEQ 161


>gi|73666800|ref|YP_302816.1| 50S ribosomal protein L10 [Ehrlichia canis str. Jake]
 gi|123615101|sp|Q3YST7|RL10_EHRCJ RecName: Full=50S ribosomal protein L10
 gi|72393941|gb|AAZ68218.1| LSU ribosomal protein L10P [Ehrlichia canis str. Jake]
          Length = 160

 Score = 76.3 bits (186), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 44/144 (30%), Positives = 74/144 (51%), Gaps = 1/144 (0%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M R  K + +S++  +FS     ++A+++G+       LRK+++ A  G+ V KN L +I
Sbjct: 1   MKRSDKELHLSKVEGLFSKFKYFIIANFQGMVANDFFSLRKELKMANSGLMVVKNSLSRI 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDN-NEFRVLGGVVEKGVLNQDS 119
           A++      +S  F G   IVYSD  ++  KI   F  DN ++  +L       +L+ + 
Sbjct: 61  ALKKMGREELSAKFFGSIFIVYSDDIILISKILAKFMKDNKSKISLLCAYDSNEILDSEK 120

Query: 120 IKQIASLPDLEGIRAGIISAIQSN 143
           +   ASLP L  + A I+S I  N
Sbjct: 121 VLYFASLPSLRELHAQIMSMISYN 144


>gi|210613409|ref|ZP_03289710.1| hypothetical protein CLONEX_01917 [Clostridium nexile DSM 1787]
 gi|210151180|gb|EEA82188.1| hypothetical protein CLONEX_01917 [Clostridium nexile DSM 1787]
          Length = 177

 Score = 76.3 bits (186), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 44/143 (30%), Positives = 78/143 (54%), Gaps = 1/143 (0%)

Query: 10  ISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRG 69
           ++ +++    + S+V+  Y+G++VAQ  +LRK++REAG   KV KN ++K A   T   G
Sbjct: 11  VAAIAEDVKDAASVVLVDYRGLTVAQDTELRKQLREAGIIYKVCKNTMMKRAFEGTDFAG 70

Query: 70  ISDLFVGQSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASLPD 128
           +++   G S I  S     AP +I   F+    +  V  GVVE  V +   +++++ +P 
Sbjct: 71  LNEYLEGPSAIAISKDDATAPARIICKFAKGAEKLEVKAGVVEGTVYDVAGVQELSKIPS 130

Query: 129 LEGIRAGIISAIQSNATRLVRLL 151
            E + +  + +IQS  T   R+L
Sbjct: 131 REELLSKFLGSIQSPITNFARVL 153


>gi|15599468|ref|NP_252962.1| 50S ribosomal protein L10 [Pseudomonas aeruginosa PAO1]
 gi|116052307|ref|YP_788847.1| 50S ribosomal protein L10 [Pseudomonas aeruginosa UCBPP-PA14]
 gi|152987076|ref|YP_001346214.1| 50S ribosomal protein L10 [Pseudomonas aeruginosa PA7]
 gi|218889400|ref|YP_002438264.1| 50S ribosomal protein L10 [Pseudomonas aeruginosa LESB58]
 gi|254237132|ref|ZP_04930455.1| 50S ribosomal protein L10 [Pseudomonas aeruginosa C3719]
 gi|296387171|ref|ZP_06876670.1| 50S ribosomal protein L10 [Pseudomonas aeruginosa PAb1]
 gi|313111426|ref|ZP_07797230.1| 50S ribosomal protein L10 [Pseudomonas aeruginosa 39016]
 gi|13959478|sp|Q9HWC7|RL10_PSEAE RecName: Full=50S ribosomal protein L10
 gi|122261456|sp|Q02T89|RL10_PSEAB RecName: Full=50S ribosomal protein L10
 gi|166230051|sp|A6UZH9|RL10_PSEA7 RecName: Full=50S ribosomal protein L10
 gi|226699988|sp|B7V635|RL10_PSEA8 RecName: Full=50S ribosomal protein L10
 gi|9950491|gb|AAG07660.1|AE004843_2 50S ribosomal protein L10 [Pseudomonas aeruginosa PAO1]
 gi|115587528|gb|ABJ13543.1| 50S ribosomal protein L10 [Pseudomonas aeruginosa UCBPP-PA14]
 gi|126169063|gb|EAZ54574.1| 50S ribosomal protein L10 [Pseudomonas aeruginosa C3719]
 gi|150962234|gb|ABR84259.1| 50S ribosomal protein L10 [Pseudomonas aeruginosa PA7]
 gi|218769623|emb|CAW25383.1| 50S ribosomal protein L10 [Pseudomonas aeruginosa LESB58]
 gi|310883732|gb|EFQ42326.1| 50S ribosomal protein L10 [Pseudomonas aeruginosa 39016]
          Length = 166

 Score = 76.3 bits (186), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 47/149 (31%), Positives = 82/149 (55%), Gaps = 1/149 (0%)

Query: 10  ISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRG 69
           ++E+++   ++ S VVA  +G++V  +  LRK+ REAG  VKV +N L+K A+  T    
Sbjct: 12  VAEVNEAAKAALSAVVADARGVTVGAMTGLRKEAREAGVYVKVVRNTLLKRAVEGTQFDV 71

Query: 70  ISDLFVGQSLIVYS-DSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASLPD 128
           ++D+F G +LI +S + P  A +I   F+   ++F +     E   L  + I  +ASLP 
Sbjct: 72  LNDVFKGPTLIAFSNEHPGAAARIFREFAKGQDKFEIKAAAFEGQFLAANQIDVLASLPT 131

Query: 129 LEGIRAGIISAIQSNATRLVRLLGTPQTQ 157
            +   + ++S IQ   ++L R L   + Q
Sbjct: 132 YDEAVSQLMSVIQGATSKLARTLAAIRDQ 160


>gi|322834823|ref|YP_004214850.1| ribosomal protein L10 [Rahnella sp. Y9602]
 gi|321170024|gb|ADW75723.1| ribosomal protein L10 [Rahnella sp. Y9602]
          Length = 165

 Score = 76.3 bits (186), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 47/159 (29%), Positives = 88/159 (55%), Gaps = 2/159 (1%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           +N Q K   ++E+ ++   + S VVA  +G++V ++ +LRK  REAG  ++V +N L++ 
Sbjct: 3   LNLQDKQAIVAEVIEVAKGALSAVVADSRGVTVDKMTELRKAGREAGVYMRVVRNTLMRR 62

Query: 61  AIRDTSIRGISDLFVGQSLIVYS-DSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
            +  T    + D FVG +LI +S + P  A ++   F+  N +F V     E   ++   
Sbjct: 63  VVEGTQFECLKDTFVGPTLIAFSTEHPGAAARLFKDFAKANAKFEVKAAAFEGEFISAAQ 122

Query: 120 IKQIASLPDLEGIRAGIISAI-QSNATRLVRLLGTPQTQ 157
           I ++A+LP  E   A +++ + +++A +LVR L   + Q
Sbjct: 123 IDRLATLPTYEEAIARLMATMKEASAGKLVRTLAAVRDQ 161


>gi|256821653|ref|YP_003145616.1| 50S ribosomal protein L10 [Kangiella koreensis DSM 16069]
 gi|256795192|gb|ACV25848.1| ribosomal protein L10 [Kangiella koreensis DSM 16069]
          Length = 175

 Score = 76.3 bits (186), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 45/168 (26%), Positives = 87/168 (51%), Gaps = 1/168 (0%)

Query: 4   QGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIR 63
           +GK   ++E++ +   + S VVA Y+G++V Q+  LR K RE+   V+V +N L + A+ 
Sbjct: 6   EGKKAIVTEVNTVAKDALSAVVAEYRGLTVEQMTALRVKARESNVYVRVIRNTLARRAVE 65

Query: 64  DTSIRGISDLFVGQSLIVYS-DSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQ 122
           +T    + D   G  +  +S D+P  A ++   F+ +N +  V G  +   +   + +  
Sbjct: 66  ETEFACMQDALTGPLVYAFSIDAPGAAARLFKDFAKENKQLEVTGIAIGGELHGPERLDA 125

Query: 123 IASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQ 170
           +A+LP  +   A ++  + +  T+L R      T+V R ++A  D+ Q
Sbjct: 126 VAALPTRDEALATLMMVMNAPITKLARTFKEVPTKVTRVVAAVRDQKQ 173


>gi|15643222|ref|NP_228266.1| 50S ribosomal protein L10 [Thermotoga maritima MSB8]
 gi|1350657|sp|P29394|RL10_THEMA RecName: Full=50S ribosomal protein L10
 gi|4980962|gb|AAD35539.1|AE001723_9 ribosomal protein L10 [Thermotoga maritima MSB8]
 gi|581803|emb|CAA77861.1| ribosomal protein L10 [Thermotoga maritima MSB8]
          Length = 179

 Score = 76.3 bits (186), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 49/178 (27%), Positives = 90/178 (50%), Gaps = 7/178 (3%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREA---GGGVKVAKNRL 57
           + RQ K + + E+S+IF  +  I+ A + G +VA + +LR ++RE    G   +V KN L
Sbjct: 2   LTRQQKELIVKEMSEIFKKTSLILFADFLGFTVADLTELRSRLREKYGDGARFRVVKNTL 61

Query: 58  VKIAIRDTSIRGISDLFVGQSLIVY--SDSPVIAPKISVSFSNDN--NEFRVLGGVVEKG 113
           + +A+++    G  +   G + ++Y     PV A KI  +F  D   +  R+ GG +E  
Sbjct: 62  LNLALKNAEYEGYEEFLKGPTAVLYVTEGDPVEAVKIIYNFYKDKKADLSRLKGGFLEGK 121

Query: 114 VLNQDSIKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQQ 171
               + ++ IA LP  E + A ++  +++  T LV  L      +V  ++A  +K  +
Sbjct: 122 KFTAEEVENIAKLPSKEELYAMLVGRVKAPITGLVFALSGILRNLVYVLNAIKEKKSE 179


>gi|73535857|pdb|1ZAV|A Chain A, Ribosomal Protein L10-L12(Ntd) Complex, Space Group P21
 gi|73535871|pdb|1ZAX|A Chain A, Ribosomal Protein L10-L12(Ntd) Complex, Space Group
           P212121, Form B
          Length = 180

 Score = 76.3 bits (186), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 49/178 (27%), Positives = 90/178 (50%), Gaps = 7/178 (3%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREA---GGGVKVAKNRL 57
           + RQ K + + E+S+IF  +  I+ A + G +VA + +LR ++RE    G   +V KN L
Sbjct: 3   LTRQQKELIVKEMSEIFKKTSLILFADFLGFTVADLTELRSRLREKYGDGARFRVVKNTL 62

Query: 58  VKIAIRDTSIRGISDLFVGQSLIVY--SDSPVIAPKISVSFSNDN--NEFRVLGGVVEKG 113
           + +A+++    G  +   G + ++Y     PV A KI  +F  D   +  R+ GG +E  
Sbjct: 63  LNLALKNAEYEGYEEFLKGPTAVLYVTEGDPVEAVKIIYNFYKDKKADLSRLKGGFLEGK 122

Query: 114 VLNQDSIKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQQ 171
               + ++ IA LP  E + A ++  +++  T LV  L      +V  ++A  +K  +
Sbjct: 123 KFTAEEVENIAKLPSKEELYAMLVGRVKAPITGLVFALSGILRNLVYVLNAIKEKKSE 180


>gi|206901282|ref|YP_002251086.1| 50S ribosomal protein L10 [Dictyoglomus thermophilum H-6-12]
 gi|226699938|sp|B5YEX8|RL10_DICT6 RecName: Full=50S ribosomal protein L10
 gi|206740385|gb|ACI19443.1| 50S ribosomal protein L10 [Dictyoglomus thermophilum H-6-12]
          Length = 178

 Score = 76.3 bits (186), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 46/173 (26%), Positives = 87/173 (50%), Gaps = 2/173 (1%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M +  K  ++ EL +   ++ +++   +KG+SVA +  LR K+R      +V KN L  +
Sbjct: 1   MPKPEKVQKVEELYQKMLNANALIFTEFKGLSVADLTQLRGKIRPLNAEYRVVKNTLALL 60

Query: 61  AIRDTSI-RGISDLFVGQSLIVYS-DSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQD 118
           AIR     + +   FVG + I Y    P    K  V ++ ++   +  GG++E  V + D
Sbjct: 61  AIRKIYPDKDLEKFFVGPTAITYCYGDPFGVLKALVDYAKEHELLKFKGGIIEGEVYSAD 120

Query: 119 SIKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQQ 171
            +K++A LP  E + + ++ AI +  + LV  L  P  ++V  + A   + ++
Sbjct: 121 EVKELAKLPPKEVLLSQVVGAISAPLSSLVWSLKWPVNKLVWTLDAIAKEKEK 173


>gi|153952851|ref|YP_001393616.1| 50S ribosomal protein L10 [Clostridium kluyveri DSM 555]
 gi|146345732|gb|EDK32268.1| RplJ [Clostridium kluyveri DSM 555]
          Length = 181

 Score = 76.3 bits (186), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 44/151 (29%), Positives = 79/151 (52%), Gaps = 1/151 (0%)

Query: 2   NRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIA 61
           N+  K  ++ E+      + SI+ A Y+G++V +  +LRK++RE+G   KV KN L   A
Sbjct: 19  NKALKQAKVEEIKDKMEKAESIIFAKYQGLTVEEDTNLRKELRESGVEYKVYKNTLSIRA 78

Query: 62  IRDTSIRGISDLFVGQSLIVYS-DSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
            ++     + D+FVG   I +  D P    +I   FS       + GGVV+  + + D +
Sbjct: 79  AKELGFDKLEDIFVGPVSIAFGYDEPTTPARILNDFSKKYKALELKGGVVQGEIFDVDKV 138

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLL 151
           KQ+A++P  E +   ++ + ++  +  V LL
Sbjct: 139 KQLATIPSKEVLIGKLLGSFKAPLSNFVYLL 169


>gi|172035140|ref|YP_001801641.1| 50S ribosomal protein L10 [Cyanothece sp. ATCC 51142]
 gi|254798373|sp|B1X074|RL10_CYAA5 RecName: Full=50S ribosomal protein L10
 gi|171696594|gb|ACB49575.1| 50S ribosomal protein L10 [Cyanothece sp. ATCC 51142]
          Length = 188

 Score = 75.9 bits (185), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 52/163 (31%), Positives = 87/163 (53%), Gaps = 2/163 (1%)

Query: 3   RQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAI 62
           R+ K+  I++L ++ S +   +V  Y+G+SVA+I +LR ++R +G   KV KN L++ AI
Sbjct: 5   RENKATVIADLKELLSEAQLGMVIDYQGLSVAEITELRNRLRPSGAICKVTKNTLMEQAI 64

Query: 63  R-DTSIRGISDLFVGQS-LIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
             D +   +++   G S  ++  D    A +   SF  D  +    GGV++   LN+D +
Sbjct: 65  TGDEAWEPMTNFLKGSSAFVLVKDDVGSAVRAYQSFKKDTKKTEFRGGVMQGQALNEDQV 124

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAIS 163
           K IA LP  E +   +  AI S AT+L   +    T + R I+
Sbjct: 125 KAIADLPSKEELIGQVAGAINSIATKLAVGVNEVPTSIGRGIN 167


>gi|126697630|ref|YP_001086527.1| 50S ribosomal protein L10 [Clostridium difficile 630]
 gi|254973721|ref|ZP_05270193.1| 50S ribosomal protein L10 [Clostridium difficile QCD-66c26]
 gi|255091111|ref|ZP_05320589.1| 50S ribosomal protein L10 [Clostridium difficile CIP 107932]
 gi|255099223|ref|ZP_05328200.1| 50S ribosomal protein L10 [Clostridium difficile QCD-63q42]
 gi|255305005|ref|ZP_05349177.1| 50S ribosomal protein L10 [Clostridium difficile ATCC 43255]
 gi|255312765|ref|ZP_05354348.1| 50S ribosomal protein L10 [Clostridium difficile QCD-76w55]
 gi|255515525|ref|ZP_05383201.1| 50S ribosomal protein L10 [Clostridium difficile QCD-97b34]
 gi|255648619|ref|ZP_05395521.1| 50S ribosomal protein L10 [Clostridium difficile QCD-37x79]
 gi|255654152|ref|ZP_05399561.1| 50S ribosomal protein L10 [Clostridium difficile QCD-23m63]
 gi|260681836|ref|YP_003213121.1| 50S ribosomal protein L10 [Clostridium difficile CD196]
 gi|260685434|ref|YP_003216567.1| 50S ribosomal protein L10 [Clostridium difficile R20291]
 gi|296449809|ref|ZP_06891577.1| 50S ribosomal protein L10 [Clostridium difficile NAP08]
 gi|296877873|ref|ZP_06901894.1| 50S ribosomal protein L10 [Clostridium difficile NAP07]
 gi|306518742|ref|ZP_07405089.1| 50S ribosomal protein L10 [Clostridium difficile QCD-32g58]
 gi|123067151|sp|Q18CE8|RL10_CLOD6 RecName: Full=50S ribosomal protein L10
 gi|115249067|emb|CAJ66878.1| 50S ribosomal protein L10 [Clostridium difficile]
 gi|260207999|emb|CBA60168.1| 50S ribosomal protein L10 [Clostridium difficile CD196]
 gi|260211450|emb|CBE01562.1| 50S ribosomal protein L10 [Clostridium difficile R20291]
 gi|296261353|gb|EFH08180.1| 50S ribosomal protein L10 [Clostridium difficile NAP08]
 gi|296431127|gb|EFH16953.1| 50S ribosomal protein L10 [Clostridium difficile NAP07]
          Length = 168

 Score = 75.9 bits (185), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 46/148 (31%), Positives = 84/148 (56%), Gaps = 2/148 (1%)

Query: 6   KSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDT 65
           KS  +SE+ +    S + VV  YKG++V ++ +LRK+MREAG   KV KN LV+ A ++ 
Sbjct: 8   KSEVVSEIVEKLQKSSAAVVVDYKGLTVEEVTELRKQMREAGVDYKVYKNTLVRRAAKEV 67

Query: 66  SIRGISD-LFVGQSLIVY-SDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQI 123
            I   +D L VG + I +  D PV   +I   F + + + ++  G+VE    ++  I ++
Sbjct: 68  GIEQFNDELLVGTNAIAFGYDDPVAPARILKGFMDSHPKMKLKMGIVEGAFYDESKIVEM 127

Query: 124 ASLPDLEGIRAGIISAIQSNATRLVRLL 151
           A++P  E + A ++ ++++  +    L+
Sbjct: 128 ANIPSREVLIAKLLGSLKAPVSNFAYLI 155


>gi|219853516|ref|YP_002470638.1| hypothetical protein CKR_0173 [Clostridium kluyveri NBRC 12016]
 gi|219567240|dbj|BAH05224.1| hypothetical protein [Clostridium kluyveri NBRC 12016]
          Length = 166

 Score = 75.9 bits (185), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 44/151 (29%), Positives = 79/151 (52%), Gaps = 1/151 (0%)

Query: 2   NRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIA 61
           N+  K  ++ E+      + SI+ A Y+G++V +  +LRK++RE+G   KV KN L   A
Sbjct: 4   NKALKQAKVEEIKDKMEKAESIIFAKYQGLTVEEDTNLRKELRESGVEYKVYKNTLSIRA 63

Query: 62  IRDTSIRGISDLFVGQSLIVY-SDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
            ++     + D+FVG   I +  D P    +I   FS       + GGVV+  + + D +
Sbjct: 64  AKELGFDKLEDIFVGPVSIAFGYDEPTTPARILNDFSKKYKALELKGGVVQGEIFDVDKV 123

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLL 151
           KQ+A++P  E +   ++ + ++  +  V LL
Sbjct: 124 KQLATIPSKEVLIGKLLGSFKAPLSNFVYLL 154


>gi|66047784|ref|YP_237625.1| 50S ribosomal protein L10 [Pseudomonas syringae pv. syringae B728a]
 gi|71735526|ref|YP_276715.1| 50S ribosomal protein L10 [Pseudomonas syringae pv. phaseolicola
           1448A]
 gi|289623858|ref|ZP_06456812.1| 50S ribosomal protein L10 [Pseudomonas syringae pv. aesculi str.
           NCPPB3681]
 gi|289648951|ref|ZP_06480294.1| 50S ribosomal protein L10 [Pseudomonas syringae pv. aesculi str.
           2250]
 gi|289675476|ref|ZP_06496366.1| 50S ribosomal protein L10 [Pseudomonas syringae pv. syringae FF5]
 gi|298489105|ref|ZP_07007127.1| LSU ribosomal protein L10p (P0) [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
 gi|302189268|ref|ZP_07265941.1| 50S ribosomal protein L10 [Pseudomonas syringae pv. syringae 642]
 gi|75500407|sp|Q4ZMN5|RL10_PSEU2 RecName: Full=50S ribosomal protein L10
 gi|97181845|sp|Q48D27|RL10_PSE14 RecName: Full=50S ribosomal protein L10
 gi|63258491|gb|AAY39587.1| Ribosomal protein L10 [Pseudomonas syringae pv. syringae B728a]
 gi|71556079|gb|AAZ35290.1| ribosomal protein L10 [Pseudomonas syringae pv. phaseolicola 1448A]
 gi|298156417|gb|EFH97515.1| LSU ribosomal protein L10p (P0) [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
 gi|320331989|gb|EFW87925.1| 50S ribosomal protein L10 [Pseudomonas syringae pv. glycinea str.
           race 4]
 gi|330869440|gb|EGH04149.1| 50S ribosomal protein L10 [Pseudomonas syringae pv. aesculi str.
           0893_23]
 gi|330879354|gb|EGH13503.1| 50S ribosomal protein L10 [Pseudomonas syringae pv. glycinea str.
           race 4]
 gi|330891940|gb|EGH24601.1| 50S ribosomal protein L10 [Pseudomonas syringae pv. mori str.
           301020]
 gi|330899745|gb|EGH31164.1| 50S ribosomal protein L10 [Pseudomonas syringae pv. japonica str.
           M301072PT]
 gi|330940872|gb|EGH43831.1| 50S ribosomal protein L10 [Pseudomonas syringae pv. pisi str.
           1704B]
 gi|330969831|gb|EGH69897.1| 50S ribosomal protein L10 [Pseudomonas syringae pv. aceris str.
           M302273PT]
 gi|330976631|gb|EGH76675.1| 50S ribosomal protein L10 [Pseudomonas syringae pv. aptata str. DSM
           50252]
          Length = 166

 Score = 75.9 bits (185), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 46/149 (30%), Positives = 81/149 (54%), Gaps = 1/149 (0%)

Query: 10  ISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRG 69
           ++E+++   +  S VVA  +G++V  +  LRK+ REAG  V+V +N L+K A+ DT    
Sbjct: 12  VAEVNEAAKAGLSAVVADARGVTVGAMTGLRKEAREAGVYVRVVRNTLLKRAVADTEFSV 71

Query: 70  ISDLFVGQSLIVYS-DSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASLPD 128
           ++D+F G +LI +S + P  A ++   F+   ++F +     E   L  + I  +ASLP 
Sbjct: 72  LNDVFTGPTLIAFSNEHPGAAARLFKEFAKGQDKFEIKAAAFEGKFLAANQIDVLASLPT 131

Query: 129 LEGIRAGIISAIQSNATRLVRLLGTPQTQ 157
                + ++S IQ   ++L R L   + Q
Sbjct: 132 RNEAISQLMSVIQGATSKLARTLAAVRDQ 160


>gi|319897825|ref|YP_004136022.1| 50S ribosomal subunit protein l10 [Haemophilus influenzae F3031]
 gi|317433331|emb|CBY81708.1| 50S ribosomal subunit protein L10 [Haemophilus influenzae F3031]
          Length = 163

 Score = 75.9 bits (185), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 51/177 (28%), Positives = 93/177 (52%), Gaps = 22/177 (12%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           +N Q K   ++E+++    + S V+A  +G++V ++ +LRK  REAG  ++V +N L++ 
Sbjct: 3   LNLQDKQAIVAEVNEAAKGALSAVIADSRGVTVEKMTELRKSAREAGVTMRVVRNTLLRR 62

Query: 61  AIRDTSIRGISDLFVGQSLIVYS-DSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
           A+  T    + D FVG +LI +S + P  A ++   F+  N++F + G   E  +  QD 
Sbjct: 63  AVEGTGYECLKDTFVGPTLIAFSNEHPGAAARLFKEFAKANDKFEIKGAAFEGKI--QD- 119

Query: 120 IKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQT----QVVRAISAFVDKNQQG 172
           ++ +A+LP  E                + RL+GT +     ++VR  +A  DK Q+ 
Sbjct: 120 VEFLATLPTYE--------------EAIARLMGTMKEAAAGKLVRTFAALRDKLQEA 162


>gi|52840565|ref|YP_094364.1| 50S ribosomal protein L10 [Legionella pneumophila subsp.
           pneumophila str. Philadelphia 1]
 gi|54293312|ref|YP_125727.1| 50S ribosomal protein L10 [Legionella pneumophila str. Lens]
 gi|54296356|ref|YP_122725.1| 50S ribosomal protein L10 [Legionella pneumophila str. Paris]
 gi|296105869|ref|YP_003617569.1| large subunit ribosomal protein L10 [Legionella pneumophila 2300/99
           Alcoy]
 gi|61214772|sp|Q5WZM1|RL10_LEGPL RecName: Full=50S ribosomal protein L10
 gi|61214782|sp|Q5X868|RL10_LEGPA RecName: Full=50S ribosomal protein L10
 gi|61214807|sp|Q5ZYQ2|RL10_LEGPH RecName: Full=50S ribosomal protein L10
 gi|52627676|gb|AAU26417.1| 50S ribosomal protein L10 [Legionella pneumophila subsp.
           pneumophila str. Philadelphia 1]
 gi|53750141|emb|CAH11533.1| 50S ribosomal subunit protein L10 [Legionella pneumophila str.
           Paris]
 gi|53753144|emb|CAH14591.1| 50S ribosomal subunit protein L10 [Legionella pneumophila str.
           Lens]
 gi|295647770|gb|ADG23617.1| large subunit ribosomal protein L10 [Legionella pneumophila 2300/99
           Alcoy]
 gi|307609129|emb|CBW98575.1| 50S ribosomal subunit protein L10 [Legionella pneumophila 130b]
          Length = 177

 Score = 75.9 bits (185), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 45/169 (26%), Positives = 88/169 (52%), Gaps = 1/169 (0%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           +N   K   + E++ + S + S VVA Y+G++V Q+  LR + R++G  ++V +N L + 
Sbjct: 3   LNLAAKKAVVEEVTAVASKAISAVVADYRGLTVNQMTQLRSEARKSGVYLRVVRNTLTRR 62

Query: 61  AIRDTSIRGISDLFVGQSLIVYS-DSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
           A ++T    ++DL VG   I  S ++P  A ++   ++    +  +    V   V N + 
Sbjct: 63  AFKNTEFECLNDLLVGPVFIALSLEAPSDAARLLKDYAKTFEKLEIRALSVGGKVYNANQ 122

Query: 120 IKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDK 168
           I  +ASLP  +   + ++  +++   + VR L  P  ++ R ++A  DK
Sbjct: 123 IDAVASLPTRDEAISKLMYVMKAPIEKFVRTLAEPHAKLARTLAAVKDK 171


>gi|239929531|ref|ZP_04686484.1| 50S ribosomal protein L10 [Streptomyces ghanaensis ATCC 14672]
 gi|291437857|ref|ZP_06577247.1| ribosomal protein L10 [Streptomyces ghanaensis ATCC 14672]
 gi|291340752|gb|EFE67708.1| ribosomal protein L10 [Streptomyces ghanaensis ATCC 14672]
          Length = 176

 Score = 75.9 bits (185), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 50/174 (28%), Positives = 90/174 (51%), Gaps = 3/174 (1%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M R  K+  ++EL+  F SS + V+  Y+G++VAQ+K LR+ + E      V KN L KI
Sbjct: 1   MARPDKAAAVAELTDKFRSSNAAVLTEYRGLTVAQLKTLRRSLGE-NAQYAVVKNTLTKI 59

Query: 61  AIRDTSIRGISDLFVGQSLIVY-SDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
           A  +  I     LF G + + + +  PV + K    F+ +N    + GGV++   L+ D 
Sbjct: 60  AANEAGITLDDQLFAGPTAVAFVTGDPVESAKGLRDFAKENPNLVIKGGVLDGKALSADE 119

Query: 120 IKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAF-VDKNQQG 172
           IK++A L   E + + +  A +   ++   +     +++VR + A    +++QG
Sbjct: 120 IKKLADLESREVLLSKLAGAFKGKQSQAASVFQALPSKLVRTVDALRAKQDEQG 173


>gi|325576517|ref|ZP_08147270.1| 50S ribosomal protein L10 [Haemophilus parainfluenzae ATCC 33392]
 gi|325161207|gb|EGC73321.1| 50S ribosomal protein L10 [Haemophilus parainfluenzae ATCC 33392]
          Length = 163

 Score = 75.9 bits (185), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 51/177 (28%), Positives = 93/177 (52%), Gaps = 22/177 (12%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           +N Q K   ++E+++    + S V+A  +G++V ++ +LRK  REAG  ++V +N L++ 
Sbjct: 3   LNLQDKQAIVAEVNEAAKGALSAVIADSRGVTVDKMTELRKAAREAGVTMRVVRNTLLRR 62

