RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780145|ref|YP_003064558.1| 50S ribosomal protein L10 [Candidatus Liberibacter asiaticus str. psy62] (172 letters) >gnl|CDD|88597 cd05797, Ribosomal_L10, Ribosomal protein L10 family, L10 subfamily; composed of bacterial 50S ribosomal protein and eukaryotic mitochondrial 39S ribosomal protein, L10. L10 occupies the L7/L12 stalk of the ribosome. The N-terminal domain (NTD) of L10 interacts with L11 protein and forms the base of the L7/L12 stalk, while the extended C-terminal helix binds to two or three dimers of the NTD of L7/L12 (L7 and L12 are identical except for an acetylated N-terminus). The L7/L12 stalk is known to contain the binding site for elongation factors G and Tu (EF-G and EF-Tu, respectively); however, there is disagreement as to whether or not L10 is involved in forming the binding site. The stalk is believed to be associated with GTPase activities in protein synthesis. In a neuroblastoma cell line, L10 has been shown to interact with the SH3 domain of Src and to activate the binding of the Nck1 adaptor protein with skeletal proteins such as the Wiskott-Aldrich Syndrome Protein (WASP) and the WASP-interacting protein (WIP). These bacteria and eukaryotic sequences have no additional C-terminal domain, present in other eukaryotic and archaeal orthologs.. Length = 157 Score = 149 bits (378), Expect = 3e-37 Identities = 61/157 (38%), Positives = 98/157 (62%), Gaps = 1/157 (0%) Query: 2 NRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIA 61 NR+ K ++EL + + S+VVA Y+G++VAQ+ +LRK++REAG +KV KN L K A Sbjct: 1 NREKKEEIVAELKEKLKEAKSVVVADYRGLTVAQLTELRKELREAGVKLKVVKNTLAKRA 60 Query: 62 IRDTSIRGISDLFVGQSLIVYS-DSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120 + T + DL G + I +S + PV A K+ F+ +N + + GGVVE VL+ + + Sbjct: 61 LEGTGFEDLDDLLKGPTAIAFSEEDPVAAAKVLKDFAKENKKLEIKGGVVEGKVLDAEEV 120 Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQ 157 K +A LP E + A ++ +Q+ AT+LVR+L P ++ Sbjct: 121 KALAKLPSREELLAQLLGLLQAPATKLVRVLNAPASK 157 >gnl|CDD|88594 cd00379, Ribosomal_L10_P0, Ribosomal protein L10 family; composed of the large subunit ribosomal protein called L10 in bacteria, P0 in eukaryotes, and L10e in archaea, as well as uncharacterized P0-like eukaryotic proteins. In all three kingdoms, L10 forms a tight complex with multiple copies of the small acidic protein L12(e). This complex forms a stalk structure on the large subunit of the ribosome. The N-terminal domain (NTD) of L10 interacts with L11 protein and forms the base of the L7/L12 stalk, while the extended C-terminal helix binds to two or three dimers of the NTD of L7/L12 (L7 and L12 are identical except for an acetylated N-terminus). The L7/L12 stalk is known to contain the binding site for elongation factors G and Tu (EF-G and EF-Tu, respectively); however, there is disagreement as to whether or not L10 is involved in forming the binding site. The stalk is believed to be associated with GTPase activities in protein synthesis. In a neuroblastoma cell line, L10 has been shown to interact with the SH3 domain of Src and to activate the binding of the Nck1 adaptor protein with skeletal proteins such as the Wiskott-Aldrich Syndrome Protein (WASP) and the WASP-interacting protein (WIP). Some eukaryotic P0 sequences have an additional