Query: 61  AIRDTSIRGISDLFVGQSLIVYS-DSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
           A+  T    + D FVG +LI +S + P  A ++   F+  N++F + G   E  +  QD 
Sbjct: 63  AVEGTDFECLQDTFVGPTLIAFSNEHPGAAARLFKDFAKANDKFEIKGAAFEGKI--QD- 119

Query: 120 IKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQT----QVVRAISAFVDKNQQG 172
           ++ +A+LP  E                + RL+GT +     ++VR  +A  DK Q+ 
Sbjct: 120 VEFLATLPTYE--------------EAIARLMGTMKEAAAGKLVRTFAALRDKLQEA 162


>gi|260222518|emb|CBA32161.1| 50S ribosomal protein L10 [Curvibacter putative symbiont of Hydra
           magnipapillata]
          Length = 175

 Score = 75.9 bits (185), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 48/157 (30%), Positives = 85/157 (54%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           +NR  K   IS+++ + + + ++V+A Y+GI+VA +  LR   R AG  + V KN L + 
Sbjct: 3   LNRSEKEAVISDVTGLAAKAQTLVIAEYRGITVADMTKLRNTARSAGVSLSVLKNTLARR 62

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A+  +S   +SD   G  +  +S+  V A K+   F+  N++  + GG      L+ + +
Sbjct: 63  AVAGSSFEVVSDQMTGPLIYGFSEDAVAAAKVVAEFAKTNDKLVIRGGAYGGKALDVNGV 122

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQ 157
           KQ+AS+P  E + A ++  +QS  +R  R+L     Q
Sbjct: 123 KQLASIPSKEVLLAQLLGLMQSPISRTARVLAALAEQ 159


>gi|240143816|ref|ZP_04742417.1| ribosomal protein L10 [Roseburia intestinalis L1-82]
 gi|257204189|gb|EEV02474.1| ribosomal protein L10 [Roseburia intestinalis L1-82]
          Length = 187

 Score = 75.9 bits (185), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 44/143 (30%), Positives = 75/143 (52%), Gaps = 1/143 (0%)

Query: 10  ISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRG 69
           + E+S+    + S+VV  Y+G++VA+   LRK +REAG   KV KN LV  A+  T    
Sbjct: 11  VQEISENIKDAQSVVVVDYRGLTVAEDTQLRKALREAGVTYKVYKNTLVSRAVEGTQFES 70

Query: 70  ISDLFVGQSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASLPD 128
           + D+  G +    S     AP ++   F+       +  GVVE    ++  +K +A++P 
Sbjct: 71  LRDVLEGPNAFAISTEDATAPARVLAKFAKTAPALEIKAGVVEGTYYDEAGMKAVAAVPS 130

Query: 129 LEGIRAGIISAIQSNATRLVRLL 151
            E + + ++ ++QS  T L R+L
Sbjct: 131 REELLSKLLGSLQSPITNLARVL 153


>gi|307543816|ref|YP_003896295.1| 50S ribosomal protein L10 [Halomonas elongata DSM 2581]
 gi|307215840|emb|CBV41110.1| 50S ribosomal protein L10 [Halomonas elongata DSM 2581]
          Length = 167

 Score = 75.9 bits (185), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 47/156 (30%), Positives = 86/156 (55%), Gaps = 2/156 (1%)

Query: 4   QGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIR 63
           +GK   ++E+S+    + S+VVA  +G+SV ++ DLRK+ RE G  ++V +N L + A+ 
Sbjct: 6   EGKKAIVAEVSEAAKDALSVVVADSRGVSVDKMTDLRKQARENGVQIRVVRNTLARRALE 65

Query: 64  DTSIRGISDLFVGQSLIVYS-DSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQ 122
            T    +++ FVG +L+ +S D P  A ++   F     EF V     E   +    + +
Sbjct: 66  GTQWECLNESFVGPTLLAFSTDHPGAAARLFKEFGKTEKEFEVKALAYEGEFIPASDLDR 125

Query: 123 IASLPDLEGIRAGIISAI-QSNATRLVRLLGTPQTQ 157
           +A+LP  +   A ++S + +++A +LVR L   + Q
Sbjct: 126 LATLPTHDEAIAKLMSVMKEASAGKLVRTLAALRDQ 161


>gi|90020569|ref|YP_526396.1| 50S ribosomal protein L10 [Saccharophagus degradans 2-40]
 gi|123396505|sp|Q21M95|RL10_SACD2 RecName: Full=50S ribosomal protein L10
 gi|89950169|gb|ABD80184.1| LSU ribosomal protein L10P [Saccharophagus degradans 2-40]
          Length = 176

 Score = 75.9 bits (185), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 49/168 (29%), Positives = 89/168 (52%), Gaps = 1/168 (0%)

Query: 4   QGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIR 63
           + K   ++E+++  +++ S+VVA  +G++V  +  LRK+ RE+G  ++V +N L K AI 
Sbjct: 6   EDKKAIVAEVNETAANALSLVVADARGVTVGAMDTLRKQARESGVRLQVVRNTLAKRAIE 65

Query: 64  DTSIRGISDLFVGQSLIVYS-DSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQ 122
            T    + D  VG S+  +S + P  A ++   F+ + ++F +    V   +L    I  
Sbjct: 66  GTDFECVKDALVGPSIFGFSMEDPGAAARLFKDFAKEQSKFEIKALSVGGKLLEAGQIDA 125

Query: 123 IASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQ 170
           +A LP LE     + S + +  T+LVR      T+V R ++A  D+ Q
Sbjct: 126 LAKLPTLEQALGQLASVMIAPVTKLVRTFNEVPTKVTRVVAAVRDQKQ 173


>gi|301155464|emb|CBW14930.1| 50S ribosomal subunit protein L10 [Haemophilus parainfluenzae T3T1]
          Length = 163

 Score = 75.9 bits (185), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 51/177 (28%), Positives = 93/177 (52%), Gaps = 22/177 (12%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           +N Q K   ++E+++    + S V+A  +G++V ++ +LRK  REAG  ++V +N L++ 
Sbjct: 3   LNLQDKQAIVAEVNEAAKGALSAVIADSRGVTVDKMTELRKAAREAGVTMRVVRNTLLRR 62

Query: 61  AIRDTSIRGISDLFVGQSLIVYS-DSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
           A+  T    + D FVG +LI +S + P  A ++   F+  N++F + G   E  +  QD 
Sbjct: 63  AVEGTDFECLQDTFVGPTLIAFSHEHPGAAARLFKDFAKANDKFEIKGAAFEGKI--QD- 119

Query: 120 IKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQT----QVVRAISAFVDKNQQG 172
           ++ +A+LP  E                + RL+GT +     ++VR  +A  DK Q+ 
Sbjct: 120 VEFLATLPTYE--------------EAIARLMGTMKEAAAGKLVRTFAALRDKLQEA 162


>gi|57234278|ref|YP_181714.1| 50S ribosomal protein L10 [Dehalococcoides ethenogenes 195]
 gi|97181626|sp|Q3Z7T5|RL10_DEHE1 RecName: Full=50S ribosomal protein L10
 gi|57224726|gb|AAW39783.1| ribosomal protein L10 [Dehalococcoides ethenogenes 195]
          Length = 176

 Score = 75.9 bits (185), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 45/154 (29%), Positives = 83/154 (53%), Gaps = 2/154 (1%)

Query: 3   RQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAI 62
           R+ K + + EL+   + + S V   Y+GIS +++  +R K+REAG G +V KN L + A 
Sbjct: 6   REKKKIAVDELTDALAVAQSAVFTDYRGISTSELTTIRMKLREAGVGYRVLKNTLARRAA 65

Query: 63  RDTSIRGISDLFVGQSLIVYSDSPVIAP-KISVSF-SNDNNEFRVLGGVVEKGVLNQDSI 120
            +T    I   F G   + YS S V+AP K+ + + +   +  +V GG +   +++ + +
Sbjct: 66  DNTDHANIKSAFEGPVAMAYSSSDVVAPAKVLMDYLAGSKSTLKVTGGYLSNKLISVEEV 125

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTP 154
            ++A LP  E + + +++ +QS    L  +L  P
Sbjct: 126 AELAKLPSREVLISKVLAGMQSPIAGLAMVLNGP 159


>gi|158319533|ref|YP_001512040.1| ribosomal protein L10 [Alkaliphilus oremlandii OhILAs]
 gi|226699902|sp|A8MLD0|RL10_ALKOO RecName: Full=50S ribosomal protein L10
 gi|158139732|gb|ABW18044.1| ribosomal protein L10 [Alkaliphilus oremlandii OhILAs]
          Length = 167

 Score = 75.9 bits (185), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 44/148 (29%), Positives = 84/148 (56%), Gaps = 3/148 (2%)

Query: 6   KSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDT 65
           K  +++E++     S S +V  Y+G+ V ++ +LRK+ RE G   KV KN L ++A  + 
Sbjct: 8   KKEQVAEITDKLQRSASAIVVDYRGLKVEEVTELRKQCREKGLEYKVYKNTLTRLAAENA 67

Query: 66  SIRGISDLFVGQSLIVYS-DSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDS-IKQI 123
            ++ +    VG + IV+S D PV A K++  F+  +    +  G+VE GVL +D+ +++ 
Sbjct: 68  GMKELVGELVGPNAIVFSYDDPVAAAKVASEFAKTHKNLELKAGLVE-GVLYKDAQLEEF 126

Query: 124 ASLPDLEGIRAGIISAIQSNATRLVRLL 151
           AS+P  E + A ++ + ++  +    L+
Sbjct: 127 ASIPSREVLIAKLLGSFKAPISNFAYLI 154


>gi|283798911|ref|ZP_06348064.1| ribosomal protein L10 [Clostridium sp. M62/1]
 gi|291073374|gb|EFE10738.1| ribosomal protein L10 [Clostridium sp. M62/1]
 gi|295092667|emb|CBK78774.1| LSU ribosomal protein L10P [Clostridium cf. saccharolyticum K10]
 gi|295115911|emb|CBL36758.1| LSU ribosomal protein L10P [butyrate-producing bacterium SM4/1]
          Length = 162

 Score = 75.9 bits (185), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 41/143 (28%), Positives = 77/143 (53%), Gaps = 1/143 (0%)

Query: 10  ISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRG 69
           ++E+S++F+ + S VV  Y+G++V Q   LRK++REAG   KV KN +++ A + T    
Sbjct: 11  VAEISELFNGAKSAVVVDYRGLTVEQDTQLRKQLREAGVTYKVYKNTMIRFAAKGTEFEA 70

Query: 70  ISDLFVGQSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASLPD 128
           +     G + +  S     AP ++   F+   ++  +  GVVE    ++  I+ IA++P 
Sbjct: 71  LEPHLEGPTALAVSKEDATAPARVLAEFAKKADKLELKAGVVEGTYYDEKGIQVIATIPS 130

Query: 129 LEGIRAGIISAIQSNATRLVRLL 151
            E +   ++ +IQS      R++
Sbjct: 131 REILLGKLLGSIQSPIANFARVI 153


>gi|126659909|ref|ZP_01731033.1| 50S ribosomal protein L10 [Cyanothece sp. CCY0110]
 gi|126618773|gb|EAZ89518.1| 50S ribosomal protein L10 [Cyanothece sp. CCY0110]
          Length = 188

 Score = 75.9 bits (185), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 52/163 (31%), Positives = 87/163 (53%), Gaps = 2/163 (1%)

Query: 3   RQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAI 62
           R+ K+  I++L ++ S +   +V  Y+G+SVA+I +LR ++R +G   KV KN L++ AI
Sbjct: 5   RENKATVIADLKELLSEAQLGMVIDYQGLSVAEISELRNRLRPSGAICKVTKNTLMEQAI 64

Query: 63  R-DTSIRGISDLFVGQS-LIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
             D +   +++   G S  ++  D    A +   SF  D  +    GGV++   LN+D +
Sbjct: 65  TGDEAWEPMTNFLNGSSAFVLVKDDVGSAVRAYQSFKKDTKKTEFRGGVMQGQALNEDQV 124

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAIS 163
           K IA LP  E +   +  AI S AT+L   +    T + R I+
Sbjct: 125 KAIADLPSKEELIGQVAGAINSIATKLAVGVNEVPTSIGRGIN 167


>gi|56459454|ref|YP_154735.1| 50S ribosomal protein L10 [Idiomarina loihiensis L2TR]
 gi|61214740|sp|Q5QWA7|RL10_IDILO RecName: Full=50S ribosomal protein L10
 gi|56178464|gb|AAV81186.1| Ribosomal protein L10 [Idiomarina loihiensis L2TR]
          Length = 172

 Score = 75.9 bits (185), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 46/164 (28%), Positives = 85/164 (51%), Gaps = 1/164 (0%)

Query: 5   GKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRD 64
           GK   + E++ + S++ ++ VA Y+GI VA +  LRKK RE G  VKV +N L K A   
Sbjct: 7   GKKAIVKEVNDVASNALAVTVAEYRGIEVADMTALRKKAREQGIFVKVVRNTLAKRAFEG 66

Query: 65  TSIRGISDLFVGQSLIVYS-DSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQI 123
           T    + D   G  +  +S D+P  + ++   FS +N   +V    +  G++  + +  +
Sbjct: 67  TQFDDMGDALKGPLVYGFSMDAPGASARLFKDFSKENKNLQVTALSIGNGIMGPEKLDAV 126

Query: 124 ASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVD 167
           ASLP  +   A +++  +   ++ V+ +    ++ VR ++A  D
Sbjct: 127 ASLPTRDEALAKLLATFKEPVSKFVKTVNEVPSKFVRTLAAIKD 170


>gi|162448678|ref|YP_001611045.1| 50S ribosomal protein L10 [Sorangium cellulosum 'So ce 56']
 gi|189040937|sp|A9GRA5|RL10_SORC5 RecName: Full=50S ribosomal protein L10
 gi|161159260|emb|CAN90565.1| 50S ribosomal protein L10 [Sorangium cellulosum 'So ce 56']
          Length = 176

 Score = 75.9 bits (185), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 44/157 (28%), Positives = 87/157 (55%), Gaps = 3/157 (1%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M R  K V I  + + F    S V   +KG++V  +  LR + R++G   +V KN LV+ 
Sbjct: 1   MERSQKEVLIGSVRQKFERMSSAVFLDFKGMNVEAVTKLRDEFRKSGVEYRVVKNTLVRH 60

Query: 61  AIRDTSI-RGISDLFVGQSLIVYS-DSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQD 118
           AI++    + +S    G + + +S + P  A K+  +F  DN + ++  G++E  +L+ D
Sbjct: 61  AIKEHPWAKTLSKSLTGMTGVAWSYEDPSAAAKVVKAFRKDNQKLQIKAGLIEGQILSGD 120

Query: 119 SIK-QIASLPDLEGIRAGIISAIQSNATRLVRLLGTP 154
           +++ Q+A++P  + +RA +++ +Q+   + V+ L  P
Sbjct: 121 AVETQLATMPGKDELRATLLATLQAPLQQFVQQLNAP 157


>gi|315651734|ref|ZP_07904739.1| 50S ribosomal protein L10 [Eubacterium saburreum DSM 3986]
 gi|315485989|gb|EFU76366.1| 50S ribosomal protein L10 [Eubacterium saburreum DSM 3986]
          Length = 164

 Score = 75.9 bits (185), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 45/143 (31%), Positives = 76/143 (53%), Gaps = 1/143 (0%)

Query: 10  ISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRG 69
           + E++++   + + VV  Y+G+S  Q   LRK++REAG   KV KN +++IA + T    
Sbjct: 11  VKEIAELLDGAQAAVVVDYRGLSAEQDTRLRKELREAGVTYKVYKNTMIRIAAKGTPFES 70

Query: 70  ISDLFVGQSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASLPD 128
           +     G + I  S     AP +I  +FS    +  +  GVV+    +QD IK IA++P 
Sbjct: 71  LDSSLEGPTAIAVSKEDATAPARILYNFSKTAPDLELKAGVVDGVTYDQDGIKVIATVPS 130

Query: 129 LEGIRAGIISAIQSNATRLVRLL 151
            + +   ++ +IQS  T   R+L
Sbjct: 131 RDELIGRLLGSIQSPITNFARVL 153


>gi|299143235|ref|ZP_07036315.1| ribosomal protein L10 [Peptoniphilus sp. oral taxon 386 str. F0131]
 gi|298517720|gb|EFI41459.1| ribosomal protein L10 [Peptoniphilus sp. oral taxon 386 str. F0131]
          Length = 179

 Score = 75.5 bits (184), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 44/149 (29%), Positives = 80/149 (53%), Gaps = 1/149 (0%)

Query: 4   QGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIR 63
           Q K+  + E+ +   ++ SIV+ +Y+G++V ++ +LR K R A    KV KN +++ A  
Sbjct: 7   QMKTQTVDEIKEKIEAAKSIVLVNYRGLNVEEVTELRTKYRAANVDYKVYKNTMMRRAFE 66

Query: 64  DTSIRGISDLFVGQSLIVYS-DSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQ 122
           +    G+ +   G S + +S + PV A KIS  F+ D+ E  +  G+V+  V+    I  
Sbjct: 67  ELGFDGVLEFLKGPSAVAFSMEDPVSAAKISSEFAKDHEELEIKSGIVDGKVITVKEIDD 126

Query: 123 IASLPDLEGIRAGIISAIQSNATRLVRLL 151
           +A LP  E + A ++  + +    LV +L
Sbjct: 127 LAKLPPKEVLIAQVLGGLNAPIQGLVNVL 155


>gi|262273341|ref|ZP_06051156.1| LSU ribosomal protein L10p (P0) [Grimontia hollisae CIP 101886]
 gi|262222714|gb|EEY74024.1| LSU ribosomal protein L10p (P0) [Grimontia hollisae CIP 101886]
          Length = 162

 Score = 75.5 bits (184), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 49/159 (30%), Positives = 87/159 (54%), Gaps = 5/159 (3%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           +N Q K   ++E+++  S + S VVA  +G++V  + +LRK+ REAG  +KV +N L + 
Sbjct: 3   LNLQDKKAIVAEVNEAASGALSAVVADSRGVTVGAMTNLRKQAREAGVYMKVVRNTLARR 62

Query: 61  AIRDTSIRGISDLFVGQSLIVYS-DSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
           A+  T    + D+FVG +LI +S + P  A ++   F+ +N  F +     E G L    
Sbjct: 63  AVEGTDYECLKDVFVGPTLIAFSTEHPGAAARLFKDFAKENKNFEIKAAAFE-GALTDAE 121

Query: 120 IKQIASLPDL-EGIRAGIISAIQSNATRLVRLLGTPQTQ 157
           +  +A+LP   E I   ++   +++A +LVR +   + Q
Sbjct: 122 V--LATLPTYDEAIARLMMCMKEASAGKLVRTIAAIRDQ 158


>gi|331701819|ref|YP_004398778.1| 50S ribosomal protein L10 [Lactobacillus buchneri NRRL B-30929]
 gi|329129162|gb|AEB73715.1| 50S ribosomal protein L10 [Lactobacillus buchneri NRRL B-30929]
          Length = 170

 Score = 75.5 bits (184), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 43/166 (25%), Positives = 90/166 (54%), Gaps = 12/166 (7%)

Query: 6   KSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDT 65
           K+ +++ +++   ++ S+V+ +Y+G++VA++ DLR+++R+ G  ++V KN+++  A  + 
Sbjct: 9   KAKKVASVTEELKNASSVVIINYRGLTVAEVTDLRQQLRDEGVKMEVIKNKVMDRAAAEA 68

Query: 66  SIRGISDLFVGQSLIVY-SDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIA 124
               +   F G + +V+ S+ PV  PKI  +F+  N++ ++ GGV++  V + + I   A
Sbjct: 69  GFDDLKPTFNGPTAVVFSSEDPVAGPKIVHNFAKTNDKLKLKGGVIDGEVASLEEITAYA 128

Query: 125 SLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQ 170
           +LP  E +            + L  +L  P       + A  DK Q
Sbjct: 129 ALPSREEL-----------LSTLANILQAPVRNFAYGVKAIADKKQ 163


>gi|119025302|ref|YP_909147.1| 50S ribosomal protein L10 [Bifidobacterium adolescentis ATCC 15703]
 gi|154486703|ref|ZP_02028110.1| hypothetical protein BIFADO_00524 [Bifidobacterium adolescentis
           L2-32]
 gi|166229708|sp|A1A032|RL10_BIFAA RecName: Full=50S ribosomal protein L10
 gi|118764886|dbj|BAF39065.1| 50S ribosomal protein L10 [Bifidobacterium adolescentis ATCC 15703]
 gi|154084566|gb|EDN83611.1| hypothetical protein BIFADO_00524 [Bifidobacterium adolescentis
           L2-32]
          Length = 173

 Score = 75.5 bits (184), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 54/177 (30%), Positives = 88/177 (49%), Gaps = 10/177 (5%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKM-REAGGGVKVAKNRLVK 59
           M R  K   +++L+  F ++ +I +  Y+G++V QI +LR+K+ R+      VAKN LV+
Sbjct: 1   MKRPEKEAVVAQLTDKFRNADAIYLTEYRGLTVPQISELREKLGRDT--SYTVAKNTLVR 58

Query: 60  IAIRDTSIRGISDLFVGQSLIVYSDSPVI-APKISVSFSNDNNEFRVLGGVVEKGVLNQD 118
           IA ++  I G+ +L  G + + +     I A K    F+  N    + GG  +  V + +
Sbjct: 59  IAAKEAGIEGLDELLAGPTAVTFVKGDFIEAAKTLRDFAKTNKALIIKGGFADGTVYDAE 118

Query: 119 SIKQIASL---PDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQQG 172
             K++A L   P L    AG I A  S A  L   L    T+ VR I A  +K ++ 
Sbjct: 119 GAKKLADLKSRPQLLAEFAGDIKATMSKAAYLFNAL---PTKAVRTIDALREKQEKA 172


>gi|152977730|ref|YP_001343359.1| 50S ribosomal protein L10 [Actinobacillus succinogenes 130Z]
 gi|171472910|sp|A6VKC7|RL10_ACTSZ RecName: Full=50S ribosomal protein L10
 gi|150839453|gb|ABR73424.1| ribosomal protein L10 [Actinobacillus succinogenes 130Z]
          Length = 163

 Score = 75.5 bits (184), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 51/177 (28%), Positives = 92/177 (51%), Gaps = 22/177 (12%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           +N Q K   ++E+++    + S V+A  +G++V ++ +LRK  REAG  ++V +N L++ 
Sbjct: 3   LNLQDKQAIVAEVNEAAKGALSAVIADSRGVTVDKMTELRKAAREAGVSMRVVRNTLLRR 62

Query: 61  AIRDTSIRGISDLFVGQSLIVYS-DSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
           A+  T    ++D F G +LI +S + P  A ++   F+  N++F + G   E  +  QD 
Sbjct: 63  AVEGTEFECLTDTFTGPTLIAFSNEHPGAAARLFKDFAKANDKFEIKGAAFEGKI--QD- 119

Query: 120 IKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQT----QVVRAISAFVDKNQQG 172
           I  +A+LP  E                + RL+GT +     ++VR  +A  DK Q+ 
Sbjct: 120 IDFLATLPTYE--------------EAIARLMGTMKEAAAGKLVRTFAALRDKLQEA 162


>gi|85712787|ref|ZP_01043831.1| Ribosomal protein L10 [Idiomarina baltica OS145]
 gi|85693427|gb|EAQ31381.1| Ribosomal protein L10 [Idiomarina baltica OS145]
          Length = 172

 Score = 75.5 bits (184), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 45/164 (27%), Positives = 86/164 (52%), Gaps = 1/164 (0%)

Query: 5   GKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRD 64
           GK   + E++ + S++ ++ VA Y+GI VA +  LRKK RE G  +KV +N L K A   
Sbjct: 7   GKKAIVKEVNDVASNALAVTVAEYRGIEVADMTALRKKAREQGVFLKVVRNTLAKRAFEG 66

Query: 65  TSIRGISDLFVGQSLIVYS-DSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQI 123
           T    +S+   G  +  +S D+P  + ++   FS +N   +V    +  G++  + +  +
Sbjct: 67  TQFEDMSEALKGPLVYGFSLDAPGASARLFKDFSKENKNLQVTALSIGNGIMGPEKLDAV 126

Query: 124 ASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVD 167
           ASLP  +   A +++  ++  ++ V+ +     + VR ++A  D
Sbjct: 127 ASLPTRDEALAKLLATFKAPVSKFVKTVNEVPAKFVRTLAAIKD 170


>gi|71802529|gb|AAX71882.1| LSU ribosomal protein L10P [Streptococcus pyogenes MGAS6180]
 gi|94542048|gb|ABF32097.1| LSU ribosomal protein L10P [Streptococcus pyogenes MGAS9429]
 gi|94545872|gb|ABF35919.1| LSU ribosomal protein L10P [Streptococcus pyogenes MGAS2096]
 gi|94547847|gb|ABF37893.1| LSU ribosomal protein L10P [Streptococcus pyogenes MGAS10750]
          Length = 187

 Score = 75.5 bits (184), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 49/168 (29%), Positives = 93/168 (55%), Gaps = 13/168 (7%)

Query: 6   KSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDT 65
           K+ ++  +++   ++ SIVV   +G++V Q   LR+ +RE+G   KV KN ++  A    
Sbjct: 30  KAEQVELIAEKMKAAASIVVVDSRGLTVDQDTVLRRSLRESGVEFKVIKNSILTRAAEKA 89

Query: 66  SIRGISDLFVGQSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIA 124
            +  + D+FVG S + +S+  VIAP K+   F+   +   + GG +E  V +++ I+ +A
Sbjct: 90  GLDELKDVFVGPSAVAFSNEDVIAPAKVINDFTKTADALEIKGGAIEGAVSSKEEIQALA 149

Query: 125 SLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQQG 172
           +LP+ EG+ + ++S +Q+           P   V  A+ A V +N++G
Sbjct: 150 TLPNREGMLSMLLSVLQA-----------PVRNVAYAVKA-VAENKEG 185


>gi|237797423|ref|ZP_04585884.1| 50S ribosomal protein L10 [Pseudomonas syringae pv. oryzae str.
           1_6]
 gi|331020273|gb|EGI00330.1| 50S ribosomal protein L10 [Pseudomonas syringae pv. oryzae str.
           1_6]
          Length = 166

 Score = 75.5 bits (184), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 46/155 (29%), Positives = 84/155 (54%), Gaps = 1/155 (0%)

Query: 4   QGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIR 63
           + K   ++E+++   +  S VVA  +G++V+ +  LRK+ REAG  V+V +N L+K A+ 
Sbjct: 6   EDKKAIVAEVNEAAKAGLSAVVADARGVTVSAMTGLRKEAREAGVYVRVVRNTLLKRAVA 65

Query: 64  DTSIRGISDLFVGQSLIVYS-DSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQ 122
           DT    ++D+F G +LI +S + P  A ++   F+   ++F +     E   L  + I  
Sbjct: 66  DTEFSVLNDVFTGPTLIAFSNEHPGAAARLFKEFAKGQDKFEIKAAAFEGKFLAANQIDV 125

Query: 123 IASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQ 157
           +A+LP      + ++S IQ   ++L R L   + Q
Sbjct: 126 LATLPTRNEAISQLMSVIQGATSKLARTLAAVRDQ 160


>gi|218246570|ref|YP_002371941.1| 50S ribosomal protein L10 [Cyanothece sp. PCC 8801]
 gi|257059610|ref|YP_003137498.1| 50S ribosomal protein L10 [Cyanothece sp. PCC 8802]
 gi|226699934|sp|B7JWT6|RL10_CYAP8 RecName: Full=50S ribosomal protein L10
 gi|218167048|gb|ACK65785.1| ribosomal protein L10 [Cyanothece sp. PCC 8801]
 gi|256589776|gb|ACV00663.1| ribosomal protein L10 [Cyanothece sp. PCC 8802]
          Length = 189

 Score = 75.5 bits (184), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 49/163 (30%), Positives = 85/163 (52%), Gaps = 2/163 (1%)

Query: 3   RQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAI 62
           R  K+  I++L ++ S +    V  Y+G+SV++I +LR ++R  G   KV KN  +++A+
Sbjct: 5   RDNKAAVIADLKELLSDAQLAFVIDYQGLSVSEITELRNRLRPTGSICKVTKNTFMEMAV 64

Query: 63  R-DTSIRGISDLFVGQS-LIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           + D + + ++    G S  ++  D    A +    F  D  +    GGV++   LN+D +
Sbjct: 65  QEDDNWQPMTQFLTGSSAFVLVKDDVGGAVRAYQGFKKDTKKTEFRGGVMQGQALNEDQV 124

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAIS 163
           K IA LP  E + A I  A+ S AT+L   +    + V R I+
Sbjct: 125 KAIADLPSKEELMAQIAGALNSIATKLAVGINEVPSSVARGIN 167


>gi|50903233|gb|AAT86948.1| LSU ribosomal protein L10P [Streptococcus pyogenes MGAS10394]
          Length = 198

 Score = 75.5 bits (184), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 49/168 (29%), Positives = 93/168 (55%), Gaps = 13/168 (7%)

Query: 6   KSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDT 65
           K+ ++  +++   ++ SIVV   +G++V Q   LR+ +RE+G   KV KN ++  A    
Sbjct: 41  KAEQVELIAEKMKAAASIVVVDSRGLTVDQDTVLRRSLRESGVEFKVIKNSILTRAAEKA 100

Query: 66  SIRGISDLFVGQSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIA 124
            +  + D+FVG S + +S+  VIAP K+   F+   +   + GG +E  V +++ I+ +A
Sbjct: 101 GLDELKDVFVGPSAVAFSNEDVIAPAKVINDFTKTADALEIKGGAIEGAVSSKEEIQALA 160

Query: 125 SLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQQG 172
           +LP+ EG+ + ++S +Q+           P   V  A+ A V +N++G
Sbjct: 161 TLPNREGMLSMLLSVLQA-----------PVRNVAYAVKA-VAENKEG 196


>gi|330812084|ref|YP_004356546.1| 50S ribosomal protein L10 [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
 gi|327380192|gb|AEA71542.1| 50S ribosomal protein L10 [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
          Length = 166

 Score = 75.5 bits (184), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 46/155 (29%), Positives = 84/155 (54%), Gaps = 1/155 (0%)

Query: 4   QGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIR 63
           + K   ++E+++   ++ S VVA  +G++V  +  LRK+ REAG  V+V +N L+K A+ 
Sbjct: 6   EDKKAIVAEVNEAAKAALSAVVADARGVTVGAMTGLRKEAREAGVYVRVVRNTLLKRAVA 65

Query: 64  DTSIRGISDLFVGQSLIVYS-DSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQ 122
           DT    ++D+F G +LI +S   P  A ++   F+   ++F +     E   L  + I  
Sbjct: 66  DTEYSVLNDVFTGPTLIAFSTQHPGAAARLFKEFAKGQDKFEIKAAAFEGKFLAANQIDV 125

Query: 123 IASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQ 157
           +A+LP  +   + ++S IQ   ++L R L   + Q
Sbjct: 126 LATLPTRDEAISQLMSVIQGATSKLARTLAALRDQ 160


>gi|323127112|gb|ADX24409.1| 50S ribosomal protein L10 [Streptococcus dysgalactiae subsp.
           equisimilis ATCC 12394]
          Length = 165

 Score = 75.5 bits (184), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 49/168 (29%), Positives = 93/168 (55%), Gaps = 13/168 (7%)

Query: 6   KSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDT 65
           K+ ++  +++   ++ SIVV   +G++V Q   LR+ +RE+G   KV KN ++  A    
Sbjct: 8   KAEQVELIAEKMKAAASIVVVDSRGLTVDQDTVLRRSLRESGVEFKVIKNSILTRAAEKA 67

Query: 66  SIRGISDLFVGQSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIA 124
            +  + D+FVG S + +S+  VIAP K+   F+   +   + GG +E  V +++ I+ +A
Sbjct: 68  GLDELKDVFVGPSAVAFSNEDVIAPAKVINDFAKTADALEIKGGAIEGAVSSKEEIQALA 127

Query: 125 SLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQQG 172
           +LP+ EG+ + ++S +Q+           P   V  A+ A V +N++G
Sbjct: 128 TLPNREGMLSMLLSVLQA-----------PVRNVAYAVKA-VAENKEG 163


>gi|51244967|ref|YP_064851.1| 50S ribosomal protein L10 [Desulfotalea psychrophila LSv54]
 gi|61214925|sp|Q6AP80|RL10_DESPS RecName: Full=50S ribosomal protein L10
 gi|50876004|emb|CAG35844.1| related to 50S ribosomal protein L10 [Desulfotalea psychrophila
           LSv54]
          Length = 175

 Score = 75.5 bits (184), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 52/174 (29%), Positives = 93/174 (53%), Gaps = 5/174 (2%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           MNR  K+  +S+L+  F  +   VVA Y G+ V++++ +R +++     ++VAKN L+K 
Sbjct: 1   MNRDDKAALVSQLNDSFGRAKLSVVADYCGLKVSELQQIRIELKGCDSEIRVAKNTLLKR 60

Query: 61  AIRDTSIRGISDLFVGQSLIV--YSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQD 118
           A   T    ++D F G + ++  YSD PV   K+   F+  + +F +    +E   +  D
Sbjct: 61  AADGTGTAVLADDFTGTTAVITSYSD-PVGPAKVLTQFAGGHEKFVIRSAALEGEKIGVD 119

Query: 119 SIKQIASLPDLEGIRAGIISAIQSNATRLVRLL-GTPQTQVVRAISAFVDKNQQ 171
            ++ +A LP  E +   ++S   +  T LVR+L G P+T  V  + A  D+ +Q
Sbjct: 120 RLEALAKLPSREVLLGQLLSTWNNVPTGLVRVLSGVPRT-FVYGLQALKDQKEQ 172


>gi|21910289|ref|NP_664557.1| 50S ribosomal protein L10 [Streptococcus pyogenes MGAS315]
 gi|28895866|ref|NP_802216.1| 50S ribosomal protein L10 [Streptococcus pyogenes SSI-1]
 gi|139473814|ref|YP_001128530.1| 50S ribosomal protein L10 [Streptococcus pyogenes str. Manfredo]
 gi|161761313|ref|YP_060131.2| 50S ribosomal protein L10 [Streptococcus pyogenes MGAS10394]
 gi|162139082|ref|YP_596641.2| 50S ribosomal protein L10 [Streptococcus pyogenes MGAS9429]
 gi|162139131|ref|YP_600463.2| 50S ribosomal protein L10 [Streptococcus pyogenes MGAS2096]
 gi|162139183|ref|YP_602437.2| 50S ribosomal protein L10 [Streptococcus pyogenes MGAS10750]
 gi|162139403|ref|YP_280237.2| 50S ribosomal protein L10 [Streptococcus pyogenes MGAS6180]
 gi|209559377|ref|YP_002285849.1| 50S ribosomal protein L10 [Streptococcus pyogenes NZ131]
 gi|306827421|ref|ZP_07460708.1| 50S ribosomal protein L10 [Streptococcus pyogenes ATCC 10782]
 gi|25054984|sp|Q8K7L4|RL10_STRP3 RecName: Full=50S ribosomal protein L10
 gi|57014108|sp|Q5XCB5|RL10_STRP6 RecName: Full=50S ribosomal protein L10
 gi|97182015|sp|Q48TS4|RL10_STRPM RecName: Full=50S ribosomal protein L10
 gi|166230078|sp|A2REM5|RL10_STRPG RecName: Full=50S ribosomal protein L10
 gi|226700012|sp|B5XLE2|RL10_STRPZ RecName: Full=50S ribosomal protein L10
 gi|21904484|gb|AAM79360.1| 50S ribosomal protein L10 [Streptococcus pyogenes MGAS315]
 gi|28811116|dbj|BAC64049.1| 50S ribosomal protein L10 [Streptococcus pyogenes SSI-1]
 gi|134272061|emb|CAM30300.1| 50S ribosomal protein L10 [Streptococcus pyogenes str. Manfredo]
 gi|209540578|gb|ACI61154.1| LSU ribosomal protein L10p (P0) [Streptococcus pyogenes NZ131]
 gi|304430568|gb|EFM33590.1| 50S ribosomal protein L10 [Streptococcus pyogenes ATCC 10782]
          Length = 166

 Score = 75.5 bits (184), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 49/168 (29%), Positives = 93/168 (55%), Gaps = 13/168 (7%)

Query: 6   KSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDT 65
           K+ ++  +++   ++ SIVV   +G++V Q   LR+ +RE+G   KV KN ++  A    
Sbjct: 9   KAEQVELIAEKMKAAASIVVVDSRGLTVDQDTVLRRSLRESGVEFKVIKNSILTRAAEKA 68

Query: 66  SIRGISDLFVGQSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIA 124
            +  + D+FVG S + +S+  VIAP K+   F+   +   + GG +E  V +++ I+ +A
Sbjct: 69  GLDELKDVFVGPSAVAFSNEDVIAPAKVINDFTKTADALEIKGGAIEGAVSSKEEIQALA 128

Query: 125 SLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQQG 172
           +LP+ EG+ + ++S +Q+           P   V  A+ A V +N++G
Sbjct: 129 TLPNREGMLSMLLSVLQA-----------PVRNVAYAVKA-VAENKEG 164


>gi|331002056|ref|ZP_08325576.1| hypothetical protein HMPREF0491_00438 [Lachnospiraceae oral taxon
           107 str. F0167]
 gi|330411852|gb|EGG91257.1| hypothetical protein HMPREF0491_00438 [Lachnospiraceae oral taxon
           107 str. F0167]
          Length = 162

 Score = 75.5 bits (184), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 44/143 (30%), Positives = 76/143 (53%), Gaps = 1/143 (0%)

Query: 10  ISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRG 69
           + E++++   + + VV  Y+G++  Q   LRK++REAG   KV KN +++IA + T    
Sbjct: 11  VKEITELLDGAQAAVVVDYRGLTAEQDTKLRKELREAGVTYKVYKNTMIRIAAKGTPFET 70

Query: 70  ISDLFVGQSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASLPD 128
           +     G + I  S     AP +I  +FS    +  +  GVV+    +QD IK IA++P 
Sbjct: 71  LYSSLEGPTAIAVSKEDATAPARILYNFSKTAPKLELKAGVVDGVTYDQDGIKVIATIPS 130

Query: 129 LEGIRAGIISAIQSNATRLVRLL 151
            + +   ++ +IQS  T   R+L
Sbjct: 131 RDELIGRLLGSIQSTITNFARVL 153


>gi|296876436|ref|ZP_06900487.1| 50S ribosomal protein L10 [Streptococcus parasanguinis ATCC 15912]
 gi|296432429|gb|EFH18225.1| 50S ribosomal protein L10 [Streptococcus parasanguinis ATCC 15912]
          Length = 166

 Score = 75.5 bits (184), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 47/157 (29%), Positives = 81/157 (51%), Gaps = 12/157 (7%)

Query: 17  FSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRGISDLFVG 76
             ++ SIVV   +G++V Q   LR+ +RE+    KV KN +++ A     +  ++ +FVG
Sbjct: 20  MKAAASIVVVDSRGLTVEQDTVLRRNLRESEVEFKVIKNSILRRAAEKAGLEDLASVFVG 79

Query: 77  QSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASLPDLEGIRAG 135
            S + +S+  VIAP KI   FS D     + GG +E  V +++ I  +A+LP+ EG+ + 
Sbjct: 80  PSAVAFSNEDVIAPAKILNDFSKDAEALEIKGGAIEGAVASKEEILALATLPNREGLLSM 139

Query: 136 IISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQQG 172
           ++S +Q+           P   V  A+ A  D  +  
Sbjct: 140 LLSVLQA-----------PVRNVALAVKAVADNKEDA 165


>gi|126433602|ref|YP_001069293.1| 50S ribosomal protein L10 [Mycobacterium sp. JLS]
 gi|166230035|sp|A3PV75|RL10_MYCSJ RecName: Full=50S ribosomal protein L10
 gi|126233402|gb|ABN96802.1| LSU ribosomal protein L10P [Mycobacterium sp. JLS]
          Length = 175

 Score = 75.5 bits (184), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 50/169 (29%), Positives = 89/169 (52%), Gaps = 2/169 (1%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M +  K+  ++++++ F  + + VV  Y+G++VA +  LR+ + E+     VAKN LVK 
Sbjct: 1   MAKADKATAVADIAEQFKEATATVVTEYRGLTVANLAQLRRSLGESAT-YTVAKNTLVKR 59

Query: 61  AIRDTSIRGISDLFVGQSLIVY-SDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
           A  +  I G+ +LF G + I +    PV A K   +F+ ++    + GG +E   L+ D 
Sbjct: 60  AAAEAGIDGLDELFTGPTAIAFVQGEPVDAAKAIKAFAKEHKALVIKGGYMEGRALSIDE 119

Query: 120 IKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDK 168
           + +IA L   E + A +  A++ N  +   L   P +QV R  +A  +K
Sbjct: 120 VNRIADLESREVLLAKLAGAMKGNLAKAAGLFNAPASQVARLAAALQEK 168


>gi|108797940|ref|YP_638137.1| 50S ribosomal protein L10 [Mycobacterium sp. MCS]
 gi|119867036|ref|YP_936988.1| 50S ribosomal protein L10 [Mycobacterium sp. KMS]
 gi|123179412|sp|Q1BDF3|RL10_MYCSS RecName: Full=50S ribosomal protein L10
 gi|166230036|sp|A1UBJ0|RL10_MYCSK RecName: Full=50S ribosomal protein L10
 gi|108768359|gb|ABG07081.1| LSU ribosomal protein L10P [Mycobacterium sp. MCS]
 gi|119693125|gb|ABL90198.1| LSU ribosomal protein L10P [Mycobacterium sp. KMS]
          Length = 175

 Score = 75.5 bits (184), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 50/169 (29%), Positives = 89/169 (52%), Gaps = 2/169 (1%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M +  K+  ++++++ F  + + VV  Y+G++VA +  LR+ + E+     VAKN LVK 
Sbjct: 1   MAKADKATAVADIAEQFKEATATVVTEYRGLTVANLAQLRRSLGESAT-YTVAKNTLVKR 59

Query: 61  AIRDTSIRGISDLFVGQSLIVY-SDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
           A  +  I G+ +LF G + I +    PV A K   +F+ ++    + GG +E   L+ D 
Sbjct: 60  AAAEAGIDGLDELFTGPTAIAFVQGEPVDAAKAIKAFAKEHKALVIKGGYMEGRALSIDE 119

Query: 120 IKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDK 168
           + +IA L   E + A +  A++ N  +   L   P +QV R  +A  +K
Sbjct: 120 VNRIADLESREVLLAKLAGAMKGNLAKAAGLFNAPASQVARLAAALQEK 168


>gi|284009042|emb|CBA75997.1| 50S ribosomal subunit protein L10 [Arsenophonus nasoniae]
          Length = 165

 Score = 75.5 bits (184), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 44/159 (27%), Positives = 89/159 (55%), Gaps = 2/159 (1%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           +N Q K   ++E+S++   + S VVA  +G++V ++ +LRK  REAG  ++V +N L++ 
Sbjct: 3   LNLQDKQAIVAEVSEVAKGALSAVVADSRGVAVDKMTELRKAGREAGVYLRVVRNTLMRR 62

Query: 61  AIRDTSIRGISDLFVGQSLIVYS-DSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
            +  T+   + + F+G +LI +S + P  A ++   F+  N  F +     E   +  + 
Sbjct: 63  VVEGTTYECLKEAFIGPTLIAFSNEHPGAAARLFKEFAKANPAFEIKAAAFEGEFIPANQ 122

Query: 120 IKQIASLPDLEGIRAGIISAI-QSNATRLVRLLGTPQTQ 157
           I ++A+LP  E   A ++S + +++A +L R++   + Q
Sbjct: 123 IDRLATLPTYEEAIARLMSTMKEASAGKLARIMAALRDQ 161


>gi|238626070|gb|ACR48349.1| Nos7 [Streptomyces actuosus]
          Length = 176

 Score = 75.5 bits (184), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 53/168 (31%), Positives = 86/168 (51%), Gaps = 5/168 (2%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M R  K+  ++EL+  F +S + V+  Y+G++VAQ + LR  + E      V KN L KI
Sbjct: 1   MARPDKAAAVAELTDKFRNSSAAVLTEYRGLTVAQTRKLRLALGE-NAQYAVVKNTLTKI 59

Query: 61  AIRDTSIRGISDLFVGQSLIVY-SDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
           A  +  I  + DLF G + + + +  PV + K    F+ +N    + GGV++   L+ D 
Sbjct: 60  AANEAGITTLDDLFNGPTAVAFVTGDPVESAKGLRDFAKENPNLVIKGGVLDGKALSADE 119

Query: 120 IKQIASLPDLEGI---RAGIISAIQSNATRLVRLLGTPQTQVVRAISA 164
           IK++A L   E +    AG   A QS A  + + L +   + V A+ A
Sbjct: 120 IKKLADLESREVLLSKLAGAFKAKQSQAASVFQALPSKLVRTVDALRA 167


>gi|237786416|ref|YP_002907121.1| 50S ribosomal protein L10 [Corynebacterium kroppenstedtii DSM
           44385]
 gi|237759328|gb|ACR18578.1| 50S ribosomal protein L10 [Corynebacterium kroppenstedtii DSM
           44385]
          Length = 181

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 45/163 (27%), Positives = 86/163 (52%), Gaps = 7/163 (4%)

Query: 10  ISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVK--VAKNRLVKIAIRDTSI 67
           + EL+  F ++ S ++  Y+G+SV ++ +LRK++   G  V+  VAKN ++K+A R+  +
Sbjct: 21  VKELTARFQNASSAILTEYRGLSVTEMTELRKEL---GAEVEYSVAKNTMIKLAAREAGV 77

Query: 68  RGI-SDLFVGQSLIVYSDSPVI-APKISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIAS 125
            G+  +L  G + I + +   + A K    F  D++ F V GG ++   L  + I+Q+A 
Sbjct: 78  EGLDEELLNGPTAIAFINGEAVDAAKAMKKFGADHDAFVVKGGTMDGSALTAEQIQQLAD 137

Query: 126 LPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDK 168
           + + E   + I          +  LLG P +++ R  +A  +K
Sbjct: 138 MDNRETTLSKIAGGFNGVLANVASLLGAPHSEMARLAAALEEK 180


>gi|188588432|ref|YP_001919663.1| 50S ribosomal protein L10 [Clostridium botulinum E3 str. Alaska
           E43]
 gi|251780497|ref|ZP_04823417.1| 50S ribosomal protein L10 [Clostridium botulinum E1 str. 'BoNT E
           Beluga']
 gi|188498713|gb|ACD51849.1| 50S ribosomal protein L10 [Clostridium botulinum E3 str. Alaska
           E43]
 gi|243084812|gb|EES50702.1| 50S ribosomal protein L10 [Clostridium botulinum E1 str. 'BoNT E
           Beluga']
          Length = 167

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 44/151 (29%), Positives = 82/151 (54%), Gaps = 1/151 (0%)

Query: 2   NRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIA 61
           NRQ K  +++E+ +    + ++V A Y+G++V +   LRK +REAG   KV KN LV IA
Sbjct: 4   NRQLKEAKVAEIKEKLQKAKAVVFAKYQGLTVEEDTALRKNLREAGVEYKVYKNTLVSIA 63

Query: 62  IRDTSIRGISDLFVGQSLIVYSDSPV-IAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
            ++  + G  +   G   I +    V +  ++   F+ ++ +  +  G+VE  V + + I
Sbjct: 64  AKELGLDGAVEYLEGPVAIAFGYEDVTVGARVLNDFAKNHKKLELKAGIVEGEVYDSEKI 123

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLL 151
            Q+A++P  E + A ++ +I+S  +    LL
Sbjct: 124 TQLATIPSKEVLIAKLLGSIKSPLSNFAYLL 154


>gi|167772351|ref|ZP_02444404.1| hypothetical protein ANACOL_03728 [Anaerotruncus colihominis DSM
           17241]
 gi|167665454|gb|EDS09584.1| hypothetical protein ANACOL_03728 [Anaerotruncus colihominis DSM
           17241]
          Length = 176

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 44/142 (30%), Positives = 78/142 (54%), Gaps = 2/142 (1%)

Query: 4   QGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIR 63
           Q K  E+  L++   ++ + V+  YKGI+VA    LRK++REAG    + KN +++ A +
Sbjct: 8   QRKKDEVVALTEKLKAATAGVLVDYKGITVADDTKLRKELREAGVEYSIVKNTMLRFAAK 67

Query: 64  DTSIRGISDLFVG-QSLIVYSDSPVIAPKISVSFSNDN-NEFRVLGGVVEKGVLNQDSIK 121
                 +  +  G  +L V  D PV A KI   ++ D+ ++F V  G V+ GV++   + 
Sbjct: 68  QVGYEALDSVLEGPTALAVSKDDPVAAAKILTKYAEDHKDKFTVKAGFVDGGVIDAAKVA 127

Query: 122 QIASLPDLEGIRAGIISAIQSN 143
           ++  LP+ E + + + SA+Q N
Sbjct: 128 ELGKLPNRETLLSMLCSALQGN 149


>gi|260905744|ref|ZP_05914066.1| 50S ribosomal protein L10 [Brevibacterium linens BL2]
          Length = 177

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 46/169 (27%), Positives = 87/169 (51%), Gaps = 2/169 (1%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M R  K+  + EL + F +S ++++  Y+G++VAQ+KDLR  + E      V KN L  I
Sbjct: 1   MARPDKAAAVEELKQQFENSDAVLLTEYRGLTVAQMKDLRVSLGE-NVSYAVVKNTLTAI 59

Query: 61  AIRDTSIRGISDLFVGQSLIVYSD-SPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
           A ++  I  + +   G + I + +  P  A K   +F+  N++  + GG  +  VL+ ++
Sbjct: 60  AAKEAGINDLDEFLNGPTAIAFVNGEPPEAAKALRNFAKANSQLVLKGGYWDGAVLSAEN 119

Query: 120 IKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDK 168
           + ++A L   E + A    A++++  +   L   P  + VR + A  +K
Sbjct: 120 VNKLADLEPREVLLAKAAGAMKASLHQAAYLFTAPMVKAVRTVDALREK 168


>gi|322411599|gb|EFY02507.1| 50S ribosomal protein L10 [Streptococcus dysgalactiae subsp.
           dysgalactiae ATCC 27957]
          Length = 166

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 49/168 (29%), Positives = 93/168 (55%), Gaps = 13/168 (7%)

Query: 6   KSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDT 65
           K+ ++  +++   ++ SIVV   +G++V Q   LR+ +RE+G   KV KN ++  A    
Sbjct: 9   KAEQVELIAEKMKAAASIVVVDSRGLTVDQDTVLRRSLRESGVEFKVIKNSILTRAAEKA 68

Query: 66  SIRGISDLFVGQSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIA 124
            +  + D+FVG S + +S+  VIAP K+   F+   +   + GG +E  V +++ I+ +A
Sbjct: 69  GLDELKDVFVGPSAVAFSNEDVIAPAKVINDFAKTADALEIKGGAIEGAVSSKEEIQALA 128

Query: 125 SLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQQG 172
           +LP+ EG+ + ++S +Q+           P   V  A+ A V +N++G
Sbjct: 129 TLPNREGMLSMLLSVLQA-----------PVRNVAYAVKA-VAENKEG 164


>gi|225376342|ref|ZP_03753563.1| hypothetical protein ROSEINA2194_01983 [Roseburia inulinivorans DSM
           16841]
 gi|225211718|gb|EEG94072.1| hypothetical protein ROSEINA2194_01983 [Roseburia inulinivorans DSM
           16841]
          Length = 179

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 47/143 (32%), Positives = 74/143 (51%), Gaps = 1/143 (0%)

Query: 10  ISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRG 69
           + E+S+    + S+VV  Y+G++VA+   LRK +REAG   KV KN LV  AI  T    
Sbjct: 11  VQEISENIKDAQSVVVVDYRGLTVAEDTQLRKALREAGVSYKVYKNTLVNRAIAGTEFES 70

Query: 70  ISDLFVGQSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASLPD 128
           + +   G S    S     AP +I   F+       +  GVVE    + + +K IA++P 
Sbjct: 71  LKESLEGPSAFAISKDDATAPARILAKFAKTAPALEIKAGVVEGTFYDANGMKAIANVPS 130

Query: 129 LEGIRAGIISAIQSNATRLVRLL 151
            E + + ++ ++QS  T L R+L
Sbjct: 131 REELLSKLLGSLQSPITNLARVL 153


>gi|224370699|ref|YP_002604863.1| RplJ [Desulfobacterium autotrophicum HRM2]
 gi|223693416|gb|ACN16699.1| RplJ [Desulfobacterium autotrophicum HRM2]
          Length = 207

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 49/172 (28%), Positives = 88/172 (51%), Gaps = 3/172 (1%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           +N   K   +++ +     +   ++  YKG++V  +  LR ++R+ G  + V KN L+ +
Sbjct: 35  LNLSNKKEFVADFAVCLKETQISILVDYKGLNVESMTQLRSELRKEGVQLAVVKNTLLGM 94

Query: 61  AIRDTSIRGISDLFVGQSLIVYS-DSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
           A   T    + D F G + I    D PV   ++ V F+ DN++  +  G +   VL+ D 
Sbjct: 95  ASEGTDTALMKDFFKGPNAIATCKDDPVAPARVLVKFAEDNDKLEIKAGTMNGKVLSVDD 154

Query: 120 IKQIASLPDLEGIRAGIISAIQSNATRLVRLL-GTPQTQVVRAISAFVDKNQ 170
           IK +A +P  E + A ++SA+    T LVR+L G P+   +  +SA  D+ +
Sbjct: 155 IKALAKMPSREVLLAQLLSAMNGVPTGLVRVLSGVPRA-FMTVLSAISDQKE 205


>gi|251782264|ref|YP_002996566.1| 50S ribosomal protein L10 [Streptococcus dysgalactiae subsp.
           equisimilis GGS_124]
 gi|242390893|dbj|BAH81352.1| LSU ribosomal protein L10P [Streptococcus dysgalactiae subsp.
           equisimilis GGS_124]
          Length = 182

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 49/168 (29%), Positives = 93/168 (55%), Gaps = 13/168 (7%)

Query: 6   KSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDT 65
           K+ ++  +++   ++ SIVV   +G++V Q   LR+ +RE+G   KV KN ++  A    
Sbjct: 25  KAEQVELIAEKMKAAASIVVVDSRGLTVDQDTVLRRSLRESGVEFKVIKNSILTRAAEKA 84

Query: 66  SIRGISDLFVGQSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIA 124
            +  + D+FVG S + +S+  VIAP K+   F+   +   + GG +E  V +++ I+ +A
Sbjct: 85  GLDELKDVFVGPSAVAFSNEDVIAPAKVINDFAKTADALEIKGGAIEGAVSSKEEIQALA 144

Query: 125 SLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQQG 172
           +LP+ EG+ + ++S +Q+           P   V  A+ A V +N++G
Sbjct: 145 TLPNREGMLSMLLSVLQA-----------PVRNVAYAVKA-VAENKEG 180


>gi|28867845|ref|NP_790464.1| 50S ribosomal protein L10 [Pseudomonas syringae pv. tomato str.
           DC3000]
 gi|213969205|ref|ZP_03397343.1| ribosomal protein L10 [Pseudomonas syringae pv. tomato T1]
 gi|301381712|ref|ZP_07230130.1| 50S ribosomal protein L10 [Pseudomonas syringae pv. tomato Max13]
 gi|302061088|ref|ZP_07252629.1| 50S ribosomal protein L10 [Pseudomonas syringae pv. tomato K40]
 gi|302130771|ref|ZP_07256761.1| 50S ribosomal protein L10 [Pseudomonas syringae pv. tomato NCPPB
           1108]
 gi|38258480|sp|Q889Y0|RL10_PSESM RecName: Full=50S ribosomal protein L10
 gi|28851081|gb|AAO54159.1| ribosomal protein L10 [Pseudomonas syringae pv. tomato str. DC3000]
 gi|213925883|gb|EEB59440.1| ribosomal protein L10 [Pseudomonas syringae pv. tomato T1]
 gi|330879464|gb|EGH13613.1| 50S ribosomal protein L10 [Pseudomonas syringae pv. morsprunorum
           str. M302280PT]
 gi|330966920|gb|EGH67180.1| 50S ribosomal protein L10 [Pseudomonas syringae pv. actinidiae str.
           M302091]
 gi|331018151|gb|EGH98207.1| 50S ribosomal protein L10 [Pseudomonas syringae pv. lachrymans str.
           M302278PT]
          Length = 166

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 46/155 (29%), Positives = 83/155 (53%), Gaps = 1/155 (0%)

Query: 4   QGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIR 63
           + K   ++E+++   +  S VVA  +G++V  +  LRK+ REAG  V+V +N L+K A+ 
Sbjct: 6   EDKKAIVAEVNEAAKAGLSAVVADARGVTVGAMTGLRKEAREAGVYVRVVRNTLLKRAVA 65

Query: 64  DTSIRGISDLFVGQSLIVYS-DSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQ 122
           DT    ++D+F G +LI +S + P  A ++   F+   ++F +     E   L  + I  
Sbjct: 66  DTEFSVLNDVFTGPTLIAFSNEHPGAAARLFKEFAKGQDKFEIKAAAFEGKFLAANQIDV 125

Query: 123 IASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQ 157
           +A+LP      + ++S IQ   ++L R L   + Q
Sbjct: 126 LATLPTRNEAISQLMSVIQGATSKLARTLAAVRDQ 160


>gi|311744837|ref|ZP_07718633.1| 50S ribosomal protein L10 [Aeromicrobium marinum DSM 15272]
 gi|311311954|gb|EFQ81875.1| 50S ribosomal protein L10 [Aeromicrobium marinum DSM 15272]
          Length = 219

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 48/166 (28%), Positives = 82/166 (49%), Gaps = 2/166 (1%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M R  K   ++EL++ F ++G  V+  Y+G++V Q+++LR+ + +      VAKN L KI
Sbjct: 1   MARPDKVAAVAELAENFRAAGGAVLTEYRGLTVKQLQELRRTLGDTVS-YAVAKNTLTKI 59

Query: 61  AIRDTSIRGISDLFVGQSLIVY-SDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
           A ++  +     L  G + I + +  PV A K    F+  N    + GG ++   L+ D 
Sbjct: 60  AAKEAGVDIDDALLTGPTAIAFINGDPVEAAKGLRDFAKANTPLVIKGGFLDGKTLSADE 119

Query: 120 IKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAF 165
           I ++A L   E + A +  A++ N      L G P  Q  R + A 
Sbjct: 120 ISKLADLESREVLLAKLAGAMKGNLQNAASLFGAPLAQTARLVGAL 165


>gi|218296040|ref|ZP_03496809.1| ribosomal protein L10 [Thermus aquaticus Y51MC23]
 gi|218243417|gb|EED09946.1| ribosomal protein L10 [Thermus aquaticus Y51MC23]
          Length = 173

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 45/152 (29%), Positives = 83/152 (54%), Gaps = 3/152 (1%)

Query: 19  SSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRGISDLFVGQS 78
           + GS  + +Y+G+S  +   LR+ ++E G  + VAKN L++IA+ +  +  + D   G S
Sbjct: 20  AKGSFFLVNYQGLSAKETHALRQALKEKGARLFVAKNTLIRIALEELGLPKL-DGLSGPS 78

Query: 79  LIVYSDSPVIAPKISVSFSNDNNE--FRVLGGVVEKGVLNQDSIKQIASLPDLEGIRAGI 136
            +V+   PV A K    FS  N +    V GG+++  VL+   +  +A LP ++ +RA +
Sbjct: 79  AVVFYQDPVAAAKALQEFSKKNPKGIPEVKGGLLQGQVLSAKDLLALAELPTMDELRAEL 138

Query: 137 ISAIQSNATRLVRLLGTPQTQVVRAISAFVDK 168
           +  +Q+    LV +LG    ++V  + A+ +K
Sbjct: 139 VGVLQAPMAELVGVLGGVARELVGILEAYAEK 170


>gi|145633888|ref|ZP_01789609.1| 50S ribosomal protein L10 [Haemophilus influenzae 3655]
 gi|148827817|ref|YP_001292570.1| 50S ribosomal protein L10 [Haemophilus influenzae PittGG]
 gi|166229731|sp|A5UHD1|RL10_HAEIG RecName: Full=50S ribosomal protein L10
 gi|144985260|gb|EDJ92103.1| 50S ribosomal protein L10 [Haemophilus influenzae 3655]
 gi|148719059|gb|ABR00187.1| 50S ribosomal protein L10 [Haemophilus influenzae PittGG]
          Length = 163

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 50/177 (28%), Positives = 93/177 (52%), Gaps = 22/177 (12%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           +N Q K   ++E+++    + S V+A  +G++V ++ +LRK  REAG  ++V +N L++ 
Sbjct: 3   LNLQDKQAIVAEVNEAAKGALSAVIADSRGVTVEKMTELRKSAREAGVTMRVVRNTLLRR 62

Query: 61  AIRDTSIRGISDLFVGQSLIVYS-DSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
           A+  T    + D FVG +LI +S + P  A ++   F+  N++F + G   E  +  QD 
Sbjct: 63  AVEGTDYECLKDTFVGPTLIAFSNEHPGAAARLFKEFAKANDKFEIKGAAFEGKI--QD- 119

Query: 120 IKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQT----QVVRAISAFVDKNQQG 172
           ++ +A+LP  E                + RL+GT +     ++ R ++A  DK Q+ 
Sbjct: 120 VEFLATLPTYE--------------EAIARLMGTMKEAAAGKLARTLAALRDKLQEA 162


>gi|255994049|ref|ZP_05427184.1| ribosomal protein L10 [Eubacterium saphenum ATCC 49989]
 gi|255993717|gb|EEU03806.1| ribosomal protein L10 [Eubacterium saphenum ATCC 49989]
          Length = 195

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 50/154 (32%), Positives = 82/154 (53%), Gaps = 3/154 (1%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           + ++ K  +IS++   FS + + VV  Y GI+V++   +RK++REA     V KN LVK 
Sbjct: 3   LTKEQKQKQISDIKDKFSRAKAAVVVDYMGITVSEADAMRKELREAEVDYSVFKNTLVKE 62

Query: 61  AIRDTSIRGISDLFVGQS--LIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQD 118
           A++DT    + D   G S   I Y D P    +I  +      +  +  G +E    + +
Sbjct: 63  ALKDTDFSEMFDYLKGSSAFAISYED-PTSPARIIGNTIKQIEKMSLKCGFIEGSFFDSE 121

Query: 119 SIKQIASLPDLEGIRAGIISAIQSNATRLVRLLG 152
            IKQ+A+LP  E + A +I ++ +  T LVR+LG
Sbjct: 122 GIKQMAALPSKEELIAKLIGSMNAPLTNLVRVLG 155


>gi|295425587|ref|ZP_06818274.1| 50S ribosomal protein L10 [Lactobacillus amylolyticus DSM 11664]
 gi|295064603|gb|EFG55524.1| 50S ribosomal protein L10 [Lactobacillus amylolyticus DSM 11664]
          Length = 172

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 37/129 (28%), Positives = 79/129 (61%), Gaps = 3/129 (2%)

Query: 17  FSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRGISDLFVG 76
              + +I+V +Y G++V ++ ++RK++R+    ++V KN  +K A+    I G+ D FVG
Sbjct: 20  LKDAKAILVINYLGLTVEEVTNMRKELRDNDVKMRVIKNTYLKRAVAKAGIEGLDDTFVG 79

Query: 77  QSLIVYSDSP--VIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASLPDLEGIR 133
            + ++Y+D+   V  P +I   + +D +   + GG++E  + ++D IK++A++P  EG+ 
Sbjct: 80  PTAVIYTDNADDVTEPARIVSKYEDDFDVIEIKGGMLEGKLTSKDEIKELAAIPGREGLL 139

Query: 134 AGIISAIQS 142
           + ++S +Q 
Sbjct: 140 SMLVSCLQD 148


>gi|94543925|gb|ABF33973.1| LSU ribosomal protein L10P [Streptococcus pyogenes MGAS10270]
          Length = 187

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 49/168 (29%), Positives = 93/168 (55%), Gaps = 13/168 (7%)

Query: 6   KSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDT 65
           K+ ++  +++   ++ SIVV   +G++V Q   LR+ +RE+G   KV KN ++  A    
Sbjct: 30  KAEQVELIAEKMKAAASIVVVDSRGLTVDQDTVLRRSLRESGVEFKVIKNSILTRAAEKA 89

Query: 66  SIRGISDLFVGQSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIA 124
            +  + D+FVG S + +S+  VIAP K+   F+   +   + GG +E  V +++ I+ +A
Sbjct: 90  GLGELKDVFVGPSAVAFSNEDVIAPAKVINDFTKTADALEIKGGAIEGAVSSKEEIQALA 149

Query: 125 SLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQQG 172
           +LP+ EG+ + ++S +Q+           P   V  A+ A V +N++G
Sbjct: 150 TLPNREGMLSMLLSVLQA-----------PVRNVAYAVKA-VAENKEG 185


>gi|126666822|ref|ZP_01737799.1| Ribosomal protein L10 [Marinobacter sp. ELB17]
 gi|126628867|gb|EAZ99487.1| Ribosomal protein L10 [Marinobacter sp. ELB17]
          Length = 176

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 46/170 (27%), Positives = 87/170 (51%), Gaps = 1/170 (0%)

Query: 4   QGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIR 63
           + K   ++E+++    + S+V+A Y+G++   +  LR + R     ++V +N L KIAIR
Sbjct: 6   EDKKAIVAEVNETAGGALSVVLADYRGVTSGDMTALRARARAENVRLQVVRNNLAKIAIR 65

Query: 64  DTSIRGISDLFVGQSLIVYS-DSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQ 122
            T    I +  VG +++ +S + P  A ++   F+ +   F + G  V   ++  D I +
Sbjct: 66  GTEFECIGEALVGPTILAFSMEDPGAAARLLKDFAKEKEAFEIKGLAVGGVLMGADQIDR 125

Query: 123 IASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQQG 172
           +A LP        + +  Q+  T+L R L    T+V RA++A  D+ Q+ 
Sbjct: 126 LAKLPTRHEALTMLAAVTQAPITKLARTLIEVPTKVTRAVAAVRDQKQEA 175


>gi|302876544|ref|YP_003845177.1| 50S ribosomal protein L10 [Clostridium cellulovorans 743B]
 gi|307687217|ref|ZP_07629663.1| 50S ribosomal protein L10 [Clostridium cellulovorans 743B]
 gi|302579401|gb|ADL53413.1| ribosomal protein L10 [Clostridium cellulovorans 743B]
          Length = 168

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 44/151 (29%), Positives = 79/151 (52%), Gaps = 1/151 (0%)

Query: 2   NRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIA 61
           NR  K  +++E+ +   +S  +V+A Y+G +      LRK  REAG   K+ KN LV +A
Sbjct: 7   NRIAKQEKVAEIKEKLVNSKGLVLAQYQGNTAEADTALRKACREAGVEYKIYKNTLVALA 66

Query: 62  IRDTSIRGISDLFVGQSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
            ++  I G+     G   I +      AP +I   F+ ++  F +  GVVE  V + ++I
Sbjct: 67  AKEAGIEGLDPFLTGPIAIAFGYEEATAPARILNDFAKEHKSFELKAGVVEGTVYDTETI 126

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLL 151
           K++A++P  E + A ++ + ++  +    LL
Sbjct: 127 KKLANIPSREVLIAKLLGSFKAPISNFAYLL 157


>gi|221135385|ref|ZP_03561688.1| 50S ribosomal protein L10 [Glaciecola sp. HTCC2999]
          Length = 172

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 45/160 (28%), Positives = 86/160 (53%), Gaps = 1/160 (0%)

Query: 10  ISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRG 69
           ++E+S++ S + S+ VA Y+G+ V+++ DLR K RE G  VKV +N L K  + D+    
Sbjct: 12  VAEVSEVASQALSVAVAEYRGMEVSELTDLRVKAREQGVYVKVIRNTLAKRGLADSKFAD 71

Query: 70  ISDLFVGQSLIVYS-DSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASLPD 128
           I     G  +  +S D+P  A ++   F+ +N +  V    +  G+L  + +  +ASLP 
Sbjct: 72  IESALTGPLIYGFSIDAPGGAARLFKDFAKENKKLNVTALSIGNGLLGPEKLDAVASLPT 131

Query: 129 LEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDK 168
            +   A +++  ++   + V+ +    T+ VR ++A  D+
Sbjct: 132 RDEALAKLLATFKAPVGKFVQTINEVPTKFVRVLAAIKDE 171


>gi|71853390|gb|AAZ51413.1| LSU ribosomal protein L10P [Streptococcus pyogenes MGAS5005]
          Length = 198

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 48/168 (28%), Positives = 93/168 (55%), Gaps = 13/168 (7%)

Query: 6   KSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDT 65
           K+ ++  +++   ++ SIV+   +G++V Q   LR+ +RE+G   KV KN ++  A    
Sbjct: 41  KAEQVELIAEKMKAAASIVIVDSRGLTVDQDTVLRRSLRESGVEFKVIKNSILTRAAEKA 100

Query: 66  SIRGISDLFVGQSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIA 124
            +  + D+FVG S + +S+  VIAP K+   F+   +   + GG +E  V +++ I+ +A
Sbjct: 101 GLDELKDVFVGPSAVAFSNEDVIAPAKVINDFTKTADALEIKGGAIEGAVSSKEEIQALA 160

Query: 125 SLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQQG 172
           +LP+ EG+ + ++S +Q+           P   V  A+ A V +N++G
Sbjct: 161 TLPNREGMLSMLLSVLQA-----------PVRNVAYAVKA-VAENKEG 196


>gi|317494915|ref|ZP_07953325.1| ribosomal protein L10 [Enterobacteriaceae bacterium 9_2_54FAA]
 gi|316917103|gb|EFV38452.1| ribosomal protein L10 [Enterobacteriaceae bacterium 9_2_54FAA]
          Length = 165

 Score = 75.1 bits (183), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 45/159 (28%), Positives = 88/159 (55%), Gaps = 2/159 (1%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           +N Q K   ++E+ ++   + S V+A  +G++V ++ +LRK  REAG  ++V +N L++ 
Sbjct: 3   LNLQDKQAIVAEVIEVAKGAHSAVIADSRGVTVDKMTELRKAGREAGVYMRVVRNTLMRR 62

Query: 61  AIRDTSIRGISDLFVGQSLIVYS-DSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
            +  T    + D FVG +L+ +S + P  A ++   F+  N +F V     E  ++    
Sbjct: 63  IVEGTPFECLKDTFVGPTLVAFSMEHPGAAARLFKDFAKANAKFEVKAAAFEGELIPAAQ 122

Query: 120 IKQIASLPDLEGIRAGIISAI-QSNATRLVRLLGTPQTQ 157
           I ++A+LP  E   A +++ + +++A +LVR L   + Q
Sbjct: 123 IDRLATLPTYEEAIARLMATMKEASAGKLVRTLAALRDQ 161


>gi|218710881|ref|YP_002418502.1| 50S ribosomal protein L10 [Vibrio splendidus LGP32]
 gi|218323900|emb|CAV20261.1| Ribosomal protein L10 [Vibrio splendidus LGP32]
          Length = 177

 Score = 75.1 bits (183), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 47/159 (29%), Positives = 87/159 (54%), Gaps = 5/159 (3%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           +N Q K   ++E+++  S + S VVA  +G++V  +  LRK+ REAG  ++V +N L + 
Sbjct: 16  LNLQDKKAIVAEVNEAASGALSAVVADSRGVTVGAMTSLRKQAREAGVYMRVVRNTLARR 75

Query: 61  AIRDTSIRGISDLFVGQSLIVYS-DSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
           AI+ T    ++D F G +LI +S + P  A ++   F+ +N +F +     E  V + + 
Sbjct: 76  AIQGTDYECLTDTFTGPTLIAFSNEHPGAAARLFKDFAKENKDFEIKAAAFEGAVTDAEV 135

Query: 120 IKQIASLPDL-EGIRAGIISAIQSNATRLVRLLGTPQTQ 157
              +A+LP   E I   ++   +++A +LVR +   + Q
Sbjct: 136 ---LATLPTYDEAIARLMMCMKEASAGKLVRTIAAVRDQ 171


>gi|217967754|ref|YP_002353260.1| ribosomal protein L10 [Dictyoglomus turgidum DSM 6724]
 gi|226699939|sp|B8E0K1|RL10_DICTD RecName: Full=50S ribosomal protein L10
 gi|217336853|gb|ACK42646.1| ribosomal protein L10 [Dictyoglomus turgidum DSM 6724]
          Length = 178

 Score = 75.1 bits (183), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 47/173 (27%), Positives = 87/173 (50%), Gaps = 2/173 (1%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M +  K  ++ EL +   ++ +++   +KG+SVA +  LR K+R      +V KN L   
Sbjct: 1   MPKPEKIQKVEELYQKMLNANALIFTEFKGLSVADLTQLRGKIRPLNAEYRVVKNTLALR 60

Query: 61  AI-RDTSIRGISDLFVGQSLIVYS-DSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQD 118
           AI R    + +   FVG + I Y  D P    K  V ++ D+   +  GG+++  V + D
Sbjct: 61  AIQRMYPDKDLEKFFVGPTAITYCYDDPFGVLKALVDYAKDHELLKFKGGIIDGEVYSAD 120

Query: 119 SIKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQQ 171
            I+++A LP  E I + ++ +I +  + LV  L  P  ++V  + A   + ++
Sbjct: 121 EIRELAKLPPKEVILSQVVGSISAPLSSLVWNLKWPVNKLVWTLDAIAKEKEK 173


>gi|32491269|ref|NP_871523.1| hypothetical protein WGLp520 [Wigglesworthia glossinidia
           endosymbiont of Glossina brevipalpis]
 gi|31340349|sp|Q8D235|RL10_WIGBR RecName: Full=50S ribosomal protein L10
 gi|25166476|dbj|BAC24666.1| rplJ [Wigglesworthia glossinidia endosymbiont of Glossina
           brevipalpis]
          Length = 161

 Score = 75.1 bits (183), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 49/153 (32%), Positives = 86/153 (56%), Gaps = 2/153 (1%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           +NR+ K   IS+++KI  SS SI++    GI+  Q+ +LRK  R+    +K  +N L++ 
Sbjct: 2   LNRKNKENIISKINKITKSSLSILIVDPTGITSNQMNNLRKSSRKLNVNIKQVRNTLMRF 61

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDS-PVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
           AI DT    +     G +LI +S S P  A +I  +F+ +NN+ ++   V E+ ++   +
Sbjct: 62  AIVDTEFDCLEKYIKGSNLIAFSHSHPGSAARIFKNFTKENNKIKIKLAVFERKIITDSN 121

Query: 120 IKQIASLPDLEGIRAGIISAIQ-SNATRLVRLL 151
           I  +A+LP  E      I+ IQ ++  +L+R+L
Sbjct: 122 IDYLANLPTHEESVINFINIIQEASIKKLIRIL 154


>gi|67924344|ref|ZP_00517776.1| Ribosomal protein L10 [Crocosphaera watsonii WH 8501]
 gi|67853800|gb|EAM49127.1| Ribosomal protein L10 [Crocosphaera watsonii WH 8501]
          Length = 188

 Score = 75.1 bits (183), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 47/147 (31%), Positives = 80/147 (54%), Gaps = 2/147 (1%)

Query: 3   RQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAI 62
           R+ K+  I+E+ ++ S +   +V  Y+G+SVA+I DLR +++ +G   KV KN  ++ A+
Sbjct: 5   RENKATVIAEIKELLSEAQLGIVIDYQGLSVAEITDLRNRLQPSGAICKVTKNTFMEKAV 64

Query: 63  R-DTSIRGISDLFVGQS-LIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
             D +   ++D   G S  ++  D    A +   SF  D  +    GGV++   LN++ +
Sbjct: 65  TGDEAWEPMTDFLKGTSAFVLVKDDVGSAVRAYQSFKKDTKKTEFRGGVMQGQALNEEQV 124

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRL 147
           K IA LP  E +   +  AI S AT+L
Sbjct: 125 KAIADLPSKEELIGQVAGAINSIATKL 151


>gi|241895132|ref|ZP_04782428.1| ribosomal protein L10 [Weissella paramesenteroides ATCC 33313]
 gi|241871628|gb|EER75379.1| ribosomal protein L10 [Weissella paramesenteroides ATCC 33313]
          Length = 167

 Score = 75.1 bits (183), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 39/138 (28%), Positives = 83/138 (60%), Gaps = 1/138 (0%)

Query: 6   KSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDT 65
           K+ +++E++  F ++ S VVA  +G++V +   LR ++R  G  ++V KN+++  A    
Sbjct: 9   KAQQVAEVADKFKNATSAVVADVRGLTVEESNKLRAELRGEGVELRVIKNKVLTRAAEAA 68

Query: 66  SIRGISDLFVGQSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIA 124
            +  ++DLF G S + +S    IAP ++   +++D +   + GG ++  +++ D I + A
Sbjct: 69  DLSELNDLFAGPSAVAFSADDAIAPARVLKKYADDIDALEIKGGYIDGNIVSIDEINKYA 128

Query: 125 SLPDLEGIRAGIISAIQS 142
           SLPD +G+ + ++S +Q+
Sbjct: 129 SLPDRDGLLSMLLSTLQA 146


>gi|73535864|pdb|1ZAW|A Chain A, Ribosomal Protein L10-L12(Ntd) Complex, Space Group
           P212121, Form A
          Length = 180

 Score = 75.1 bits (183), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 49/178 (27%), Positives = 89/178 (50%), Gaps = 7/178 (3%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREA---GGGVKVAKNRL 57
           + RQ K + + E S+IF  +  I+ A + G +VA + +LR ++RE    G   +V KN L
Sbjct: 3   LTRQQKELIVKEXSEIFKKTSLILFADFLGFTVADLTELRSRLREKYGDGARFRVVKNTL 62

Query: 58  VKIAIRDTSIRGISDLFVGQSLIVY--SDSPVIAPKISVSFSNDN--NEFRVLGGVVEKG 113
           + +A+++    G  +   G + ++Y     PV A KI  +F  D   +  R+ GG +E  
Sbjct: 63  LNLALKNAEYEGYEEFLKGPTAVLYVTEGDPVEAVKIIYNFYKDKKADLSRLKGGFLEGK 122

Query: 114 VLNQDSIKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQQ 171
               + ++ IA LP  E + A ++  +++  T LV  L      +V  ++A  +K  +
Sbjct: 123 KFTAEEVENIAKLPSKEELYAXLVGRVKAPITGLVFALSGILRNLVYVLNAIKEKKSE 180


>gi|307720237|ref|YP_003891377.1| 50S ribosomal protein L10P [Sulfurimonas autotrophica DSM 16294]
 gi|306978330|gb|ADN08365.1| LSU ribosomal protein L10P [Sulfurimonas autotrophica DSM 16294]
          Length = 160

 Score = 75.1 bits (183), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 43/146 (29%), Positives = 81/146 (55%), Gaps = 5/146 (3%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M +  K+  I +L+  F+++ ++V+  YKG++V+Q+++LRK  R     V+V KN L  I
Sbjct: 1   MLKSKKAEVIEQLTTSFANTTAVVICDYKGLTVSQLEELRKAARAKDTSVQVVKNTLATI 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           A+ +  + G+       ++ ++SD  + A KI+  F+ D+++F +  G ++K   N   I
Sbjct: 61  ALNNAEMSGVE--IKDTNIFIWSDDVINAAKIAADFAKDHDKFVIKAGYLDKEPANVAKI 118

Query: 121 KQIASLP---DLEGIRAGIISAIQSN 143
           +  A LP   +L G+ A    A  +N
Sbjct: 119 EAFAKLPGRDELLGMLAATWMAPITN 144


>gi|162139106|ref|YP_598517.2| 50S ribosomal protein L10 [Streptococcus pyogenes MGAS10270]
          Length = 166

 Score = 74.7 bits (182), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 49/168 (29%), Positives = 93/168 (55%), Gaps = 13/168 (7%)

Query: 6   KSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDT 65
           K+ ++  +++   ++ SIVV   +G++V Q   LR+ +RE+G   KV KN ++  A    
Sbjct: 9   KAEQVELIAEKMKAAASIVVVDSRGLTVDQDTVLRRSLRESGVEFKVIKNSILTRAAEKA 68

Query: 66  SIRGISDLFVGQSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIA 124
            +  + D+FVG S + +S+  VIAP K+   F+   +   + GG +E  V +++ I+ +A
Sbjct: 69  GLGELKDVFVGPSAVAFSNEDVIAPAKVINDFTKTADALEIKGGAIEGAVSSKEEIQALA 128

Query: 125 SLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQQG 172
           +LP+ EG+ + ++S +Q+           P   V  A+ A V +N++G
Sbjct: 129 TLPNREGMLSMLLSVLQA-----------PVRNVAYAVKA-VAENKEG 164


>gi|77359191|ref|YP_338766.1| 50S ribosomal protein L10 [Pseudoalteromonas haloplanktis TAC125]
 gi|97181860|sp|Q3ILQ2|RL10_PSEHT RecName: Full=50S ribosomal protein L10
 gi|76874102|emb|CAI85323.1| 50S ribosomal protein L10 [Pseudoalteromonas haloplanktis TAC125]
          Length = 164

 Score = 74.7 bits (182), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 50/159 (31%), Positives = 88/159 (55%), Gaps = 5/159 (3%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           +N QGK   ++E+++  + + S VVA  +G++V  I  LRK+ R  G  +KV +N L K 
Sbjct: 3   LNLQGKQAIVAEVNEAANGALSAVVADSRGVTVGAITALRKEARANGVWMKVVRNTLAKR 62

Query: 61  AIRDTSIRGISDLFVGQSLIVY-SDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
           A+  T    +SD FVG SLI + S+ P  A +I  +F+  N +F +     E  V++   
Sbjct: 63  ALEGTQFECLSDSFVGPSLIAFSSEHPGAAARIFSAFAKKNEKFELKTAAFEGNVVDA-- 120

Query: 120 IKQIASLPDLEGIRAGIISAI-QSNATRLVRLLGTPQTQ 157
              +A+LP  +   A ++SA+ +++A +L + +   + Q
Sbjct: 121 -AMLATLPTYDEAVARLMSAMKEASAGKLCKTIEAVRVQ 158


>gi|254483552|ref|ZP_05096778.1| ribosomal protein L10, putative [marine gamma proteobacterium
           HTCC2148]
 gi|214036209|gb|EEB76890.1| ribosomal protein L10, putative [marine gamma proteobacterium
           HTCC2148]
          Length = 176

 Score = 74.7 bits (182), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 48/168 (28%), Positives = 90/168 (53%), Gaps = 1/168 (0%)

Query: 4   QGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIR 63
           + K   ++E+++  +S+ S+V+A  +G++V  +  LRK  RE    ++V +N L K A+ 
Sbjct: 6   EDKKAIVAEVNETATSAMSLVIADARGVTVDGMTALRKDARENQVTLRVVRNTLAKRALE 65

Query: 64  DTSIRGISDLFVGQSLIVYS-DSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQ 122
            T    ++D   G SL  +S + P  A +I   FS DN  F V    V   +L  + +  
Sbjct: 66  GTEYECVNDSLAGPSLFGFSMEDPGAAARIFKDFSKDNEAFEVKALAVSGQMLGAEQLDV 125

Query: 123 IASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQ 170
           +A LP  +   + ++S +Q+ AT+LV+ +     ++VR ++A  D+ +
Sbjct: 126 LAKLPTRDQALSMLMSVMQAPATKLVQTMNEVPGKLVRTLAAVRDQKE 173


>gi|293394020|ref|ZP_06638324.1| 50S ribosomal protein L10 [Serratia odorifera DSM 4582]
 gi|291423460|gb|EFE96685.1| 50S ribosomal protein L10 [Serratia odorifera DSM 4582]
          Length = 165

 Score = 74.7 bits (182), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 46/159 (28%), Positives = 87/159 (54%), Gaps = 2/159 (1%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           +N Q K   ++E++++   + S VVA  +G++V ++ +LRK  REAG  ++V +N L++ 
Sbjct: 3   LNLQDKQAIVAEVNEVAKGALSAVVADSRGVTVDKMTELRKAGREAGVYMRVVRNTLMRR 62

Query: 61  AIRDTSIRGISDLFVGQSLIVYS-DSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
            +  T    + D FVG +LI +S + P  A ++   F+  N +F V     E  ++    
Sbjct: 63  VVEGTPFECLKDTFVGPTLIAFSNEHPGAAARLFKEFAKANAKFEVKAAAFEGELIPAAQ 122

Query: 120 IKQIASLPDLEGIRAGIISAIQSNAT-RLVRLLGTPQTQ 157
           I ++A+LP  +   A +++ ++  A  +LVR L   + Q
Sbjct: 123 IDRLATLPTYDEAIARLMATMKEAAAGKLVRTLAAVRDQ 161


>gi|320322331|gb|EFW78425.1| 50S ribosomal protein L10 [Pseudomonas syringae pv. glycinea str.
           B076]
          Length = 166

 Score = 74.7 bits (182), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 47/155 (30%), Positives = 83/155 (53%), Gaps = 1/155 (0%)

Query: 4   QGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIR 63
           + K   ++E+++   +  S VVA  +G++V  +  LRK+ REAG  V+V +N L+K A+ 
Sbjct: 6   EDKKAIVAEVNEAAKAGLSAVVADARGVTVGAMTGLRKEAREAGVYVRVVRNTLLKRAVA 65

Query: 64  DTSIRGISDLFVGQSLIVYS-DSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQ 122
           DT    ++D+F G +LI +S + P  A ++   F+   ++F +     E   L  + I  
Sbjct: 66  DTEFSVLNDVFTGPTLIAFSNEHPGAAARLFKEFAKGQDKFEIKAAAFEGKFLAANQIDV 125

Query: 123 IASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQ 157
           +ASLP      + ++S IQ   ++L R L   + Q
Sbjct: 126 LASLPIRNEAISQLMSVIQGATSKLARTLAAVRDQ 160


>gi|315222733|ref|ZP_07864622.1| ribosomal protein L10 [Streptococcus anginosus F0211]
 gi|315188419|gb|EFU22145.1| ribosomal protein L10 [Streptococcus anginosus F0211]
          Length = 166

 Score = 74.7 bits (182), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 45/157 (28%), Positives = 83/157 (52%), Gaps = 12/157 (7%)

Query: 17  FSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRGISDLFVG 76
             ++ SIVV   +G++V Q   LR+ +R +    KV KN +++ A     + G++D FVG
Sbjct: 20  MKAAASIVVVDARGLTVEQDTVLRRNLRGSEVEYKVIKNSILRRAAEKAGLEGLADAFVG 79

Query: 77  QSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASLPDLEGIRAG 135
            S + +S+  V+AP KI   F+ + +   + GG +E  V +++ I  +A+LP+ EG+ + 
Sbjct: 80  PSAVAFSNEDVVAPAKIINDFTKEADALEIKGGAIEGAVASKEEIVALATLPNREGLLSM 139

Query: 136 IISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQQG 172
           ++S +Q+           P   V  A+ A  D  ++ 
Sbjct: 140 LLSVLQA-----------PVRNVALAVKAVADNKEEA 165


>gi|170780571|ref|YP_001708903.1| 50S ribosomal protein L10 [Clavibacter michiganensis subsp.
           sepedonicus]
 gi|169155139|emb|CAQ00239.1| 50S ribosomal protein L10 [Clavibacter michiganensis subsp.
           sepedonicus]
          Length = 181

 Score = 74.7 bits (182), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 50/167 (29%), Positives = 82/167 (49%), Gaps = 4/167 (2%)

Query: 6   KSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDT 65
           K   ++EL++ F SS ++++  Y+G++VAQ+K LRK +  A     V KN L KIA    
Sbjct: 14  KEASVAELAEKFRSSNAVLLTEYRGLTVAQLKQLRKSI-SADATYAVVKNTLTKIAANQA 72

Query: 66  SIRGISDLFVGQSLI--VYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQI 123
            I    D  VG S I  V+ D+  +A  +  +F+  N    V GG  +   L  D + ++
Sbjct: 73  GISSFDDELVGPSAIAFVHGDTVAVAKALR-TFTKANPLLVVKGGYFDGNPLTADEVNKL 131

Query: 124 ASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQ 170
           A L   E +   +  A +++      L   P +Q VR + A  +K +
Sbjct: 132 ADLESREVLLGKLAGAFKASLFGAAYLFNAPLSQAVRTVEALREKQE 178


>gi|86147867|ref|ZP_01066172.1| 50S ribosomal protein L10 [Vibrio sp. MED222]
 gi|85834294|gb|EAQ52447.1| 50S ribosomal protein L10 [Vibrio sp. MED222]
          Length = 164

 Score = 74.7 bits (182), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 47/159 (29%), Positives = 87/159 (54%), Gaps = 5/159 (3%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           +N Q K   ++E+++  S + S VVA  +G++V  +  LRK+ REAG  ++V +N L + 
Sbjct: 3   LNLQDKKAIVAEVNEAASGALSAVVADSRGVTVGAMTSLRKQAREAGVYMRVVRNTLARR 62

Query: 61  AIRDTSIRGISDLFVGQSLIVYS-DSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
           AI+ T    ++D F G +LI +S + P  A ++   F+ +N +F +     E  V + + 
Sbjct: 63  AIQGTDYECLTDTFTGPTLIAFSNEHPGAAARLFKDFAKENKDFEIKAAAFEGAVTDAEV 122

Query: 120 IKQIASLPDL-EGIRAGIISAIQSNATRLVRLLGTPQTQ 157
              +A+LP   E I   ++   +++A +LVR +   + Q
Sbjct: 123 ---LATLPTYDEAIARLMMCMKEASAGKLVRTIAAVRDQ 158


>gi|148272039|ref|YP_001221600.1| 50S ribosomal protein L10 [Clavibacter michiganensis subsp.
           michiganensis NCPPB 382]
 gi|147829969|emb|CAN00896.1| 50S ribosomal protein L10 [Clavibacter michiganensis subsp.
           michiganensis NCPPB 382]
          Length = 171

 Score = 74.7 bits (182), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 50/167 (29%), Positives = 82/167 (49%), Gaps = 4/167 (2%)

Query: 6   KSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDT 65
           K   ++EL++ F SS ++++  Y+G++VAQ+K LRK +  A     V KN L KIA    
Sbjct: 4   KEASVAELAEKFRSSNAVLLTEYRGLTVAQLKQLRKSI-SADATYAVVKNTLTKIAANQA 62

Query: 66  SIRGISDLFVGQSLI--VYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQI 123
            I    D  VG S I  V+ D+  +A  +  +F+  N    V GG  +   L  D + ++
Sbjct: 63  GISSFDDELVGPSAIAFVHGDTVAVAKALR-TFTKANPLLVVKGGYFDGNPLTADEVNKL 121

Query: 124 ASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQ 170
           A L   E +   +  A +++      L   P +Q VR + A  +K +
Sbjct: 122 ADLESREVLLGKLAGAFKASLFGAAYLFNAPLSQAVRTVEALREKQE 168


>gi|15828013|ref|NP_302276.1| 50S ribosomal protein L10 [Mycobacterium leprae TN]
 gi|221230490|ref|YP_002503906.1| 50S ribosomal protein L10 [Mycobacterium leprae Br4923]
 gi|13633835|sp|Q9CBK7|RL10_MYCLE RecName: Full=50S ribosomal protein L10
 gi|254798392|sp|B8ZSD0|RL10_MYCLB RecName: Full=50S ribosomal protein L10
 gi|13093566|emb|CAC30850.1| 50S ribosomal protein L10 [Mycobacterium leprae]
 gi|219933597|emb|CAR71992.1| 50S ribosomal protein L10 [Mycobacterium leprae Br4923]
          Length = 177

 Score = 74.7 bits (182), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 42/169 (24%), Positives = 88/169 (52%), Gaps = 2/169 (1%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M R  K+  ++ +++ F ++ + ++  Y+G++VA + +LR+ +        VAKN L+K 
Sbjct: 1   MARADKATAVANIAEQFKAATAALITEYRGLTVANLAELRRSLT-GSASYAVAKNTLIKR 59

Query: 61  AIRDTSIRGISDLFVGQSLIVY-SDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
           A  +  I G+ +LF G + I + +  PV A K   +F+ ++    + GG ++   +    
Sbjct: 60  AASEVGIEGLDELFAGPTAIAFVTGEPVDAAKAIKTFAKEHKALVIKGGYMDGHPMTVAE 119

Query: 120 IKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDK 168
           +++IA L   E + A +  A++    + + L   P +Q+ R  +A  +K
Sbjct: 120 VERIADLESREVLLAKLAGAMKGTFAKAIGLFNAPTSQMARLTAALQEK 168


>gi|15675064|ref|NP_269238.1| 50S ribosomal protein L10 [Streptococcus pyogenes M1 GAS]
 gi|161936124|ref|YP_282158.2| 50S ribosomal protein L10 [Streptococcus pyogenes MGAS5005]
 gi|57014103|sp|P68900|RL10_STRP1 RecName: Full=50S ribosomal protein L10
 gi|13622218|gb|AAK33959.1| 50S ribosomal protein L10 [Streptococcus pyogenes M1 GAS]
          Length = 166

 Score = 74.7 bits (182), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 48/168 (28%), Positives = 93/168 (55%), Gaps = 13/168 (7%)

Query: 6   KSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDT 65
           K+ ++  +++   ++ SIV+   +G++V Q   LR+ +RE+G   KV KN ++  A    
Sbjct: 9   KAEQVELIAEKMKAAASIVIVDSRGLTVDQDTVLRRSLRESGVEFKVIKNSILTRAAEKA 68

Query: 66  SIRGISDLFVGQSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIA 124
            +  + D+FVG S + +S+  VIAP K+   F+   +   + GG +E  V +++ I+ +A
Sbjct: 69  GLDELKDVFVGPSAVAFSNEDVIAPAKVINDFTKTADALEIKGGAIEGAVSSKEEIQALA 128

Query: 125 SLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQQG 172
           +LP+ EG+ + ++S +Q+           P   V  A+ A V +N++G
Sbjct: 129 TLPNREGMLSMLLSVLQA-----------PVRNVAYAVKA-VAENKEG 164


>gi|85858136|ref|YP_460338.1| 50S ribosomal protein L10 [Syntrophus aciditrophicus SB]
 gi|97182050|sp|Q2LQ89|RL10_SYNAS RecName: Full=50S ribosomal protein L10
 gi|85721227|gb|ABC76170.1| LSU ribosomal protein L10 [Syntrophus aciditrophicus SB]
          Length = 174

 Score = 74.7 bits (182), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 53/175 (30%), Positives = 94/175 (53%), Gaps = 7/175 (4%)

Query: 1   MNRQGK---SVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRL 57
           M+R+ K   +VE+ E  K F  +   V+A++ G+ VA++  LR  +R++   +KV KN L
Sbjct: 1   MDRRTKEQVAVELHEKVKSFKLA---VLANFSGMGVAKMTTLRNDLRKSNAELKVVKNTL 57

Query: 58  VKIAIRDTSIRGISDLFVGQ-SLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLN 116
           ++IA RDTS+  + D F G  +LI+    PV   KI   F+  N E  +  G++   V+ 
Sbjct: 58  LRIASRDTSLEALQDDFKGPLALILGYGDPVEPSKILSDFAKKNAELELKIGMLSDKVIT 117

Query: 117 QDSIKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQQ 171
            + +  +A LP  E + A ++S +    T+LV +L      +V+ +  +  K ++
Sbjct: 118 VEQLSALAELPSREILLAKLLSVMVGVQTQLVNVLSAVPRGLVQVLDGYRAKKEE 172


>gi|313903161|ref|ZP_07836555.1| LSU ribosomal protein L10P [Thermaerobacter subterraneus DSM 13965]
 gi|313466663|gb|EFR62183.1| LSU ribosomal protein L10P [Thermaerobacter subterraneus DSM 13965]
          Length = 175

 Score = 74.7 bits (182), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 41/166 (24%), Positives = 85/166 (51%), Gaps = 1/166 (0%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           +NR  K   + +L+     +  +++  ++G++VA   +LR+++R  G   +V KN L++ 
Sbjct: 2   LNRAQKEALVEDLAGKLQRAQGVILTDFRGLNVAATTELRRRLRAQGVEYRVIKNTLIRR 61

Query: 61  AIRDTSIRGISDLFVGQSLIVYS-DSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
           A     I G+  L  G + + +  D PV+A K    F+ + N+ ++ GG+++  ++    
Sbjct: 62  AAEKAGIEGLDPLLEGPTALAFGFDDPVVAAKELSRFAREYNQLQIKGGLLDGRIIGVKE 121

Query: 120 IKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAF 165
           ++Q+A LP  E + A ++  +Q+    L  +L       V A+ A 
Sbjct: 122 VQQLADLPSREELLAKVMGGMQAPLYGLAGVLAATLRSFVYAVDAL 167


>gi|42518510|ref|NP_964440.1| 50S ribosomal protein L10 [Lactobacillus johnsonii NCC 533]
 gi|227888778|ref|ZP_04006583.1| hypothetical protein HMPREF0528_0115 [Lactobacillus johnsonii ATCC
           33200]
 gi|61215128|sp|Q74L09|RL10_LACJO RecName: Full=50S ribosomal protein L10
 gi|41582795|gb|AAS08406.1| 50S ribosomal protein L10 [Lactobacillus johnsonii NCC 533]
 gi|227850615|gb|EEJ60701.1| hypothetical protein HMPREF0528_0115 [Lactobacillus johnsonii ATCC
           33200]
          Length = 166

 Score = 74.7 bits (182), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 41/136 (30%), Positives = 80/136 (58%), Gaps = 3/136 (2%)

Query: 10  ISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRG 69
           + + +     + +I+V  Y G++V ++ +LRK +R+A   +KV KN  +K A     I G
Sbjct: 13  VDDFAAELKEAKAILVIDYLGLTVEEVTNLRKDLRDANVKMKVIKNTYLKRAAEKAGIEG 72

Query: 70  ISDLFVGQSLIVYS-DSPVIA--PKISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASL 126
           + D FVG + +VY+ D+  I    +I   + +D +   + GG++E  V +Q+ IK++A++
Sbjct: 73  LEDTFVGPTAVVYTADAEDITEPARIVSKYEDDIDALSIKGGMLEGKVASQEEIKKLAAI 132

Query: 127 PDLEGIRAGIISAIQS 142
           P  EG+ + ++S +Q+
Sbjct: 133 PGREGLLSMLVSVLQA 148


>gi|188532312|ref|YP_001906109.1| 50S ribosomal protein L10 [Erwinia tasmaniensis Et1/99]
 gi|259906927|ref|YP_002647283.1| 50S ribosomal protein L10 [Erwinia pyrifoliae Ep1/96]
 gi|226699948|sp|B2VG94|RL10_ERWT9 RecName: Full=50S ribosomal protein L10
 gi|188027354|emb|CAO95199.1| 50S ribosomal protein L10 [Erwinia tasmaniensis Et1/99]
 gi|224962549|emb|CAX54004.1| 50S ribosomal protein L10 [Erwinia pyrifoliae Ep1/96]
 gi|283476720|emb|CAY72549.1| 50S ribosomal protein L10 [Erwinia pyrifoliae DSM 12163]
 gi|310766072|gb|ADP11022.1| 50S ribosomal protein L10 [Erwinia sp. Ejp617]
          Length = 167

 Score = 74.7 bits (182), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 46/159 (28%), Positives = 86/159 (54%), Gaps = 2/159 (1%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           +N Q K   ++E+S++   + S VVA  +G++V ++ +LRK  REAG  ++V +N L++ 
Sbjct: 3   LNLQDKQAIVAEVSEVAKGALSAVVADSRGVTVDKMTELRKAGREAGVYMRVVRNTLLRR 62

Query: 61  AIRDTSIRGISDLFVGQSLIVYS-DSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
            +  T    + D   G +LI YS + P  A ++   F+  N +F V     E  +++   
Sbjct: 63  VVEGTQFECLKDTLTGPTLIAYSMEHPGAAARLFKEFAKANAKFEVKAAAFEGELISAAQ 122

Query: 120 IKQIASLPDLEGIRAGIISAIQSNAT-RLVRLLGTPQTQ 157
           I ++A+LP  +   A +++ ++  A  +LVR L   + Q
Sbjct: 123 IDRLATLPTYDEAIARLMATMKEAAAGKLVRTLAAVRDQ 161


>gi|254283992|ref|ZP_04958960.1| 50S ribosomal protein L10 [gamma proteobacterium NOR51-B]
 gi|219680195|gb|EED36544.1| 50S ribosomal protein L10 [gamma proteobacterium NOR51-B]
          Length = 176

 Score = 74.7 bits (182), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 44/164 (26%), Positives = 91/164 (55%), Gaps = 1/164 (0%)

Query: 10  ISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRG 69
           ++E+++  +S+ S+VVA  +G++V+ +  LR+  R+    ++V +N L K A+  T    
Sbjct: 12  VAEVNETAASALSLVVADARGVTVSSMTALRQSARDNQVMLRVVRNTLAKRALEGTDYEC 71

Query: 70  ISDLFVGQSLIVYS-DSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASLPD 128
           ++D   G SL  +S + P  A ++   F+ +N  F V    V   +L  D + ++A LP 
Sbjct: 72  VNDTLAGPSLFGFSMEDPGAAARLFKDFAKENEHFEVKALSVSGELLGADQLDRLAKLPT 131

Query: 129 LEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQQG 172
            +   + ++S +Q+  T+LV+ +    +++VR ++A  D+ +Q 
Sbjct: 132 RDEALSILMSVMQAPTTKLVQTMHAVPSKLVRTLAAVRDQKEQA 175


>gi|255657877|ref|ZP_05403286.1| ribosomal protein L10 [Mitsuokella multacida DSM 20544]
 gi|260850067|gb|EEX70074.1| ribosomal protein L10 [Mitsuokella multacida DSM 20544]
          Length = 179

 Score = 74.7 bits (182), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 45/148 (30%), Positives = 82/148 (55%), Gaps = 6/148 (4%)

Query: 10  ISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRG 69
           +++L +   S+  +V+  YKG++VAQ  +LR+++REAG    V KN +++IA ++  I G
Sbjct: 11  VAQLKEQLESAKGVVLTSYKGLTVAQDTELRRELREAGVSYHVVKNTMLRIAAKEAGIEG 70

Query: 70  ISDLFVGQSLIVYSDSPVIAP-KISVSFSNDN--NEFRVLG---GVVEKGVLNQDSIKQI 123
           I +   G +   +S    +AP K+   F   N   +  VL    G+VE  V+  D +K +
Sbjct: 71  IEEHLEGTTAFAFSTEDAVAPAKVICGFIKKNKLEDAEVLTVKVGMVEGKVIGVDEVKAL 130

Query: 124 ASLPDLEGIRAGIISAIQSNATRLVRLL 151
           A+LP  E + A ++ ++ +  +  V +L
Sbjct: 131 AALPSREELIAKLLGSMNAPISNTVNVL 158


>gi|301059237|ref|ZP_07200174.1| ribosomal protein L10 [delta proteobacterium NaphS2]
 gi|300446672|gb|EFK10500.1| ribosomal protein L10 [delta proteobacterium NaphS2]
          Length = 174

 Score = 74.7 bits (182), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 48/173 (27%), Positives = 86/173 (49%), Gaps = 3/173 (1%)

Query: 1   MNRQGKSVEISELS-KIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVK 59
           MN+Q K   +  L  ++  + GS +V  Y+G+ V  +  LR+ +RE     +V KNRL+K
Sbjct: 1   MNKQDKKALVDNLHGRLEKAQGSYLV-DYQGLEVESMNRLRRDLREVNAEFEVVKNRLLK 59

Query: 60  IAIRDTSIRGISDLFVGQSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQD 118
           +A +DT    I+D   G + I  +   V+ P K  V F+ D  +  +    +    ++  
Sbjct: 60  LACKDTETEQIADFMQGPTAIALTYDDVVGPAKALVDFAKDFEKLEIKCAQIAGKPVDVA 119

Query: 119 SIKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQQ 171
            +K +A+LP  + + A  +S +Q+  T  VR+L     Q +  + A  +K  +
Sbjct: 120 GVKTLAALPGKDALLAQALSVMQAVPTSFVRVLNGVMGQFMNVLKAIEEKKSE 172


>gi|293399722|ref|ZP_06643868.1| ribosomal protein L10 [Erysipelotrichaceae bacterium 5_2_54FAA]
 gi|291306122|gb|EFE47365.1| ribosomal protein L10 [Erysipelotrichaceae bacterium 5_2_54FAA]
          Length = 177

 Score = 74.7 bits (182), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 40/133 (30%), Positives = 76/133 (57%)

Query: 10  ISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRG 69
           +SE+++    + S VV  Y+G+SVA++  LR+ +R  G   KV KN L + A  +     
Sbjct: 13  VSEIAQKMKEADSTVVVEYRGLSVAEVTQLRRDLRAEGVEFKVYKNSLAQRAAEEAGASE 72

Query: 70  ISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASLPDL 129
           +    VG + I +    V   ++   F+  +++  +  G+VE  V++ D+IK+++SLP+ 
Sbjct: 73  LVKDLVGPNAIAFGPDAVAPARVLAKFAKTHDKLVLKSGIVEGKVVSVDTIKELSSLPNR 132

Query: 130 EGIRAGIISAIQS 142
           EG+ + ++S +QS
Sbjct: 133 EGMLSMLLSCLQS 145


>gi|119485145|ref|ZP_01619530.1| 50S ribosomal protein L10 [Lyngbya sp. PCC 8106]
 gi|119457373|gb|EAW38498.1| 50S ribosomal protein L10 [Lyngbya sp. PCC 8106]
          Length = 190

 Score = 74.7 bits (182), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 46/140 (32%), Positives = 75/140 (53%), Gaps = 2/140 (1%)

Query: 10  ISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIR-DTSIR 68
           +++L +I S +   ++  YKG+SVAQI DLR ++RE G   KV KN  ++ A+  + +  
Sbjct: 12  VADLKQILSEAQLALIIDYKGLSVAQITDLRNRLRETGSTCKVTKNTFMRKAVEGNETWE 71

Query: 69  GISDLFVGQSLIVYS-DSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASLP 127
            + +   G S  +++ D    A K   +F  D+ +  + GGV+E   L+ D +K I  LP
Sbjct: 72  VMQEFLSGSSAFIFAQDDFGAAIKAYQAFQKDSKKTELRGGVMEGRALSVDDVKAITELP 131

Query: 128 DLEGIRAGIISAIQSNATRL 147
             E + A I   I S  T+L
Sbjct: 132 TKEELMAKIAGVINSIPTKL 151


>gi|292486725|ref|YP_003529595.1| 50S ribosomal protein L10 [Erwinia amylovora CFBP1430]
 gi|292897958|ref|YP_003537327.1| 50S ribosomal protein L10 [Erwinia amylovora ATCC 49946]
 gi|291197806|emb|CBJ44901.1| 50S ribosomal subunit protein L10 [Erwinia amylovora ATCC 49946]
 gi|291552142|emb|CBA19179.1| 50S ribosomal protein L10 [Erwinia amylovora CFBP1430]
 gi|312170791|emb|CBX79052.1| 50S ribosomal protein L10 [Erwinia amylovora ATCC BAA-2158]
          Length = 167

 Score = 74.7 bits (182), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 46/159 (28%), Positives = 86/159 (54%), Gaps = 2/159 (1%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           +N Q K   ++E+S++   + S VVA  +G++V ++ +LRK  REAG  ++V +N L++ 
Sbjct: 3   LNLQDKQAIVAEVSEVAKGALSAVVADSRGVTVDKMTELRKAGREAGVYMRVVRNTLLRR 62

Query: 61  AIRDTSIRGISDLFVGQSLIVYS-DSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
            +  T    + D   G +LI YS + P  A ++   F+  N +F V     E  +++   
Sbjct: 63  VVEGTQFECLKDTLTGPTLIAYSMEHPGAAARLFKEFAKANAKFEVKAAAFEGELISAAQ 122

Query: 120 IKQIASLPDLEGIRAGIISAIQSNAT-RLVRLLGTPQTQ 157
           I ++A+LP  +   A +++ ++  A  +LVR L   + Q
Sbjct: 123 IDRLATLPTYDEAIARLMATMKEAAAGKLVRTLAAVRDQ 161


>gi|238855644|ref|ZP_04645944.1| 50S ribosomal protein L10 [Lactobacillus jensenii 269-3]
 gi|260664915|ref|ZP_05865766.1| 50S ribosomal protein L10 [Lactobacillus jensenii SJ-7A-US]
 gi|282932784|ref|ZP_06338187.1| 50S ribosomal protein L10 [Lactobacillus jensenii 208-1]
 gi|313472538|ref|ZP_07813028.1| ribosomal protein L10 [Lactobacillus jensenii 1153]
 gi|238831710|gb|EEQ24047.1| 50S ribosomal protein L10 [Lactobacillus jensenii 269-3]
 gi|239529975|gb|EEQ68976.1| ribosomal protein L10 [Lactobacillus jensenii 1153]
 gi|260561398|gb|EEX27371.1| 50S ribosomal protein L10 [Lactobacillus jensenii SJ-7A-US]
 gi|281303092|gb|EFA95291.1| 50S ribosomal protein L10 [Lactobacillus jensenii 208-1]
          Length = 170

 Score = 74.7 bits (182), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 38/136 (27%), Positives = 83/136 (61%), Gaps = 3/136 (2%)

Query: 10  ISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRG 69
           +   ++   ++ +I+V  Y G++V ++ ++RK++RE    +KV KN  ++ A +   I G
Sbjct: 13  VDAFAEELKAAKAILVIDYLGLTVDEVTNMRKELRENDVKMKVIKNTYLRRAAKKAGIEG 72

Query: 70  ISDLFVGQSLIVYSDSP--VIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASL 126
           + D FVG + ++Y+D+   V  P +I   + +D +   + GG++E  + +++ IK++AS+
Sbjct: 73  LEDTFVGPTAVIYTDNADDVTEPARIVSKYEDDFDVINIKGGMLEGKLTSKEEIKELASI 132

Query: 127 PDLEGIRAGIISAIQS 142
           P  EG+ + ++S +Q+
Sbjct: 133 PGREGLLSMLVSVLQA 148


>gi|260774681|ref|ZP_05883586.1| LSU ribosomal protein L10p (P0) [Vibrio coralliilyticus ATCC
           BAA-450]
 gi|260609400|gb|EEX35549.1| LSU ribosomal protein L10p (P0) [Vibrio coralliilyticus ATCC
           BAA-450]
          Length = 164

 Score = 74.7 bits (182), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 47/159 (29%), Positives = 86/159 (54%), Gaps = 5/159 (3%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           +N Q K   ++E+++  S + S VVA  +G+ V  +  LRK+ REAG  +KV +N L + 
Sbjct: 3   LNLQDKKAIVAEVNEAASGALSAVVADSRGVEVGAMTSLRKQAREAGVYLKVVRNTLARR 62

Query: 61  AIRDTSIRGISDLFVGQSLIVYS-DSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
           A+  T    ++D F G +LI +S + P  A ++   F+ +N++F +     E  V + + 
Sbjct: 63  AVEGTDYECLTDTFTGPTLIAFSNEHPGAAARLFKDFAKENDKFEIKAAAFEGAVTDAEV 122

Query: 120 IKQIASLPDL-EGIRAGIISAIQSNATRLVRLLGTPQTQ 157
              +A+LP   E I   ++   +++A +LVR +   + Q
Sbjct: 123 ---LATLPTYDEAIARLMMCMKEASAGKLVRTIAALRDQ 158


>gi|291561994|emb|CBL40805.1| LSU ribosomal protein L10P [butyrate-producing bacterium SS3/4]
          Length = 170

 Score = 74.7 bits (182), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 42/143 (29%), Positives = 76/143 (53%), Gaps = 1/143 (0%)

Query: 10  ISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRG 69
           ++E++++ + + S VV  Y+G++V Q   LRK++REAG   KV KN +++ A + T    
Sbjct: 11  VAEIAEVLNGAKSAVVVDYRGLTVEQDTALRKQLREAGVSYKVYKNTMIRFAAKGTEFEA 70

Query: 70  ISDLFVGQSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASLPD 128
           +     G + +  S     AP ++   F+   ++  + GGVVE    +   I  IAS+P 
Sbjct: 71  LEPHLEGPTALAVSKEDATAPARVLAEFAKKADKLELKGGVVEGTYYDAAGIGVIASIPS 130

Query: 129 LEGIRAGIISAIQSNATRLVRLL 151
            E +   ++ ++QS  T   R+L
Sbjct: 131 REVLLGRLLGSMQSPITNFARVL 153


>gi|288554714|ref|YP_003426649.1| 50S ribosomal protein L10 [Bacillus pseudofirmus OF4]
 gi|288545874|gb|ADC49757.1| 50S ribosomal protein L10 [Bacillus pseudofirmus OF4]
          Length = 165

 Score = 74.7 bits (182), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 40/134 (29%), Positives = 78/134 (58%), Gaps = 1/134 (0%)

Query: 10  ISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRG 69
           +S+++     + + +V  Y+G++VA++ +LRK++REAG   KV KN L + A     +  
Sbjct: 11  VSDIADKLRDNKATIVVDYRGLNVAEVTELRKQLREAGVEFKVYKNSLTRRAADAAELSE 70

Query: 70  ISDLFVGQSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASLPD 128
           +++  VG + + +S   VIAP K+   F+  ++   +  GV+E  V + + IK +A LP 
Sbjct: 71  LNEKLVGPNAVAFSAEDVIAPAKVLNEFAKKHDALEIKAGVIEGRVASVEEIKALAELPS 130

Query: 129 LEGIRAGIISAIQS 142
            EG+ + + + +Q+
Sbjct: 131 REGLLSMLANVLQA 144


>gi|304310007|ref|YP_003809605.1| 50S ribosomal protein L10 [gamma proteobacterium HdN1]
 gi|301795740|emb|CBL43939.1| 50S ribosomal protein L10 [gamma proteobacterium HdN1]
          Length = 174

 Score = 74.7 bits (182), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 49/170 (28%), Positives = 94/170 (55%), Gaps = 7/170 (4%)

Query: 4   QGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIR 63
           + K V ++E+++  S++ S V+A Y+G++V+Q+  LR+  RE    V+V +N L K+A+R
Sbjct: 6   EDKKVIVAEVNEAASNALSAVIADYRGLTVSQMTKLRRAAREQKVFVQVVRNTLAKVAVR 65

Query: 64  DTSIRGISDLFVGQSLIVYS-DSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQ 122
            T    +SD  VG +++ +S + P  A ++   +S +  + +V G  V         I +
Sbjct: 66  GTEFECLSDSLVGPTILAFSMEDPGAAARLLKDYSKEFEKLKVKGLAVGGVAYPATEIDR 125

Query: 123 IASLPDLE---GIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKN 169
           +A+LP  +   GI AG+   +Q+  ++  R +    T++ R I+A  D+ 
Sbjct: 126 LANLPTRQQALGILAGV---LQAPISKFARTINEVPTKIARVIAAVKDQK 172


>gi|220927768|ref|YP_002504677.1| ribosomal protein L10 [Clostridium cellulolyticum H10]
 gi|219998096|gb|ACL74697.1| ribosomal protein L10 [Clostridium cellulolyticum H10]
          Length = 176

 Score = 74.7 bits (182), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 47/156 (30%), Positives = 88/156 (56%), Gaps = 2/156 (1%)

Query: 10  ISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRG 69
           +S+L++   S+ SIV+A Y+G++V Q  +LR  +R+AG   KV KN+L  +A++++ +  
Sbjct: 14  VSDLTEKIKSAQSIVLADYRGLTVEQDTELRTALRKAGVEYKVVKNKLTSLAMKESGLE- 72

Query: 70  ISDLFVGQSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASLPD 128
           + +   G + +  S +  +AP K+   FS   ++  +  GVVE  V++ D IK +A LP 
Sbjct: 73  LDEFLTGPTAMAISSADAVAPAKVLSEFSKKFDKLELKVGVVEGKVIDLDGIKALAELPS 132

Query: 129 LEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISA 164
            E + A ++    +  +  V +L      +V A++A
Sbjct: 133 REVLIAKVLGGFNAPISGFVNVLNGNMRGLVVALNA 168


>gi|268318930|ref|YP_003292586.1| ribosomal protein L10 [Lactobacillus johnsonii FI9785]
 gi|262397305|emb|CAX66319.1| ribosomal protein L10 [Lactobacillus johnsonii FI9785]
 gi|329666780|gb|AEB92728.1| 50S ribosomal protein L10 [Lactobacillus johnsonii DPC 6026]
          Length = 190

 Score = 74.3 bits (181), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 41/136 (30%), Positives = 80/136 (58%), Gaps = 3/136 (2%)

Query: 10  ISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRG 69
           + + +     + +I+V  Y G++V ++ +LRK +R+A   +KV KN  +K A     I G
Sbjct: 37  VDDFAAELKEAKAILVIDYLGLTVEEVTNLRKDLRDANVKMKVIKNTYLKRAAEKAGIEG 96

Query: 70  ISDLFVGQSLIVYS-DSPVIA--PKISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASL 126
           + D FVG + +VY+ D+  I    +I   + +D +   + GG++E  V +Q+ IK++A++
Sbjct: 97  LEDTFVGPTAVVYTADAEDITEPARIVSKYEDDIDALSIKGGMLEGKVASQEEIKKLAAI 156

Query: 127 PDLEGIRAGIISAIQS 142
           P  EG+ + ++S +Q+
Sbjct: 157 PGREGLLSMLVSVLQA 172


>gi|145629686|ref|ZP_01785483.1| 50S ribosomal protein L10 [Haemophilus influenzae 22.1-21]
 gi|145631669|ref|ZP_01787432.1| 50S ribosomal protein L10 [Haemophilus influenzae R3021]
 gi|145635665|ref|ZP_01791361.1| 50S ribosomal protein L10 [Haemophilus influenzae PittAA]
 gi|145638006|ref|ZP_01793641.1| 50S ribosomal protein L10 [Haemophilus influenzae PittHH]
 gi|145639388|ref|ZP_01794993.1| 50S ribosomal protein L10 [Haemophilus influenzae PittII]
 gi|145642230|ref|ZP_01797797.1| 50S ribosomal protein L10 [Haemophilus influenzae R3021]
 gi|148826727|ref|YP_001291480.1| 50S ribosomal protein L10 [Haemophilus influenzae PittEE]
 gi|229845630|ref|ZP_04465755.1| 50S ribosomal protein L10 [Haemophilus influenzae 6P18H1]
 gi|229847419|ref|ZP_04467519.1| 50S ribosomal protein L10 [Haemophilus influenzae 7P49H1]
 gi|260581384|ref|ZP_05849199.1| ribosomal protein L10 [Haemophilus influenzae RdAW]
 gi|260583186|ref|ZP_05850965.1| ribosomal protein L10 [Haemophilus influenzae NT127]
 gi|319775419|ref|YP_004137907.1| 50S ribosomal subunit protein L10 [Haemophilus influenzae F3047]
 gi|329122555|ref|ZP_08251137.1| 50S ribosomal protein L10 [Haemophilus aegyptius ATCC 11116]
 gi|166229730|sp|A5UE96|RL10_HAEIE RecName: Full=50S ribosomal protein L10
 gi|144978197|gb|EDJ87970.1| 50S ribosomal protein L10 [Haemophilus influenzae 22.1-21]
 gi|144982692|gb|EDJ90228.1| 50S ribosomal protein L10 [Haemophilus influenzae R3021]
 gi|145267060|gb|EDK07068.1| 50S ribosomal protein L10 [Haemophilus influenzae PittAA]
 gi|145268800|gb|EDK08768.1| 50S ribosomal protein L10 [Haemophilus influenzae PittHH]
 gi|145271435|gb|EDK11347.1| 50S ribosomal protein L10 [Haemophilus influenzae PittII]
 gi|145273090|gb|EDK12969.1| 50S ribosomal protein L10 [Haemophilus influenzae 22.4-21]
 gi|148716887|gb|ABQ99097.1| 50S ribosomal protein L10 [Haemophilus influenzae PittEE]
 gi|229809657|gb|EEP45383.1| 50S ribosomal protein L10 [Haemophilus influenzae 7P49H1]
 gi|229811430|gb|EEP47134.1| 50S ribosomal protein L10 [Haemophilus influenzae 6P18H1]
 gi|260091979|gb|EEW75927.1| ribosomal protein L10 [Haemophilus influenzae RdAW]
 gi|260093743|gb|EEW77652.1| ribosomal protein L10 [Haemophilus influenzae NT127]
 gi|301169356|emb|CBW28956.1| 50S ribosomal subunit protein L10 [Haemophilus influenzae 10810]
 gi|309751766|gb|ADO81750.1| 50S ribosomal protein L10 [Haemophilus influenzae R2866]
 gi|309973868|gb|ADO97069.1| 50S ribosomal protein L10 [Haemophilus influenzae R2846]
 gi|317450010|emb|CBY86223.1| 50S ribosomal subunit protein L10 [Haemophilus influenzae F3047]
 gi|327473138|gb|EGF18563.1| 50S ribosomal protein L10 [Haemophilus aegyptius ATCC 11116]
          Length = 163

 Score = 74.3 bits (181), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 50/177 (28%), Positives = 92/177 (51%), Gaps = 22/177 (12%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           +N Q K   ++E+++    + S V+A  +G++V ++ +LRK  REAG  ++V +N L++ 
Sbjct: 3   LNLQDKQAIVAEVNEAAKGALSAVIADSRGVTVEKMTELRKSAREAGVTMRVVRNTLLRR 62

Query: 61  AIRDTSIRGISDLFVGQSLIVYS-DSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
           A+  T    + D FVG +LI +S + P  A ++   F+  N++F + G   E  +  QD 
Sbjct: 63  AVEGTDYECLKDTFVGPTLIAFSNEHPGAAARLFKEFAKANDKFEIKGAAFEGKI--QD- 119

Query: 120 IKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQT----QVVRAISAFVDKNQQG 172
           ++ +A+LP  E                + RL+GT +     ++ R  +A  DK Q+ 
Sbjct: 120 VEFLATLPTYE--------------EAIARLMGTMKEAAAGKLARTFAALRDKLQEA 162


>gi|261254080|ref|ZP_05946653.1| LSU ribosomal protein L10p (P0) [Vibrio orientalis CIP 102891]
 gi|323498405|ref|ZP_08103402.1| 50S ribosomal protein L10 [Vibrio sinaloensis DSM 21326]
 gi|260937471|gb|EEX93460.1| LSU ribosomal protein L10p (P0) [Vibrio orientalis CIP 102891]
 gi|323316547|gb|EGA69561.1| 50S ribosomal protein L10 [Vibrio sinaloensis DSM 21326]
          Length = 164

 Score = 74.3 bits (181), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 48/159 (30%), Positives = 86/159 (54%), Gaps = 5/159 (3%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           +N Q K   ++E+++  S + S VVA  +G+ V  +  LRK+ REAG  V+V +N L++ 
Sbjct: 3   LNLQDKKAIVAEVNEAASGALSAVVADSRGVEVGAMTSLRKQAREAGVYVRVVRNTLMRR 62

Query: 61  AIRDTSIRGISDLFVGQSLIVYS-DSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
           A+  T    ++D F G +LI +S + P  A ++   F+ +N +F +     E G L    
Sbjct: 63  AVEGTDYECLTDTFTGPTLIAFSNEHPGAAARLFKDFAKENKDFEIKAAAFE-GALTDAE 121

Query: 120 IKQIASLPDL-EGIRAGIISAIQSNATRLVRLLGTPQTQ 157
           +  +A+LP   E I   ++   +++A +LVR +   + Q
Sbjct: 122 V--LATLPTYDEAIARLMMCMKEASAGKLVRTIAALRDQ 158


>gi|323703912|ref|ZP_08115544.1| ribosomal protein L10 [Desulfotomaculum nigrificans DSM 574]
 gi|323531128|gb|EGB21035.1| ribosomal protein L10 [Desulfotomaculum nigrificans DSM 574]
          Length = 179

 Score = 74.3 bits (181), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 41/139 (29%), Positives = 77/139 (55%), Gaps = 2/139 (1%)

Query: 6   KSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDT 65
           K+  + EL    ++S   ++A ++GI VA+I DLR ++R+AG  +KVAKN +  IA ++ 
Sbjct: 8   KAAVLEELKNKMANSQVTILADFRGIPVAKITDLRARLRKAGSEMKVAKNTIAGIAAKEV 67

Query: 66  SIRGISDLFVGQSLIVYS-DSPVIAPKISVSFSNDNNE-FRVLGGVVEKGVLNQDSIKQI 123
            + G+     G ++  +  D PV   KI   F+ +  +   +  G++E  V++   +K +
Sbjct: 68  GVEGLDQYLQGPTVFTFGIDDPVAPAKILSDFAKEIKQGLEIKAGILEGKVIDASGVKAL 127

Query: 124 ASLPDLEGIRAGIISAIQS 142
           A LP  E + A ++  +Q+
Sbjct: 128 ADLPSREVLLAKVLGGMQA 146


>gi|289167629|ref|YP_003445898.1| 50S ribosomal protein L10 [Streptococcus mitis B6]
 gi|288907196|emb|CBJ22031.1| 50S ribosomal protein L10 [Streptococcus mitis B6]
          Length = 166

 Score = 74.3 bits (181), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 46/157 (29%), Positives = 82/157 (52%), Gaps = 12/157 (7%)

Query: 17  FSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRGISDLFVG 76
             ++ SIVV   +G++V Q   LR+++R +    KV KN +++ A     + G++ +FVG
Sbjct: 20  MKAAASIVVVDARGLTVEQDTVLRRELRGSEVEYKVIKNSILRRAAEKAGLEGLASVFVG 79

Query: 77  QSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASLPDLEGIRAG 135
            S + +S+  VIAP KI   F+ D     + GG +E  V +++ I  +A+LP+ EG+ + 
Sbjct: 80  PSAVAFSNEDVIAPAKILNDFAKDAEALEIKGGAIEGAVASKEEILALATLPNREGLLSM 139

Query: 136 IISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQQG 172
           ++S +Q+           P   V  A+ A  D  +  
Sbjct: 140 LLSVLQA-----------PVRNVALAVKAVADNKEDA 165


>gi|282896124|ref|ZP_06304150.1| Ribosomal protein L10 [Raphidiopsis brookii D9]
 gi|281199042|gb|EFA73917.1| Ribosomal protein L10 [Raphidiopsis brookii D9]
          Length = 181

 Score = 74.3 bits (181), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 52/166 (31%), Positives = 88/166 (53%), Gaps = 4/166 (2%)

Query: 10  ISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIR-DTSIR 68
           +++L    S S   +V  Y+G++VA+I DLR+++R +G   KV KN  + +AI+ D   +
Sbjct: 12  VADLKGTLSQSTLALVIDYQGLTVAEITDLRRRLRPSGTICKVTKNTFMGLAIQEDKKWQ 71

Query: 69  GISDLFVGQS--LIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASL 126
            +S+L  G S  L+V  D    A K    F     +  + GGV+E  +L  + +K +  L
Sbjct: 72  PMSELLKGSSAFLLVKEDFSS-AIKAYQEFQKATKKTELRGGVMEGRLLKDEDVKALGDL 130

Query: 127 PDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQQG 172
           P  E + A I  AI + AT++   +    + + R I A  DK+++G
Sbjct: 131 PSKEQLMAQIAGAINALATKVAVGIKEVPSSLARGIQAIADKDKEG 176


>gi|305680187|ref|ZP_07402997.1| ribosomal protein L10 [Corynebacterium matruchotii ATCC 14266]
 gi|305660807|gb|EFM50304.1| ribosomal protein L10 [Corynebacterium matruchotii ATCC 14266]
          Length = 173

 Score = 74.3 bits (181), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 48/164 (29%), Positives = 88/164 (53%), Gaps = 6/164 (3%)

Query: 10  ISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVK--VAKNRLVKIAIRDTSI 67
           ++EL + F+ + S+V+  Y+G++VAQ  +LRK +   G  V+  +AKN L+K+A +   +
Sbjct: 10  LAELKQRFTDTDSLVLTEYRGLTVAQTTELRKAL---GADVQYSIAKNTLLKLAAKHAGV 66

Query: 68  RGISDLFVGQSLIVY-SDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASL 126
            G+ +LFVG + + +     V A K    F+ +N    V GG ++   L  + +  IA L
Sbjct: 67  EGLDELFVGPTAVAFIQGEAVDAAKALKKFAAENKALVVKGGYMDGNPLTAEQVDAIAEL 126

Query: 127 PDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQ 170
            + E   A +  A++ + ++   L   P +QV R  +A  +K +
Sbjct: 127 DNRETTLAKLAGAMKGSLSKAAALFNAPASQVARLSAALQEKKE 170


>gi|331699186|ref|YP_004335425.1| 50S ribosomal protein L10 [Pseudonocardia dioxanivorans CB1190]
 gi|326953875|gb|AEA27572.1| 50S ribosomal protein L10 [Pseudonocardia dioxanivorans CB1190]
          Length = 191

 Score = 74.3 bits (181), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 49/169 (28%), Positives = 79/169 (46%), Gaps = 2/169 (1%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M R  K   + E++  F  + + VV  Y+G++ AQ+ +LR+ +       +VAKN LVK 
Sbjct: 1   MARPDKVEAVDEIANRFRGATASVVTEYRGLTTAQLTELRRSLGP-DATYRVAKNTLVKR 59

Query: 61  AIRDTSIRGISDLFVGQSLIVY-SDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
           A  D  + G+  L  G + I +    PV A K    F+  +    + GG ++   L    
Sbjct: 60  AAADAGVEGLDALLTGPTAIAFVQGEPVDAAKALRDFAKAHQGLVIKGGFMDGRPLTVTE 119

Query: 120 IKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDK 168
           + Q+A L   E + A +  A++ N  +   L   P +QV R   A  DK
Sbjct: 120 VNQLADLESREVLLAKLAGAMKGNLAKAAGLFAAPASQVARLAQALADK 168


>gi|294786493|ref|ZP_06751747.1| ribosomal protein L10 [Parascardovia denticolens F0305]
 gi|315226066|ref|ZP_07867854.1| 50S ribosomal protein L10 [Parascardovia denticolens DSM 10105]
 gi|294485326|gb|EFG32960.1| ribosomal protein L10 [Parascardovia denticolens F0305]
 gi|315120198|gb|EFT83330.1| 50S ribosomal protein L10 [Parascardovia denticolens DSM 10105]
          Length = 173

 Score = 74.3 bits (181), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 47/173 (27%), Positives = 84/173 (48%), Gaps = 2/173 (1%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M R  K   I++L+  F  + +I +  Y+G+SV QI DLR+K+        VAKN L +I
Sbjct: 1   MKRPEKGEMITKLTDKFRDADAIYLTEYRGLSVPQISDLREKL-GTDTTYNVAKNTLARI 59

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVI-APKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
           A ++  I G+ D+  G S I +     + A K+   F+ DN +  V GG  +  V + + 
Sbjct: 60  AAKEAGIEGLDDMLKGPSAITFVKGDYVEAAKVLRDFAKDNKQLIVKGGFADGTVYDAEG 119

Query: 120 IKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQQG 172
           +  +A L     + + +  A++    +         T+ VR + A  +K+++ 
Sbjct: 120 VNTLADLESRPVLLSKMAGALKGTMAKAAYAFVALPTKAVRTVDALREKHEKA 172


>gi|160914582|ref|ZP_02076797.1| hypothetical protein EUBDOL_00590 [Eubacterium dolichum DSM 3991]
 gi|158433740|gb|EDP12029.1| hypothetical protein EUBDOL_00590 [Eubacterium dolichum DSM 3991]
          Length = 173

 Score = 74.3 bits (181), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 41/133 (30%), Positives = 75/133 (56%)

Query: 10  ISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRG 69
           +SE++     + S V+  Y+G+SVA++ +LR+ +R  G   KV KN L + A  +     
Sbjct: 13  VSEIAGKMKEAQSTVLVEYRGLSVAEVTELRRNLRAEGVEFKVYKNSLAQRAAEEIGADE 72

Query: 70  ISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASLPDL 129
           +    VG + I +    V   +I   F+ D+++  +  G+VE  V+  D+IK++A LP+ 
Sbjct: 73  LVKDLVGPNAIAFGGDAVAPARILSKFAKDHDKLVLKSGIVEGKVVGLDTIKELAGLPNR 132

Query: 130 EGIRAGIISAIQS 142
           EG+ + ++S +QS
Sbjct: 133 EGMLSMLLSCLQS 145


>gi|291276550|ref|YP_003516322.1| 50S ribosomal protein L10 [Helicobacter mustelae 12198]
 gi|290963744|emb|CBG39579.1| 50S ribosomal protein L10 [Helicobacter mustelae 12198]
          Length = 160

 Score = 74.3 bits (181), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 47/159 (29%), Positives = 84/159 (52%), Gaps = 5/159 (3%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M +Q K + +  LS  F +S S++V  YKG+SVA+++ LRK  R+A   V+V KN L KI
Sbjct: 1   MTKQDKKLLVESLSADFRASNSLIVCDYKGLSVAKLEALRKAARDADAKVQVIKNTLAKI 60

Query: 61  AIRDTSIRGISDLFVGQS-LIVYSDSPVIAPKISVSFSNDNNE-FRVLGGVVEKGVLNQD 118
           A++D    G  D  +  + + ++S+  +   K  + F++++ + FR   G  +  V++ +
Sbjct: 61  ALKDA---GYPDFELKDTNIFIWSNEQISLSKFVIKFADEHKDFFRAKVGCFDGEVVDVN 117

Query: 119 SIKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQ 157
            I  I+ LP  + +   ++S     A   V  L   + Q
Sbjct: 118 HITSISKLPSRDELIGMLLSVWMGPARYFVTALDNLKKQ 156


>gi|167957239|ref|ZP_02544313.1| 50S ribosomal protein L10 [candidate division TM7 single-cell
           isolate TM7c]
          Length = 174

 Score = 74.3 bits (181), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 46/146 (31%), Positives = 81/146 (55%), Gaps = 4/146 (2%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           ++R  K   ++E+S+  +++     A YKG++VA +++LRKK RE    +KV KNRLV++
Sbjct: 3   ISRDKKQTLVAEVSESLANAKMTAFAKYKGLTVADLQELRKKARETNVSIKVVKNRLVRV 62

Query: 61  AIRDTSIRGISD--LFVGQSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKG-VLN 116
           A+ ++      D  +  GQ +  +S    +AP ++   F+  N    ++GG   KG  L+
Sbjct: 63  AVENSETYKNVDTSMLEGQLVYAFSSEDEVAPAQVLDVFAKTNPALELVGGFSGKGETLD 122

Query: 117 QDSIKQIASLPDLEGIRAGIISAIQS 142
            D IK +A LP  E + A + + + S
Sbjct: 123 TDQIKALAGLPSKEQLIAQVTAQLLS 148


>gi|157368524|ref|YP_001476513.1| 50S ribosomal protein L10 [Serratia proteamaculans 568]
 gi|270265422|ref|ZP_06193681.1| 50S ribosomal protein L10 [Serratia odorifera 4Rx13]
 gi|166981916|sp|A8G8E5|RL10_SERP5 RecName: Full=50S ribosomal protein L10
 gi|157320288|gb|ABV39385.1| ribosomal protein L10 [Serratia proteamaculans 568]
 gi|270040615|gb|EFA13720.1| 50S ribosomal protein L10 [Serratia odorifera 4Rx13]
          Length = 165

 Score = 74.3 bits (181), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 45/159 (28%), Positives = 88/159 (55%), Gaps = 2/159 (1%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           +N Q K   ++E++++   + S VVA  +G++V ++ +LRK  REAG  ++V +N L++ 
Sbjct: 3   LNLQDKQAIVAEVNEVAKGALSAVVADSRGVTVDKMTELRKAGREAGVYMRVVRNTLMRR 62

Query: 61  AIRDTSIRGISDLFVGQSLIVYS-DSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
            +  T    + D FVG +LI +S + P  A ++   F+  N +F +     E  ++    
Sbjct: 63  VVEGTPFECLKDTFVGPTLIAFSHEHPGAAARLFKDFAKANAKFEIKAAAFEGEMIPAAQ 122

Query: 120 IKQIASLPDLEGIRAGIISAI-QSNATRLVRLLGTPQTQ 157
           I ++A+LP  +   A +++ + ++ A +LVR L   + Q
Sbjct: 123 IDRLATLPTYDEAIARLMATMKEAAAGKLVRTLAALRDQ 161


>gi|296274143|ref|YP_003656774.1| 50S ribosomal protein L10 [Arcobacter nitrofigilis DSM 7299]
 gi|296098317|gb|ADG94267.1| ribosomal protein L10 [Arcobacter nitrofigilis DSM 7299]
          Length = 162

 Score = 74.3 bits (181), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 43/140 (30%), Positives = 82/140 (58%), Gaps = 4/140 (2%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M +Q KS  +  L+  F  S +IVV  YKG++  Q++ LRK  R+ G  V+VAKN LV +
Sbjct: 1   MTKQQKSEIVDFLTSEFKESQAIVVCDYKGLTHKQLEVLRKDARDNGTKVQVAKNTLVAV 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDN-NEFRVLGGVVEKGVLNQDS 119
           ++++  +  I     G ++ ++S+  + A K++  F++DN ++F +  G++E  + +  +
Sbjct: 61  SVKNAELGDIE--LTGTNIFLWSEDQISACKVADKFASDNKDKFAIKSGIIEGKIADLAT 118

Query: 120 IKQIASLPDLEGIRAGIISA 139
           +   A LP  E +  G+++A
Sbjct: 119 VNAFAKLPSREQL-LGMLAA 137


>gi|146308932|ref|YP_001189397.1| 50S ribosomal protein L10 [Pseudomonas mendocina ymp]
 gi|330505216|ref|YP_004382085.1| 50S ribosomal protein L10 [Pseudomonas mendocina NK-01]
 gi|166230053|sp|A4XZ99|RL10_PSEMY RecName: Full=50S ribosomal protein L10
 gi|145577133|gb|ABP86665.1| LSU ribosomal protein L10P [Pseudomonas mendocina ymp]
 gi|328919502|gb|AEB60333.1| 50S ribosomal protein L10 [Pseudomonas mendocina NK-01]
          Length = 166

 Score = 74.3 bits (181), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 50/150 (33%), Positives = 83/150 (55%), Gaps = 3/150 (2%)

Query: 10  ISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRG 69
           ++E+++   +  S VVA  +G++V  +  LRK+ REAG  VKV +N L+K A+  T    
Sbjct: 12  VAEVNEAAKAGLSAVVADARGVTVGAMTGLRKEAREAGVYVKVVRNTLLKRAVEGTQFDV 71

Query: 70  ISDLFVGQSLIVYS-DSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASLPD 128
           ++D+F G +LI +S + P  A ++   F+   ++F +     E   L  + I  +ASLP 
Sbjct: 72  LNDVFKGPTLIAFSNEHPGAAARLFKEFAKGQDKFEIKAAAFEGKYLAANQIDVLASLPT 131

Query: 129 L-EGIRAGIISAIQSNATRLVRLLGTPQTQ 157
             EGI A ++S IQ   ++L R L   + Q
Sbjct: 132 RDEGI-AQLMSVIQGATSKLARTLAAIRDQ 160


>gi|77461309|ref|YP_350816.1| 50S ribosomal protein L10 [Pseudomonas fluorescens Pf0-1]
 gi|97181866|sp|Q3K5X9|RL10_PSEPF RecName: Full=50S ribosomal protein L10
 gi|77385312|gb|ABA76825.1| 50S ribosomal protein L10 [Pseudomonas fluorescens Pf0-1]
          Length = 166

 Score = 74.3 bits (181), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 48/158 (30%), Positives = 84/158 (53%), Gaps = 1/158 (0%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           +N + K   ++E+++    + S VV   +G++V  +  LRK+ REAG  V+V +N L+K 
Sbjct: 3   INLEDKKAIVAEVNEAAKVALSAVVVDARGVTVGAMTGLRKEAREAGVYVRVVRNTLLKR 62

Query: 61  AIRDTSIRGISDLFVGQSLIVYS-DSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
           A+  TS   ++D F G +LI +S + P  A ++   F+   ++F +     E   L  + 
Sbjct: 63  AVAGTSYEVLNDAFTGPTLIAFSNEHPGAAARLFKEFAKGQDKFEIKAASFEGKFLAANE 122

Query: 120 IKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQ 157
           I  +ASLP  +   A ++S IQ   ++L R L   + Q
Sbjct: 123 IDVLASLPTRDEAIAKLMSVIQGATSKLARTLAAIRDQ 160


>gi|170729018|ref|YP_001763044.1| 50S ribosomal protein L10 [Shewanella woodyi ATCC 51908]
 gi|226700004|sp|B1KMZ2|RL10_SHEWM RecName: Full=50S ribosomal protein L10
 gi|169814365|gb|ACA88949.1| ribosomal protein L10 [Shewanella woodyi ATCC 51908]
          Length = 166

 Score = 74.3 bits (181), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 46/150 (30%), Positives = 81/150 (54%), Gaps = 2/150 (1%)

Query: 10  ISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRG 69
           ++E+++    + S VVA  +G++V ++  LR+  REAG  VKV +N LVK A+  T    
Sbjct: 12  VAEVNEAAKGALSAVVADSRGVTVGEMTGLRRAAREAGVYVKVVRNTLVKRAVAGTDFEC 71

Query: 70  ISDLFVGQSLIVYS-DSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASLPD 128
           +SD F G +LI +S + P  A ++   F+    +F +     E  V+    I ++A LP 
Sbjct: 72  LSDTFTGPTLIAFSNEHPGAAARLLKDFATAQEKFEIKAAAFEGEVIPAADIDRLAKLPT 131

Query: 129 L-EGIRAGIISAIQSNATRLVRLLGTPQTQ 157
             E +   +++  +++A + VRLL   + Q
Sbjct: 132 YDEALAQLMMTMKEASAGKFVRLLAALRDQ 161


>gi|225020319|ref|ZP_03709511.1| hypothetical protein CORMATOL_00326 [Corynebacterium matruchotii
           ATCC 33806]
 gi|224946708|gb|EEG27917.1| hypothetical protein CORMATOL_00326 [Corynebacterium matruchotii
           ATCC 33806]
          Length = 173

 Score = 74.3 bits (181), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 48/164 (29%), Positives = 88/164 (53%), Gaps = 6/164 (3%)

Query: 10  ISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVK--VAKNRLVKIAIRDTSI 67
           ++EL + F+ + S+V+  Y+G++VAQ  +LRK +   G  V+  +AKN L+K+A +   +
Sbjct: 10  LAELKQRFADTDSLVLTEYRGLTVAQTTELRKAL---GADVQYSIAKNTLLKLAAKHAGV 66

Query: 68  RGISDLFVGQSLIVY-SDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASL 126
            G+ +LFVG + + +     V A K    F+ +N    V GG ++   L  + +  IA L
Sbjct: 67  EGLDELFVGPTAVAFIQGEAVDAAKALKKFAAENKALVVKGGYMDGNPLTAEQVDAIAEL 126

Query: 127 PDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQ 170
            + E   A +  A++ + ++   L   P +QV R  +A  +K +
Sbjct: 127 DNRETTLAKLAGAMKGSLSKAAALFNAPASQVARLSAALQEKKE 170


>gi|332037822|gb|EGI74272.1| 50S ribosomal protein L10 [Pseudoalteromonas haloplanktis ANT/505]
          Length = 164

 Score = 74.3 bits (181), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 50/159 (31%), Positives = 87/159 (54%), Gaps = 5/159 (3%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           +N QGK   ++E+++  + + S VVA  +G++V  I  LRK+ R  G  +KV +N L K 
Sbjct: 3   LNLQGKKAIVAEVNEAANGALSAVVADSRGVTVGAITALRKEARANGVWMKVVRNTLAKR 62

Query: 61  AIRDTSIRGISDLFVGQSLIVY-SDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
           A+  T    +SD FVG SLI + S+ P  A +I   F+  N +F +     E  V++   
Sbjct: 63  ALEGTDFECLSDSFVGPSLIAFSSEHPGAAARIFSDFAKKNEKFELKTAAFEGNVVDA-- 120

Query: 120 IKQIASLPDLEGIRAGIISAI-QSNATRLVRLLGTPQTQ 157
              +A+LP  +   A ++SA+ +++A +L + +   + Q
Sbjct: 121 -AMLATLPTYDEAVARLMSAMKEASAGKLCKTIEAVRVQ 158


>gi|328884390|emb|CCA57629.1| LSU ribosomal protein L10p [Streptomyces venezuelae ATCC 10712]
          Length = 176

 Score = 74.3 bits (181), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 48/166 (28%), Positives = 79/166 (47%), Gaps = 2/166 (1%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M R  K+  ++EL   F SS ++V+  Y G++VAQ+K LR+ + E      V KN L KI
Sbjct: 1   MARPDKAAAVAELEDKFRSSNAVVLTSYTGLTVAQLKTLRRSLGE-NAQYAVVKNTLTKI 59

Query: 61  AIRDTSIRGISDLFVGQSLIVY-SDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
           A     I  + D   G +   + +  PV + K    F+ DN    + GGV++   L+ D 
Sbjct: 60  AANQAGISALDDQLAGSTAAAFVTGDPVESAKALRDFAKDNPNLVIKGGVLDGKALSADE 119

Query: 120 IKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAF 165
            K++A L   E + + +  A +   ++   L     ++ VR   A 
Sbjct: 120 FKKLADLESREVLLSKLAGAFKGKQSQAASLFQALPSKFVRTAEAL 165


>gi|28899698|ref|NP_799303.1| 50S ribosomal protein L10 [Vibrio parahaemolyticus RIMD 2210633]
 gi|260364012|ref|ZP_05776746.1| 50S ribosomal protein L10 [Vibrio parahaemolyticus K5030]
 gi|260878166|ref|ZP_05890521.1| 50S ribosomal protein L10 [Vibrio parahaemolyticus AN-5034]
 gi|260897871|ref|ZP_05906367.1| 50S ribosomal protein L10 [Vibrio parahaemolyticus Peru-466]
 gi|31340336|sp|Q87KQ2|RL10_VIBPA RecName: Full=50S ribosomal protein L10
 gi|28807950|dbj|BAC61187.1| ribosomal protein L10 [Vibrio parahaemolyticus RIMD 2210633]
 gi|308085547|gb|EFO35242.1| 50S ribosomal protein L10 [Vibrio parahaemolyticus Peru-466]
 gi|308090238|gb|EFO39933.1| 50S ribosomal protein L10 [Vibrio parahaemolyticus AN-5034]
 gi|308115545|gb|EFO53085.1| 50S ribosomal protein L10 [Vibrio parahaemolyticus K5030]
 gi|328471081|gb|EGF41987.1| 50S ribosomal protein L10 [Vibrio parahaemolyticus 10329]
          Length = 162

 Score = 74.3 bits (181), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 48/159 (30%), Positives = 86/159 (54%), Gaps = 5/159 (3%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           +N Q K   ++E+++  S + S VVA  +G+ V  +  LRK+ REAG  +KV +N L + 
Sbjct: 3   LNLQDKKAIVAEVNEAASGALSAVVADSRGVEVGAMTSLRKQAREAGVYMKVVRNTLARR 62

Query: 61  AIRDTSIRGISDLFVGQSLIVYS-DSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
           A++ T    ++D F G +LI +S + P  A ++   F+ +N +F +     E G L    
Sbjct: 63  AVQGTDYECLTDTFTGPTLIAFSNEHPGAAARLFKDFAKENKDFEIKAAAFE-GALTDAE 121

Query: 120 IKQIASLPDL-EGIRAGIISAIQSNATRLVRLLGTPQTQ 157
           +  +A+LP   E I   ++   +++A +LVR +   + Q
Sbjct: 122 V--LATLPTYDEAIARLMMCMKEASAGKLVRTIAAIRDQ 158


>gi|23466102|ref|NP_696705.1| 50S ribosomal protein L10 [Bifidobacterium longum NCC2705]
 gi|46190324|ref|ZP_00121642.2| COG0244: Ribosomal protein L10 [Bifidobacterium longum DJO10A]
 gi|189440529|ref|YP_001955610.1| 50S ribosomal protein L10 [Bifidobacterium longum DJO10A]
 gi|213693117|ref|YP_002323703.1| ribosomal protein L10 [Bifidobacterium longum subsp. infantis ATCC
           15697]
 gi|227546438|ref|ZP_03976487.1| 50S ribosomal protein L10 [Bifidobacterium longum subsp. infantis
           ATCC 55813]
 gi|239620978|ref|ZP_04664009.1| 50S ribosomal protein L10 [Bifidobacterium longum subsp. infantis
           CCUG 52486]
 gi|296454904|ref|YP_003662048.1| 50S ribosomal protein L10 [Bifidobacterium longum subsp. longum
           JDM301]
 gi|312133838|ref|YP_004001177.1| rplj [Bifidobacterium longum subsp. longum BBMN68]
 gi|317483030|ref|ZP_07942032.1| ribosomal protein L10 [Bifidobacterium sp. 12_1_47BFAA]
 gi|322689961|ref|YP_004209695.1| 50S ribosomal protein L10 [Bifidobacterium longum subsp. infantis
           157F]
 gi|322691901|ref|YP_004221471.1| 50S ribosomal protein L10 [Bifidobacterium longum subsp. longum JCM
           1217]
 gi|29336743|sp|Q8G444|RL10_BIFLO RecName: Full=50S ribosomal protein L10
 gi|226699911|sp|B3DPX3|RL10_BIFLD RecName: Full=50S ribosomal protein L10
 gi|254798361|sp|B7GNG9|RL10_BIFLI RecName: Full=50S ribosomal protein L10
 gi|23326835|gb|AAN25341.1| 50S ribosomal protein L10 [Bifidobacterium longum NCC2705]
 gi|189428964|gb|ACD99112.1| Ribosomal protein L10 [Bifidobacterium longum DJO10A]
 gi|213524578|gb|ACJ53325.1| ribosomal protein L10 [Bifidobacterium longum subsp. infantis ATCC
           15697]
 gi|227213095|gb|EEI80974.1| 50S ribosomal protein L10 [Bifidobacterium longum subsp. infantis
           ATCC 55813]
 gi|239516079|gb|EEQ55946.1| 50S ribosomal protein L10 [Bifidobacterium longum subsp. infantis
           CCUG 52486]
 gi|291516494|emb|CBK70110.1| LSU ribosomal protein L10P [Bifidobacterium longum subsp. longum
           F8]
 gi|296184336|gb|ADH01218.1| ribosomal protein L10 [Bifidobacterium longum subsp. longum JDM301]
 gi|311773129|gb|ADQ02617.1| RplJ [Bifidobacterium longum subsp. longum BBMN68]
 gi|316915531|gb|EFV36951.1| ribosomal protein L10 [Bifidobacterium sp. 12_1_47BFAA]
 gi|320456757|dbj|BAJ67379.1| 50S ribosomal protein L10 [Bifidobacterium longum subsp. longum JCM
           1217]
 gi|320459295|dbj|BAJ69916.1| 50S ribosomal protein L10 [Bifidobacterium longum subsp. infantis
           ATCC 15697]
 gi|320461297|dbj|BAJ71917.1| 50S ribosomal protein L10 [Bifidobacterium longum subsp. infantis
           157F]
          Length = 173

 Score = 74.3 bits (181), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 52/177 (29%), Positives = 89/177 (50%), Gaps = 10/177 (5%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKM-REAGGGVKVAKNRLVK 59
           M R  K   +++L++ F ++ ++ +  Y+G++V QI DLR+K+ R+      VAKN L +
Sbjct: 1   MKRPEKEAVVAQLTEEFRNADAVYLTEYRGLTVPQISDLREKLGRDT--SYTVAKNTLAR 58

Query: 60  IAIRDTSIRGISDLFVGQSLIVYSDSPVI-APKISVSFSNDNNEFRVLGGVVEKGVLNQD 118
           IA ++  I G+ ++  G + I +     I A K+   F+ DN    + G   +  V + +
Sbjct: 59  IAAKEAGIEGLDEILSGPTAITFVKGDFIEAAKVIRDFAKDNKALVIKGAAADGTVYDAE 118

Query: 119 SIKQIASL---PDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQQG 172
             K++A L   P L    AG I A  + A  L   L    T+ VR I A  +K ++ 
Sbjct: 119 GAKKLADLKSRPQLLAEFAGDIKASMAKAAYLFNAL---PTKAVRTIDALREKQEKA 172


>gi|298490346|ref|YP_003720523.1| 50S ribosomal protein L10 ['Nostoc azollae' 0708]
 gi|298232264|gb|ADI63400.1| ribosomal protein L10 ['Nostoc azollae' 0708]
          Length = 183

 Score = 74.3 bits (181), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 52/163 (31%), Positives = 88/163 (53%), Gaps = 4/163 (2%)

Query: 10  ISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIR-DTSIR 68
           +++L    S S   +V  Y+G++VA+I+DLR+++R +G   KVAKN  + IAI+ D   +
Sbjct: 12  VADLKGTLSESTLALVIDYQGLTVAEIRDLRRRLRPSGTVCKVAKNTFMGIAIQEDEKWQ 71

Query: 69  GISDLFVGQS--LIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASL 126
            +S+L  G S  L+V  D    A K    F   + +  + GGV++  +L +  +K +  L
Sbjct: 72  PLSELLKGSSAFLLVKEDFSS-AIKAYQEFQKTSKKTELRGGVMDGRLLKEADVKALGDL 130

Query: 127 PDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKN 169
           P  E + A I  +I + AT+L   +    + + RA+ A  DK 
Sbjct: 131 PSKEQLMAQIAGSINALATKLAVGINEVPSSLARAVQAVADKE 173


>gi|237809524|ref|YP_002893964.1| 50S ribosomal protein L10 [Tolumonas auensis DSM 9187]
 gi|259645502|sp|C4LBV4|RL10_TOLAT RecName: Full=50S ribosomal protein L10
 gi|237501785|gb|ACQ94378.1| ribosomal protein L10 [Tolumonas auensis DSM 9187]
          Length = 167

 Score = 74.3 bits (181), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 43/145 (29%), Positives = 84/145 (57%), Gaps = 2/145 (1%)

Query: 10  ISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRG 69
           ++E+S+    + S V A  +G++VA++  LR+  REAG  ++V +N L+  A+  +    
Sbjct: 12  VAEVSEAAKGALSAVAADSRGVTVAKMTALRQSAREAGVYMRVVRNTLLTRAVEGSDFEC 71

Query: 70  ISDLFVGQSLIVYS-DSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASLPD 128
           + D+FVG +LI +S + P  A ++   F+  N++F + GG  +   +    I ++A+LP 
Sbjct: 72  MKDVFVGPTLIAFSNEHPGAAARLFKEFAKGNDKFSIKGGAFQGEFIPAAQIDRLATLPT 131

Query: 129 LEGIRAGIISAI-QSNATRLVRLLG 152
            E   A +++ + +++A +LVR L 
Sbjct: 132 YEEAIAKLMATMKEASAGKLVRTLA 156


>gi|323465893|gb|ADX69580.1| 50S ribosomal protein L10 [Lactobacillus helveticus H10]
          Length = 170

 Score = 74.3 bits (181), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 37/129 (28%), Positives = 80/129 (62%), Gaps = 3/129 (2%)

Query: 17  FSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRGISDLFVG 76
             ++ +I+V +Y G++V ++ ++RK++R+    +KV KN  ++ A     I G+ D FVG
Sbjct: 20  LKAAKAILVINYLGLTVEEVTNMRKELRDNDVKMKVIKNTYLRRAAAKAGIEGLDDTFVG 79

Query: 77  QSLIVYSDSP--VIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASLPDLEGIR 133
            + ++Y+D+   +  P +I   + +D +   + GG++E  + ++D IK++AS+P  EG+ 
Sbjct: 80  PTAVIYTDNADDITEPARIVSKYEDDFDVIEIKGGMLEGKLTSKDEIKELASIPGREGLL 139

Query: 134 AGIISAIQS 142
           + ++S +Q+
Sbjct: 140 SMLVSVLQA 148


>gi|319938976|ref|ZP_08013340.1| 50S ribosomal protein L10 [Streptococcus anginosus 1_2_62CV]
 gi|319812026|gb|EFW08292.1| 50S ribosomal protein L10 [Streptococcus anginosus 1_2_62CV]
          Length = 166

 Score = 74.3 bits (181), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 45/157 (28%), Positives = 83/157 (52%), Gaps = 12/157 (7%)

Query: 17  FSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRGISDLFVG 76
             ++ SIVV   +G++V Q   LR+ +R +    KV KN +++ A     + G++D FVG
Sbjct: 20  MKAAASIVVVDARGLTVEQDTVLRRNLRGSEVEYKVIKNSILRRASEKAGLEGLADAFVG 79

Query: 77  QSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASLPDLEGIRAG 135
            S + +S+  V+AP KI   F+ + +   + GG +E  V +++ I  +A+LP+ EG+ + 
Sbjct: 80  PSAVAFSNEDVVAPAKIINDFTKEADALEIKGGAIEGAVASKEEIVALATLPNREGLLSM 139

Query: 136 IISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQQG 172
           ++S +Q+           P   V  A+ A  D  ++ 
Sbjct: 140 LLSVLQA-----------PVRNVALAVKAVADNKEEA 165


>gi|256852101|ref|ZP_05557488.1| 50S ribosomal protein L10 [Lactobacillus jensenii 27-2-CHN]
 gi|260661329|ref|ZP_05862242.1| 50S ribosomal protein L10 [Lactobacillus jensenii 115-3-CHN]
 gi|256615513|gb|EEU20703.1| 50S ribosomal protein L10 [Lactobacillus jensenii 27-2-CHN]
 gi|260547784|gb|EEX23761.1| 50S ribosomal protein L10 [Lactobacillus jensenii 115-3-CHN]
          Length = 170

 Score = 74.3 bits (181), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 37/129 (28%), Positives = 80/129 (62%), Gaps = 3/129 (2%)

Query: 17  FSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRGISDLFVG 76
             ++ +I+V  Y G++V ++ ++RK++RE    +KV KN  ++ A +   I G+ D FVG
Sbjct: 23  LKAAKAILVIDYLGLTVDEVTNMRKELRENDVKMKVIKNTYLRRAAKKAGIEGLEDTFVG 82

Query: 77  QSLIVYSDSP--VIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASLPDLEGIR 133
            + ++Y+D+   +  P +I   + +D +   + GG++E  + +++ IK++AS+P  EG+ 
Sbjct: 83  PTAVIYTDNADDITEPARIVSKYEDDFDVINIKGGMLEGKLTSKEEIKELASIPGREGLL 142

Query: 134 AGIISAIQS 142
           + ++S +Q+
Sbjct: 143 SMLVSVLQA 151


>gi|297205024|ref|ZP_06922420.1| 50S ribosomal protein L10 [Lactobacillus jensenii JV-V16]
 gi|297149602|gb|EFH29899.1| 50S ribosomal protein L10 [Lactobacillus jensenii JV-V16]
          Length = 172

 Score = 74.3 bits (181), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 37/129 (28%), Positives = 80/129 (62%), Gaps = 3/129 (2%)

Query: 17  FSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRGISDLFVG 76
             ++ +I+V  Y G++V ++ ++RK++RE    +KV KN  ++ A +   I G+ D FVG
Sbjct: 25  LKAAKAILVIDYLGLTVDEVTNMRKELRENDVKMKVIKNTYLRRAAKKAGIEGLEDTFVG 84

Query: 77  QSLIVYSDSP--VIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASLPDLEGIR 133
            + ++Y+D+   +  P +I   + +D +   + GG++E  + +++ IK++AS+P  EG+ 
Sbjct: 85  PTAVIYTDNADDITEPARIVSKYEDDFDVINIKGGMLEGKLTSKEEIKELASIPGREGLL 144

Query: 134 AGIISAIQS 142
           + ++S +Q+
Sbjct: 145 SMLVSVLQA 153


>gi|320155008|ref|YP_004187387.1| 50S ribosomal protein L10p (P0) [Vibrio vulnificus MO6-24/O]
 gi|319930320|gb|ADV85184.1| LSU ribosomal protein L10p (P0) [Vibrio vulnificus MO6-24/O]
          Length = 162

 Score = 73.9 bits (180), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 49/159 (30%), Positives = 86/159 (54%), Gaps = 5/159 (3%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           +N Q K   ++E+++  + + S VVA  +G+SV  +  LRK+ REAG  +KV +N L + 
Sbjct: 3   LNLQDKKAIVAEVNEAAAGALSAVVADSRGVSVDAMTTLRKQAREAGVYMKVVRNTLARR 62

Query: 61  AIRDTSIRGISDLFVGQSLIVYS-DSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
           A+  T    ++D F G SLI +S + P  A ++   F+ +N +F +     E G L    
Sbjct: 63  AVEGTEYECLTDTFTGPSLIAFSNEHPGAAARLFKDFAKENKKFEIKAAAFE-GALTDAE 121

Query: 120 IKQIASLPDL-EGIRAGIISAIQSNATRLVRLLGTPQTQ 157
           +  +A+LP   E I   ++   +++A +LVR +   + Q
Sbjct: 122 V--LATLPTYDEAIARLMMCLKEASAGKLVRTIAAIRDQ 158


>gi|161506944|ref|YP_001576898.1| 50S ribosomal protein L10 [Lactobacillus helveticus DPC 4571]
 gi|260102431|ref|ZP_05752668.1| 50S ribosomal protein L10 [Lactobacillus helveticus DSM 20075]
 gi|172048176|sp|A8YTF1|RL10_LACH4 RecName: Full=50S ribosomal protein L10
 gi|160347933|gb|ABX26607.1| 50S ribosomal protein L10 [Lactobacillus helveticus DPC 4571]
 gi|260083751|gb|EEW67871.1| 50S ribosomal protein L10 [Lactobacillus helveticus DSM 20075]
 gi|328462868|gb|EGF34717.1| 50S ribosomal protein L10 [Lactobacillus helveticus MTCC 5463]
          Length = 170

 Score = 73.9 bits (180), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 37/136 (27%), Positives = 83/136 (61%), Gaps = 3/136 (2%)

Query: 10  ISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRG 69
           +   ++   ++ +I+V +Y G++V ++ ++RK++R+    +KV KN  ++ A     I G
Sbjct: 13  VDAFAEELKAAKAILVINYLGLTVEEVTNMRKELRDNDVKMKVIKNTYLRRAAAKAGIEG 72

Query: 70  ISDLFVGQSLIVYSDSP--VIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASL 126
           + D FVG + ++Y+D+   +  P +I   + +D +   + GG++E  + ++D IK++AS+
Sbjct: 73  LDDTFVGPTAVIYTDNADDITEPARIVSKYEDDFDVIEIKGGMLEGKLTSKDEIKELASI 132

Query: 127 PDLEGIRAGIISAIQS 142
           P  EG+ + ++S +Q+
Sbjct: 133 PGREGVLSMLVSVLQA 148


>gi|156972587|ref|YP_001443494.1| 50S ribosomal protein L10 [Vibrio harveyi ATCC BAA-1116]
 gi|156524181|gb|ABU69267.1| hypothetical protein VIBHAR_00227 [Vibrio harveyi ATCC BAA-1116]
          Length = 178

 Score = 73.9 bits (180), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 47/159 (29%), Positives = 86/159 (54%), Gaps = 5/159 (3%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           +N Q K   ++E+++  S + S VVA  +G+ V  +  LRK+ REAG  +KV +N L + 
Sbjct: 17  LNLQDKKAIVAEVNEAASGALSAVVADSRGVEVGAMTSLRKQAREAGVYMKVVRNTLARR 76

Query: 61  AIRDTSIRGISDLFVGQSLIVYS-DSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
           A++ T    ++D F G +LI +S + P  A ++   F+ +N +F +     E  V + + 
Sbjct: 77  AVQGTDYECLTDTFTGPTLIAFSNEHPGAAARLFKDFAKENKDFEIKAAAFEGAVTDAEV 136

Query: 120 IKQIASLPDL-EGIRAGIISAIQSNATRLVRLLGTPQTQ 157
              +A+LP   E I   ++   +++A +LVR +   + Q
Sbjct: 137 ---LATLPTYDEAIARLMMCMKEASAGKLVRTIAAIRDQ 172


>gi|282934790|ref|ZP_06340028.1| 50S ribosomal protein L10 [Lactobacillus jensenii 208-1]
 gi|281301153|gb|EFA93459.1| 50S ribosomal protein L10 [Lactobacillus jensenii 208-1]
          Length = 167

 Score = 73.9 bits (180), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 37/129 (28%), Positives = 80/129 (62%), Gaps = 3/129 (2%)

Query: 17  FSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRGISDLFVG 76
             ++ +I+V  Y G++V ++ ++RK++RE    +KV KN  ++ A +   I G+ D FVG
Sbjct: 20  LKAAKAILVIDYLGLTVDEVTNMRKELRENDVKMKVIKNTYLRRAAKKAGIEGLEDTFVG 79

Query: 77  QSLIVYSDSP--VIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASLPDLEGIR 133
            + ++Y+D+   +  P +I   + +D +   + GG++E  + +++ IK++AS+P  EG+ 
Sbjct: 80  PTAVIYTDNADDITEPARIVSKYEDDFDVINIKGGMLEGKLTSKEEIKELASIPGREGLL 139

Query: 134 AGIISAIQS 142
           + ++S +Q+
Sbjct: 140 SMLVSVLQA 148


>gi|118473128|ref|YP_885750.1| 50S ribosomal protein L10 [Mycobacterium smegmatis str. MC2 155]
 gi|166230034|sp|A0QS62|RL10_MYCS2 RecName: Full=50S ribosomal protein L10
 gi|118174415|gb|ABK75311.1| 50S ribosomal protein L10 [Mycobacterium smegmatis str. MC2 155]
          Length = 175

 Score = 73.9 bits (180), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 49/169 (28%), Positives = 90/169 (53%), Gaps = 2/169 (1%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           M +  K+  ++++++ F +S + VV  Y+G++VA + +LR+ + ++     VAKN LVK 
Sbjct: 1   MAKADKATAVADIAEQFKASTATVVTEYRGLTVANLAELRRALGDSAT-YTVAKNTLVKR 59

Query: 61  AIRDTSIRGISDLFVGQSLIVY-SDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
           A  +  I G+ +LF G + I +     V A K    F+ DN    + GG ++   L+   
Sbjct: 60  AASEAGIEGLDELFAGPTAIAFVKGEAVDAAKAIKKFAKDNKALVIKGGYMDGKALSVAD 119

Query: 120 IKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDK 168
           +++IA L   E + A +  A++ N ++   L   P +QV R  +A  +K
Sbjct: 120 VEKIADLESREVLLAKLAGAMKGNLSKAAGLFNAPASQVARLAAALQEK 168


>gi|238853599|ref|ZP_04643968.1| 50S ribosomal protein L10 [Lactobacillus gasseri 202-4]
 gi|300362318|ref|ZP_07058494.1| 50S ribosomal protein L10 [Lactobacillus gasseri JV-V03]
 gi|311111173|ref|ZP_07712570.1| ribosomal protein L10 [Lactobacillus gasseri MV-22]
 gi|238833743|gb|EEQ26011.1| 50S ribosomal protein L10 [Lactobacillus gasseri 202-4]
 gi|300353309|gb|EFJ69181.1| 50S ribosomal protein L10 [Lactobacillus gasseri JV-V03]
 gi|311066327|gb|EFQ46667.1| ribosomal protein L10 [Lactobacillus gasseri MV-22]
          Length = 166

 Score = 73.9 bits (180), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 39/136 (28%), Positives = 78/136 (57%), Gaps = 3/136 (2%)

Query: 10  ISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRG 69
           + + +     + +I+V  Y G++V ++ +LRK +R++   +KV KN  +K A     I G
Sbjct: 13  VDDFAAELKEAKAILVIDYLGLTVEEVTNLRKDLRDSNVKMKVIKNTYLKRAAEKAGIEG 72

Query: 70  ISDLFVGQSLIVYS---DSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASL 126
           + D FVG + +VY+   D      +I   + +D +   + GG++E  V +Q+ IK++A++
Sbjct: 73  LDDTFVGPTAVVYTADADDITEPARIVSKYEDDIDALSIKGGMLEGKVASQEEIKKLAAI 132

Query: 127 PDLEGIRAGIISAIQS 142
           P  EG+ + ++S +Q+
Sbjct: 133 PGREGLLSMLVSVLQA 148


>gi|27364614|ref|NP_760142.1| 50S ribosomal protein L10 [Vibrio vulnificus CMCP6]
 gi|37681345|ref|NP_935954.1| 50S ribosomal protein L10 [Vibrio vulnificus YJ016]
 gi|29336647|sp|Q8DD22|RL10_VIBVU RecName: Full=50S ribosomal protein L10
 gi|61215221|sp|Q7MGR6|RL10_VIBVY RecName: Full=50S ribosomal protein L10
 gi|27360733|gb|AAO09669.1| LSU ribosomal protein L10p (P0) [Vibrio vulnificus CMCP6]
 gi|37200096|dbj|BAC95925.1| ribosomal protein L10 [Vibrio vulnificus YJ016]
          Length = 162

 Score = 73.9 bits (180), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 49/159 (30%), Positives = 86/159 (54%), Gaps = 5/159 (3%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           +N Q K   ++E+++  + + S VVA  +G+SV  +  LRK+ REAG  +KV +N L + 
Sbjct: 3   LNLQDKKAIVAEVNEAAAGALSAVVADSRGVSVDAMTTLRKQAREAGVYMKVVRNTLARR 62

Query: 61  AIRDTSIRGISDLFVGQSLIVYS-DSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
           A+  T    ++D F G SLI +S + P  A ++   F+ +N +F +     E G L    
Sbjct: 63  AVEGTQYECLTDTFTGPSLIAFSNEHPGAAARLFKDFAKENKKFEIKAAAFE-GALTDAE 121

Query: 120 IKQIASLPDL-EGIRAGIISAIQSNATRLVRLLGTPQTQ 157
           +  +A+LP   E I   ++   +++A +LVR +   + Q
Sbjct: 122 V--LATLPTYDEAIARLMMCLKEASAGKLVRTIAAIRDQ 158


>gi|295099258|emb|CBK88347.1| LSU ribosomal protein L10P [Eubacterium cylindroides T2-87]
          Length = 187

 Score = 73.9 bits (180), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 35/137 (25%), Positives = 78/137 (56%)

Query: 6   KSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDT 65
           K  +++ L++   ++ S+V+  Y+G++VA++ +LR+ +RE    +KV KN + + A    
Sbjct: 9   KEADVNALAEKMEAASSVVLVEYRGLTVAEVTELRRALREEDVELKVYKNAIARRASEKL 68

Query: 66  SIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIAS 125
                S+  VG + + +   PV   ++   F+ ++    +  G+V+  +++ D+IK+++S
Sbjct: 69  GYNDFSEGLVGPNALAFGKDPVAPARVLAKFAKNHENLVLKTGIVDGSMVDTDTIKKLSS 128

Query: 126 LPDLEGIRAGIISAIQS 142
           LP+ EG+ A   S + +
Sbjct: 129 LPNKEGMLAKFASCLNA 145


>gi|167626048|ref|YP_001676342.1| 50S ribosomal protein L10 [Shewanella halifaxensis HAW-EB4]
 gi|189040934|sp|B0TM21|RL10_SHEHH RecName: Full=50S ribosomal protein L10
 gi|167356070|gb|ABZ78683.1| ribosomal protein L10 [Shewanella halifaxensis HAW-EB4]
          Length = 165

 Score = 73.9 bits (180), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 46/156 (29%), Positives = 83/156 (53%), Gaps = 2/156 (1%)

Query: 4   QGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIR 63
           + K   ++E+++    + S VVA  +G++VA +  LRK  REAG  ++V +N LVK A+ 
Sbjct: 6   EDKKAIVAEVNEAAKGALSAVVADSRGVTVANMTGLRKAAREAGVYIRVVRNTLVKRAVA 65

Query: 64  DTSIRGISDLFVGQSLIVYS-DSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQ 122
            T    +SD F G +LI +S + P  A ++   F+    +F +     E  ++  ++I +
Sbjct: 66  GTDFECLSDTFTGPTLIAFSTEHPGAAARLLKDFAKAQEKFEIKAAAFEGELIPAENIDR 125

Query: 123 IASLPDLEGIRAGIISAI-QSNATRLVRLLGTPQTQ 157
           +A LP  E   A  +  + +++A + VR L   + Q
Sbjct: 126 LAKLPTYEEALAQFMMTLKEASAGKFVRTLAALRDQ 161


>gi|260883995|ref|ZP_05895609.1| LOW QUALITY PROTEIN: 50S ribosomal protein L10 [Brucella abortus
           bv. 9 str. C68]
 gi|260873523|gb|EEX80592.1| LOW QUALITY PROTEIN: 50S ribosomal protein L10 [Brucella abortus
           bv. 9 str. C68]
          Length = 73

 Score = 73.9 bits (180), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 49/70 (70%)

Query: 68  RGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASLP 127
            GI+DLF GQ+++ Y++ P+ APK++V F+  N++  +LGG +    LN D +K +ASLP
Sbjct: 2   EGIADLFTGQTVVAYANDPITAPKVAVEFAKANDKLVILGGAMGATTLNADGVKSLASLP 61

Query: 128 DLEGIRAGII 137
            L+ +RA ++
Sbjct: 62  SLDELRAKLV 71


>gi|209696268|ref|YP_002264198.1| 50S ribosomal protein L10 [Aliivibrio salmonicida LFI1238]
 gi|226699900|sp|B6ENR5|RL10_ALISL RecName: Full=50S ribosomal protein L10
 gi|208010221|emb|CAQ80552.1| 50S ribosomal subunit protein L10 [Aliivibrio salmonicida LFI1238]
          Length = 164

 Score = 73.9 bits (180), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 47/159 (29%), Positives = 84/159 (52%), Gaps = 5/159 (3%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           +N Q K   ++E+++  S + S VVA  +G++V  +  LRK+ REAG  ++V +N L + 
Sbjct: 3   LNLQDKKAIVAEVNEAASGALSAVVADSRGVTVGAMTSLRKQAREAGVYMRVVRNTLARR 62

Query: 61  AIRDTSIRGISDLFVGQSLIVYS-DSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
           A+  T    + D F G SL+ +S + P  A ++   F+ +N  F +     E  V + D 
Sbjct: 63  AVEGTQYECLQDTFTGPSLLAFSNEHPGAAARLFKDFAKENKNFEIKAAAFEGAVTDADV 122

Query: 120 IKQIASLPDL-EGIRAGIISAIQSNATRLVRLLGTPQTQ 157
              +A+LP   E I   ++   +++A +LVR +   + Q
Sbjct: 123 ---LATLPTYDEAIARLMMCMKEASAGKLVRTIAAVRDQ 158


>gi|300812646|ref|ZP_07093058.1| ribosomal protein L10 [Lactobacillus delbrueckii subsp. bulgaricus
           PB2003/044-T3-4]
 gi|300496376|gb|EFK31486.1| ribosomal protein L10 [Lactobacillus delbrueckii subsp. bulgaricus
           PB2003/044-T3-4]
          Length = 169

 Score = 73.9 bits (180), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 38/136 (27%), Positives = 80/136 (58%), Gaps = 3/136 (2%)

Query: 10  ISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRG 69
           + E ++   S+ SIVV +Y G++V Q+   R ++RE+   +KV KN  ++ A     +  
Sbjct: 13  VEEFAEELKSAKSIVVINYLGLTVDQVTAFRAELRESNAKMKVVKNTYLRRAAAQAGLED 72

Query: 70  ISDLFVGQSLIVYSDSP--VIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASL 126
           ++ +FVG S ++Y+D    V AP +I+  ++   +   + GG +E  V  ++ ++++A++
Sbjct: 73  LASVFVGPSAVIYTDDEDNVTAPARIAADYAKKFDVVEIKGGALEGQVATKEQVEELAAI 132

Query: 127 PDLEGIRAGIISAIQS 142
           P  EG+ + ++S +Q+
Sbjct: 133 PGREGLLSMLLSVLQA 148


>gi|326802937|ref|YP_004320755.1| ribosomal protein L10 [Aerococcus urinae ACS-120-V-Col10a]
 gi|326650078|gb|AEA00261.1| ribosomal protein L10 [Aerococcus urinae ACS-120-V-Col10a]
          Length = 172

 Score = 73.9 bits (180), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 45/164 (27%), Positives = 90/164 (54%), Gaps = 12/164 (7%)

Query: 6   KSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDT 65
           K  E+  + +  ++S S VV  Y G++V+++ +LRK++R+     KV KN +++ A+   
Sbjct: 9   KQQEVDAIVERINNSISFVVVDYLGLTVSEVTELRKQLRDEDVFFKVIKNTMMRRALDQA 68

Query: 66  SIRGISDLFVGQSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIA 124
            I    ++F G + + +S    +AP +I  +F+ D +   + GGV++  +++++ I +IA
Sbjct: 69  GIEYHEEVFQGPTAVAFSAEDAVAPARILANFAKDADALTLKGGVIDGKIMSKEEIHKIA 128

Query: 125 SLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDK 168
           SLP  +G+ + ++S +Q+           P   V  A+ A  DK
Sbjct: 129 SLPSRDGLLSMLLSVLQA-----------PVRNVAYAVKAVQDK 161


>gi|157960005|ref|YP_001500039.1| 50S ribosomal protein L10 [Shewanella pealeana ATCC 700345]
 gi|189040935|sp|A8GYW7|RL10_SHEPA RecName: Full=50S ribosomal protein L10
 gi|157845005|gb|ABV85504.1| ribosomal protein L10 [Shewanella pealeana ATCC 700345]
          Length = 165

 Score = 73.9 bits (180), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 45/150 (30%), Positives = 81/150 (54%), Gaps = 2/150 (1%)

Query: 10  ISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRG 69
           ++E+++    + S VVA  +G++VA +  LRK  REAG  ++V +N LVK A+  T    
Sbjct: 12  VAEVNEAAKGALSAVVADSRGVTVANMTGLRKAAREAGVYIRVVRNTLVKRAVAGTDFEC 71

Query: 70  ISDLFVGQSLIVY-SDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASLPD 128
           +SD F G +LI + S+ P  A ++   F+    +F +     E  ++  ++I ++A LP 
Sbjct: 72  LSDTFTGPTLIAFSSEHPGAAARLLKDFAKAQEKFEIKAAAFEGELIPAENIDRLAKLPT 131

Query: 129 LEGIRAGIISAI-QSNATRLVRLLGTPQTQ 157
            E   A  +  + +++A + VR L   + Q
Sbjct: 132 YEEALAQFMMTLKEASAGKFVRTLAALRDQ 161


>gi|157363339|ref|YP_001470106.1| 50S ribosomal protein L10 [Thermotoga lettingae TMO]
 gi|157313943|gb|ABV33042.1| ribosomal protein L10 [Thermotoga lettingae TMO]
          Length = 191

 Score = 73.9 bits (180), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 52/179 (29%), Positives = 91/179 (50%), Gaps = 8/179 (4%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMR---EAGGGVKVAKNRL 57
           + RQ K   + +L   FS+S  ++  +Y G +VA ++DLR+++    E      VAKN L
Sbjct: 13  ITRQQKEAVLEKLENDFSNSSLVMFINYSGFNVAMMRDLRRRLYSKYEREARFTVAKNTL 72

Query: 58  VKIAIRDTSI--RGISDLFVGQSLIVY--SDSPVIAPKISVSFSNDNN-EFRVLGGVVEK 112
           +  A+       +    +  G + ++Y  SD P+ A KI+ SFS +   E    GG +E 
Sbjct: 73  IGRALSKVGYAEKDFQSILAGPTAVLYVLSDDPIEAIKITHSFSKEKKLEGIFKGGFLEG 132

Query: 113 GVLNQDSIKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQQ 171
                D + ++ASLP  E + A ++  +Q+  T LV +L     +++ A++A  DK  +
Sbjct: 133 NYFTADDVSKLASLPTKEELYAMVVGRVQAPLTNLVYVLSGTIRKLLYALNAIHDKKSK 191


>gi|313124304|ref|YP_004034563.1| 50S ribosomal protein l10 [Lactobacillus delbrueckii subsp.
           bulgaricus ND02]
 gi|312280867|gb|ADQ61586.1| 50S ribosomal protein L10 [Lactobacillus delbrueckii subsp.
           bulgaricus ND02]
 gi|325685653|gb|EGD27735.1| 50S ribosomal protein L10 [Lactobacillus delbrueckii subsp. lactis
           DSM 20072]
          Length = 169

 Score = 73.9 bits (180), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 38/136 (27%), Positives = 80/136 (58%), Gaps = 3/136 (2%)

Query: 10  ISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRG 69
           + E ++   S+ SIVV +Y G++V Q+   R ++RE+   +KV KN  ++ A     +  
Sbjct: 13  VEEFAEELKSAKSIVVINYLGLTVDQVTAFRAELRESNAKMKVVKNTYLRRAAAQAGLED 72

Query: 70  ISDLFVGQSLIVYSDSP--VIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASL 126
           ++ +FVG S ++Y+D    V AP +I+  ++   +   + GG +E  V  ++ ++++A++
Sbjct: 73  LAPVFVGPSAVIYTDDEDNVTAPARIAADYAKKFDVVEIKGGALEGQVATKEQVEELAAI 132

Query: 127 PDLEGIRAGIISAIQS 142
           P  EG+ + ++S +Q+
Sbjct: 133 PGREGLLSMLLSVLQA 148


>gi|68536941|ref|YP_251646.1| 50S ribosomal protein L10 [Corynebacterium jeikeium K411]
 gi|260579286|ref|ZP_05847169.1| 50S ribosomal protein L10 [Corynebacterium jeikeium ATCC 43734]
 gi|97181608|sp|Q4JT29|RL10_CORJK RecName: Full=50S ribosomal protein L10
 gi|68264540|emb|CAI38028.1| 50S ribosomal protein L10 [Corynebacterium jeikeium K411]
 gi|258602585|gb|EEW15879.1| 50S ribosomal protein L10 [Corynebacterium jeikeium ATCC 43734]
          Length = 171

 Score = 73.9 bits (180), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 46/168 (27%), Positives = 82/168 (48%), Gaps = 6/168 (3%)

Query: 7   SVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGV--KVAKNRLVKIAIRD 64
           +  + EL   F  + S ++  Y+G+SVA+  +LR+ +   G  V   VAKN ++K+A R+
Sbjct: 7   TASLEELKARFEQAQSTLLTEYRGLSVAETTELRRAL---GSDVTYSVAKNTMIKLAARE 63

Query: 65  TSIRGISDLFVGQSLIVYSDSPVI-APKISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQI 123
             I     L  G + I + +   + A K    F  D+  F + GG ++   ++   ++ I
Sbjct: 64  AGIELDESLLTGPTAIAFVNGEAVDAAKAMKDFGKDHKNFVIKGGYMDGATIDAAQVEAI 123

Query: 124 ASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQQ 171
           A L + E   A +  A+Q +  +   L   P +QV R  +A  +K +Q
Sbjct: 124 AELDNRETTLAKLAGAMQGSLAKAAGLFNAPASQVARLAAALQEKKEQ 171


>gi|269103667|ref|ZP_06156364.1| LSU ribosomal protein L10p (P0) [Photobacterium damselae subsp.
           damselae CIP 102761]
 gi|268163565|gb|EEZ42061.1| LSU ribosomal protein L10p (P0) [Photobacterium damselae subsp.
           damselae CIP 102761]
          Length = 164

 Score = 73.9 bits (180), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 47/159 (29%), Positives = 87/159 (54%), Gaps = 5/159 (3%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           +N Q K   ++E+++  + + S VVA  +G++V  +  LRK+ RE G  +KV +N L + 
Sbjct: 3   LNLQDKKAIVAEVNEAANGALSAVVADSRGVAVGAMTTLRKQARENGVYLKVVRNTLARR 62

Query: 61  AIRDTSIRGISDLFVGQSLIVYS-DSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
           A+  T    + D+FVG SLI +S + P  A ++   F+ +N +F +     E  + N   
Sbjct: 63  AVEGTDFECLQDVFVGPSLIGFSNEHPGAAARLFKDFAKENKDFEIKAAAFEGAIAN--- 119

Query: 120 IKQIASLPDL-EGIRAGIISAIQSNATRLVRLLGTPQTQ 157
           ++ +A+LP   E I   ++   +++A +LVR +   + Q
Sbjct: 120 VEVLATLPTYDEAIARLMMCMKEASAGKLVRTIAAVRDQ 158


>gi|255019482|ref|ZP_05291578.1| LSU ribosomal protein L10p (P0) [Acidithiobacillus caldus ATCC
           51756]
 gi|254971077|gb|EET28543.1| LSU ribosomal protein L10p (P0) [Acidithiobacillus caldus ATCC
           51756]
          Length = 173

 Score = 73.9 bits (180), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 40/148 (27%), Positives = 80/148 (54%)

Query: 22  SIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRGISDLFVGQSLIV 81
           + VVA Y+G++VAQ+ +LR   R+ G  ++V KN L++ A++D+    +  L  G  +  
Sbjct: 24  ATVVAEYRGLTVAQMTELRAAGRKQGVLIQVVKNSLLRRALKDSPFLVMDPLLKGPLVFA 83

Query: 82  YSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASLPDLEGIRAGIISAIQ 141
            S  PV   K+   F+  N++  + GG +   +++  ++ Q++ +P  E + A ++  +Q
Sbjct: 84  ASADPVAMAKLFTDFAKRNDKLIITGGALGSQLMDAQALAQLSKMPSREELLAKLMGTMQ 143

Query: 142 SNATRLVRLLGTPQTQVVRAISAFVDKN 169
           +  +  VR L     + VR ++A  D+ 
Sbjct: 144 APISTFVRTLNEVPGRFVRTLAAVRDQK 171


>gi|19746042|ref|NP_607178.1| 50S ribosomal protein L10 [Streptococcus pyogenes MGAS8232]
 gi|24212226|sp|Q8P159|RL10_STRP8 RecName: Full=50S ribosomal protein L10
 gi|19748210|gb|AAL97677.1| 50S ribosomal protein L10 [Streptococcus pyogenes MGAS8232]
          Length = 166

 Score = 73.9 bits (180), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 41/138 (29%), Positives = 82/138 (59%), Gaps = 1/138 (0%)

Query: 6   KSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDT 65
           K+ ++  +++   ++ SIVV   +G++V Q   LR+ +RE+G   KV KN ++  A    
Sbjct: 9   KAEQVELIAEKMKAAASIVVVDSRGLTVDQDTVLRRSLRESGVEFKVIKNSILTRAAEKA 68

Query: 66  SIRGISDLFVGQSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIA 124
            +  + D+FVG S + +S+  VIAP K+   F+   +   + GG +E  V +++ I+ +A
Sbjct: 69  GLDELKDVFVGPSAVAFSNEDVIAPAKVINDFTKTADALEIKGGAIEGAVSSKEEIQALA 128

Query: 125 SLPDLEGIRAGIISAIQS 142
           +LP+ +G+ + ++S +Q+
Sbjct: 129 TLPNRQGMLSMLLSVLQA 146


>gi|167768210|ref|ZP_02440263.1| hypothetical protein CLOSS21_02766 [Clostridium sp. SS2/1]
 gi|317499071|ref|ZP_07957351.1| ribosomal protein L10 [Lachnospiraceae bacterium 5_1_63FAA]
 gi|167709734|gb|EDS20313.1| hypothetical protein CLOSS21_02766 [Clostridium sp. SS2/1]
 gi|291560229|emb|CBL39029.1| LSU ribosomal protein L10P [butyrate-producing bacterium SSC/2]
 gi|316893647|gb|EFV15849.1| ribosomal protein L10 [Lachnospiraceae bacterium 5_1_63FAA]
          Length = 167

 Score = 73.6 bits (179), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 43/143 (30%), Positives = 78/143 (54%), Gaps = 1/143 (0%)

Query: 10  ISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRG 69
           ++E+ ++ + + S V+  Y+GI+V Q   +RK++REA    KV KN +++ AI+ T    
Sbjct: 11  VNEIKELLTDAQSAVLVSYRGITVEQDTAMRKELREADVEYKVYKNTMIRFAIQGTEFEA 70

Query: 70  ISDLFVGQSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASLPD 128
           ++D   G + I  S +   AP +I    + +     +  GVVE    ++D I+ IAS+P 
Sbjct: 71  LADDLKGPTAIAVSKTDATAPARILAKHAKNIEVLEMKSGVVEGTFYDKDGIQVIASIPS 130

Query: 129 LEGIRAGIISAIQSNATRLVRLL 151
            + + A  + +IQS  T   R++
Sbjct: 131 RDELLAKFLGSIQSPITNFARVI 153


>gi|22537449|ref|NP_688300.1| 50S ribosomal protein L10 [Streptococcus agalactiae 2603V/R]
 gi|76800036|ref|ZP_00781959.1| 50S ribosomal protein [Streptococcus agalactiae 18RS21]
 gi|29336667|sp|Q8DZ20|RL10_STRA5 RecName: Full=50S ribosomal protein L10
 gi|22534326|gb|AAN00173.1|AE014251_17 ribosomal protein L10 [Streptococcus agalactiae 2603V/R]
 gi|76584646|gb|EAO61445.1| 50S ribosomal protein [Streptococcus agalactiae 18RS21]
 gi|319745304|gb|EFV97622.1| 50S ribosomal protein L10 [Streptococcus agalactiae ATCC 13813]
          Length = 166

 Score = 73.6 bits (179), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 47/170 (27%), Positives = 90/170 (52%), Gaps = 14/170 (8%)

Query: 3   RQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAI 62
           ++ + VE+  +++   ++ SIVV   +G++V Q  +LR+ +RE+    KV KN ++  A 
Sbjct: 8   KKAEQVEL--IAEKMKAAASIVVVDSRGLTVEQDTNLRRSLRESDVEFKVIKNSILTRAA 65

Query: 63  RDTSIRGISDLFVGQSLIVYSDSPVIAP-KISVSFSNDNNEFRVLGGVVEKGVLNQDSIK 121
               +  + +LFVG S + +S+  VIAP K+   F+ D     + GG V+    + + I 
Sbjct: 66  EKAGLEDLKELFVGPSAVAFSNEDVIAPAKVISDFAKDAEALEIKGGSVDGKFTSVEEIN 125

Query: 122 QIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQQ 171
            +A LP+ EG+ + ++S +Q+           P   V  A+ A  +K+++
Sbjct: 126 ALAKLPNKEGMLSMLLSVLQA-----------PVRNVAYAVKAVAEKDEE 164


>gi|116629032|ref|YP_814204.1| 50S ribosomal protein L10 [Lactobacillus gasseri ATCC 33323]
 gi|116094614|gb|ABJ59766.1| LSU ribosomal protein L10P [Lactobacillus gasseri ATCC 33323]
          Length = 190

 Score = 73.6 bits (179), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 39/136 (28%), Positives = 78/136 (57%), Gaps = 3/136 (2%)

Query: 10  ISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRG 69
           + + +     + +I+V  Y G++V ++ +LRK +R++   +KV KN  +K A     I G
Sbjct: 37  VDDFAAELKEAKAILVIDYLGLTVEEVTNLRKDLRDSNVKMKVIKNTYLKRAAEKAGIEG 96

Query: 70  ISDLFVGQSLIVYS---DSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASL 126
           + D FVG + +VY+   D      +I   + +D +   + GG++E  V +Q+ IK++A++
Sbjct: 97  LDDTFVGPTAVVYTADADDITEPARIVSKYEDDIDALSIKGGMLEGKVASQEEIKKLAAI 156

Query: 127 PDLEGIRAGIISAIQS 142
           P  EG+ + ++S +Q+
Sbjct: 157 PGREGLLSMLVSVLQA 172


>gi|296395102|ref|YP_003659986.1| 50S ribosomal protein L10 [Segniliparus rotundus DSM 44985]
 gi|296182249|gb|ADG99155.1| ribosomal protein L10 [Segniliparus rotundus DSM 44985]
          Length = 174

 Score = 73.6 bits (179), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 46/165 (27%), Positives = 86/165 (52%), Gaps = 4/165 (2%)

Query: 9   EISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKM-REAGGGVKVAKNRLVKIAIRDTSI 67
           ++++++K F  + + +V  Y+G++++ +  LR  + R+      VAKN LVK A  D  +
Sbjct: 9   KVADIAKRFEEANAAIVTEYRGLTMSSLTKLRTDLGRDTT--YLVAKNTLVKRAAADAGV 66

Query: 68  RGISDLFVGQSLIVYSDSPVI-APKISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASL 126
            G  +LF G + + + +  ++ A K+   F+ +N    V GG ++  VL +  + ++A L
Sbjct: 67  EGADELFAGPTAVAFVNGDIVEAAKVIKGFAKENQALVVKGGYLDGAVLTEKEVIKLADL 126

Query: 127 PDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQQ 171
              E + A +  AI+      + LL  P +QV R   A  D+ QQ
Sbjct: 127 ESREVLLAKVAGAIKGALGSALGLLNAPLSQVARLSQALADQKQQ 171


>gi|315925312|ref|ZP_07921523.1| 50S ribosomal protein L10 [Pseudoramibacter alactolyticus ATCC
           23263]
 gi|315621213|gb|EFV01183.1| 50S ribosomal protein L10 [Pseudoramibacter alactolyticus ATCC
           23263]
          Length = 176

 Score = 73.6 bits (179), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 43/171 (25%), Positives = 89/171 (52%), Gaps = 1/171 (0%)

Query: 2   NRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIA 61
           N + K   ++E+++   ++   VV  Y+G++VA++ +LR K RE G   KV KN +++ A
Sbjct: 3   NLEAKKAIVAEIAEKMKNAQGAVVVDYRGLNVAEVTELRSKAREQGVEYKVYKNAMMRFA 62

Query: 62  IRDTSIRGISDLFVGQSLIVYSDSPVIA-PKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
            ++  + G+     G + I + +S  +A  K+   F+ D+ +  +  GVVE  V++   +
Sbjct: 63  AQEAGLEGLLPSLTGPNAIAFCESDAVATAKLMADFAKDHEKLEIKAGVVEGKVIDAAGV 122

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQQ 171
            Q+A +P  + + A  +  + +    LV +L      +V A+    D+ ++
Sbjct: 123 GQLAKMPSRDELVAMTLRGLNAPIAGLVNVLNGTIKGLVVALGQIADQKRE 173


>gi|120553643|ref|YP_957994.1| 50S ribosomal protein L10 [Marinobacter aquaeolei VT8]
 gi|166229740|sp|A1TYI8|RL10_MARAV RecName: Full=50S ribosomal protein L10
 gi|120323492|gb|ABM17807.1| LSU ribosomal protein L10P [Marinobacter aquaeolei VT8]
          Length = 176

 Score = 73.6 bits (179), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 45/170 (26%), Positives = 85/170 (50%), Gaps = 1/170 (0%)

Query: 4   QGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIR 63
           + K   ++E+++   ++ S+V+A Y+G++   +  LR K R     +KV +N L KIAIR
Sbjct: 6   EDKKAIVAEVNETAGAALSVVLADYRGVTSGDMTALRAKARAENVRLKVVRNNLAKIAIR 65

Query: 64  DTSIRGISDLFVGQSLIVYS-DSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQ 122
            T    I    VG +++ +S + P  A ++   F+ +   F + G  V   ++  + I +
Sbjct: 66  GTEFECIDPALVGPTILAFSMEDPGAAARLLKDFAKEKEAFEIKGLAVGGELMGAEQIDR 125

Query: 123 IASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQQG 172
           +A+LP L      +    Q+  T+L R L     ++ R ++A  D+ Q  
Sbjct: 126 LATLPTLHEALTKLAIVTQAPVTKLARTLNDIPGRITRVVAAVRDQKQDA 175


>gi|68249218|ref|YP_248330.1| 50S ribosomal protein L10 [Haemophilus influenzae 86-028NP]
 gi|81336378|sp|Q4QMS7|RL10_HAEI8 RecName: Full=50S ribosomal protein L10
 gi|68057417|gb|AAX87670.1| 50S ribosomal protein L10 [Haemophilus influenzae 86-028NP]
          Length = 163

 Score = 73.6 bits (179), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 50/177 (28%), Positives = 92/177 (51%), Gaps = 22/177 (12%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           +N Q K   ++E+++    + S V+A  +G++V ++ +LRK  REAG  ++V +N L++ 
Sbjct: 3   LNLQDKQAIVAEVNEAAKGALSAVIADSRGVTVEKMTELRKSAREAGVTMRVVRNTLLRR 62

Query: 61  AIRDTSIRGISDLFVGQSLIVYS-DSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
           A+  T    + D FVG +LI +S + P  A ++   F+  N++F + G   E  +  QD 
Sbjct: 63  AVEGTDYECLKDTFVGPTLIAFSNEHPGEAARLFKEFAKANDKFEIKGAAFEGKI--QD- 119

Query: 120 IKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQT----QVVRAISAFVDKNQQG 172
           ++ +A+LP  E                + RL+GT +     ++ R  +A  DK Q+ 
Sbjct: 120 VEFLATLPTYE--------------EAIARLMGTMKEAAAGKLARTFAALRDKLQEA 162


>gi|150020402|ref|YP_001305756.1| 50S ribosomal protein L10 [Thermosipho melanesiensis BI429]
 gi|166230084|sp|A6LKC0|RL10_THEM4 RecName: Full=50S ribosomal protein L10
 gi|149792923|gb|ABR30371.1| ribosomal protein L10 [Thermosipho melanesiensis BI429]
          Length = 180

 Score = 73.6 bits (179), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 51/179 (28%), Positives = 90/179 (50%), Gaps = 8/179 (4%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREA---GGGVKVAKNRL 57
           + R+ K + + ELS IF  S  I+ + YKG++V QI  LR+K+RE    G   +V KN +
Sbjct: 2   LTRKQKELLVEELSAIFEKSSLILFSDYKGLNVEQITKLRRKLREKLANGARYRVIKNSV 61

Query: 58  VKIAIRDT--SIRGISDLFVGQSLIVYSDS--PVIAPKISVSFSNDNNEFRVLGGVVEKG 113
             +A++    S+  I ++F G   I+Y +   P+ A KI   FS +        G+   G
Sbjct: 62  AYLALKKAGYSVDEIEEVFSGPLAILYVEEGDPIEAIKIIYDFSKETKGLPSFKGLYLDG 121

Query: 114 -VLNQDSIKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQQ 171
              + + ++ ++ LP  E + A ++S +Q      V +L      ++ A++A  DK  +
Sbjct: 122 RFFDAEEVENLSKLPSKEQLLAMVVSGVQGPIRGFVNVLSGTLKSLLYALNAIKDKKSE 180


>gi|307243190|ref|ZP_07525363.1| ribosomal protein L10 [Peptostreptococcus stomatis DSM 17678]
 gi|306493451|gb|EFM65431.1| ribosomal protein L10 [Peptostreptococcus stomatis DSM 17678]
          Length = 173

 Score = 73.6 bits (179), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 48/152 (31%), Positives = 84/152 (55%), Gaps = 6/152 (3%)

Query: 6   KSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIR-- 63
           KS  ++E+++ F  + S++V  YKG++V Q+ DLR +MREAG   KV KN LV+ A    
Sbjct: 8   KSAVVAEIAEKFEKAASVIVVDYKGLTVEQVTDLRSQMREAGVDYKVYKNTLVRRAASQI 67

Query: 64  --DTSIRGISDLFVGQSLIVYSDSPVIAP-KISVSFSNDN-NEFRVLGGVVEKGVLNQDS 119
             D       +L VG + I +     +AP ++  +F + N ++  +  GVVE    ++  
Sbjct: 68  EGDVYANFNDELLVGPNAIAFGYEDAVAPARVLKAFMDKNPDKITLKMGVVEGEFYDEAK 127

Query: 120 IKQIASLPDLEGIRAGIISAIQSNATRLVRLL 151
           I  +AS+P  E + A ++ ++++  +  V LL
Sbjct: 128 IVSLASIPSREELIAKLLGSLKAPMSNFVYLL 159


>gi|260770578|ref|ZP_05879510.1| LSU ribosomal protein L10p (P0) [Vibrio furnissii CIP 102972]
 gi|260614408|gb|EEX39595.1| LSU ribosomal protein L10p (P0) [Vibrio furnissii CIP 102972]
          Length = 164

 Score = 73.6 bits (179), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 46/159 (28%), Positives = 87/159 (54%), Gaps = 5/159 (3%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           +N Q K   ++E+++  S + S VVA  +G+ VA +  LRK+ REAG  ++V +N L + 
Sbjct: 3   LNLQDKKAIVAEVNEAASGALSAVVADSRGVQVAAMTTLRKQAREAGVYLRVVRNTLARR 62

Query: 61  AIRDTSIRGISDLFVGQSLIVYS-DSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119
           A+  T+   + D+FVG +LI +S + P  A ++   F+ +N  F +     E  + +   
Sbjct: 63  AVEGTAYECLQDVFVGPTLIGFSNEHPGAAARLFKDFAKENKAFEIKAAAFEGAITD--- 119

Query: 120 IKQIASLPDL-EGIRAGIISAIQSNATRLVRLLGTPQTQ 157
           ++ +A+LP   E I   ++   +++A +L R +   + Q
Sbjct: 120 VEVLATLPTYDEAIARLMMCMKEASAAKLARTIAAIRDQ 158


>gi|227879340|ref|ZP_03997204.1| ribosomal protein L10 [Lactobacillus crispatus JV-V01]
 gi|256844515|ref|ZP_05550001.1| 50S ribosomal protein L10 [Lactobacillus crispatus 125-2-CHN]
 gi|256849096|ref|ZP_05554529.1| 50S ribosomal protein L10 [Lactobacillus crispatus MV-1A-US]
 gi|262047578|ref|ZP_06020533.1| 50S ribosomal protein L10 [Lactobacillus crispatus MV-3A-US]
 gi|293381052|ref|ZP_06627073.1| 50S ribosomal protein L10 [Lactobacillus crispatus 214-1]
 gi|295692232|ref|YP_003600842.1| 50S ribosomal protein l10 [Lactobacillus crispatus ST1]
 gi|312977931|ref|ZP_07789677.1| ribosomal protein L10 [Lactobacillus crispatus CTV-05]
 gi|227861061|gb|EEJ68716.1| ribosomal protein L10 [Lactobacillus crispatus JV-V01]
 gi|256613593|gb|EEU18796.1| 50S ribosomal protein L10 [Lactobacillus crispatus 125-2-CHN]
 gi|256713872|gb|EEU28860.1| 50S ribosomal protein L10 [Lactobacillus crispatus MV-1A-US]
 gi|260572154|gb|EEX28719.1| 50S ribosomal protein L10 [Lactobacillus crispatus MV-3A-US]
 gi|290922352|gb|EFD99333.1| 50S ribosomal protein L10 [Lactobacillus crispatus 214-1]
 gi|295030338|emb|CBL49817.1| 50S ribosomal protein L10 [Lactobacillus crispatus ST1]
 gi|310895238|gb|EFQ44306.1| ribosomal protein L10 [Lactobacillus crispatus CTV-05]
          Length = 170

 Score = 73.6 bits (179), Expect = 9e-1