C-terminal domain homologous with acidic proteins P1 and P2.. Length = 155 Score = 124 bits (313), Expect = 1e-29 Identities = 47/155 (30%), Positives = 84/155 (54%), Gaps = 1/155 (0%) Query: 4 QGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIR 63 + K + EL ++ S+VV Y+G++VAQ+ +LRK++RE+G +KV KN L++ A++ Sbjct: 1 EKKEELVEELKELLKKYKSVVVVDYRGLTVAQLTELRKELRESGAKLKVGKNTLMRRALK 60 Query: 64 DTSIRGISDLFVGQSLIVYS-DSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQ 122 T + L G + + ++ + PV K+ F+ +N + GGVV VL+ + Sbjct: 61 GTGFEELKPLLKGPTALAFTNEDPVEVAKVLKDFAKENKKLFAKGGVVAGKVLDPAGVTA 120 Query: 123 IASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQ 157 +A LP E + A +I +++ +L RLL Sbjct: 121 LAKLPSREELLAMLIGLLKAPIAKLARLLNALGIG 155 >gnl|CDD|30593 COG0244, RplJ, Ribosomal protein L10 [Translation, ribosomal structure and biogenesis]. Length = 175 Score = 123 bits (310), Expect = 3e-29 Identities = 56/173 (32%), Positives = 97/173 (56%), Gaps = 2/173 (1%) Query: 1 MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60 + R+ K ++EL ++ S S+V+ Y+G++VAQ+ +LRKK+REAG +KV KN L++ Sbjct: 3 LAREWKKELVAELKELIKESPSVVIVDYRGLTVAQLTELRKKLREAGAKLKVVKNTLLRR 62 Query: 61 AIRDTSIRGISDLFVGQSLIVYSDS-PVIAPKISVSFSNDNNE-FRVLGGVVEKGVLNQD 118 A+ + + G+ DL G + I +S+ PV A K+ F+ + + + GGV E VL Sbjct: 63 ALEEAGLEGLDDLLKGPTAIAFSNEDPVAAAKLLKDFAKEAGDKAPIKGGVPEGKVLGAA 122 Query: 119 SIKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQQ 171 + +A LP E + ++ +Q+ AT+L+R L +V + A +K Sbjct: 123 EVIALAKLPSKEELVVMLLGVLQAPATKLLRALKAVPDKVGLKLLAAYEKGVV 175 >gnl|CDD|144164 pfam00466, Ribosomal_L10, Ribosomal protein L10. Length = 100 Score = 97.6 bits (244), Expect = 1e-21 Identities = 35/99 (35%), Positives = 61/99 (61%), Gaps = 2/99 (2%) Query: 1 MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60 M R+ K + EL ++ S+VV Y+G++VAQ+ +LRKK+REAG +KV KN L++ Sbjct: 1 MTREKKEEIVEELKELLKEYKSVVVVDYRGLTVAQLTELRKKLREAGAELKVGKNTLMRR 60 Query: 61 AIRDTSIR-GISDLFVGQSLIVYSDSPVIAP-KISVSFS 97 A+ T G+S+L G + +++++ +A K+ F+ Sbjct: 61 ALEGTGEEEGLSELLKGPTALIFTNEDPVAVAKVLKKFA 99 >gnl|CDD|88595 cd05795, Ribosomal_P0_L10e, Ribosomal protein L10 family, P0 and L10e subfamily; composed of eukaryotic 60S ribosomal protein P0 and the archaeal P0 homolog, L10e. P0 or L10e forms a tight complex with multiple copies of the small acidic protein L12(e). This complex forms a stalk structure on the large subunit of the ribosome. The stalk is known to contain the binding site for elongation factors G and Tu (EF-G and EF-Tu, respectively); however, there is disagreement as to whether or not L10 is involved in forming the binding site. The stalk is believed to be associated with GTPase activities in protein synthesis. In a neuroblastoma cell line, L10 has been shown to interact with the SH3 domain of Src and to activate the binding of the Nck1 adaptor protein with skeletal proteins such as the Wiskott-Aldrich Syndrome Protein (WASP) and the WASP-interacting protein (WIP). These eukaryotic and archaeal P0 sequences have an additional C-terminal domain homologous with acidic proteins P1 and P2.. Length = 175 Score = 40.5 bits (95), Expect = 3e-04 Identities = 12/87 (13%), Positives = 39/87 (44%), Gaps = 6/87 (6%) Query: 4 QGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIR 63 + K + +L+++ S +++ + Q++ +R+ +R + + KN L++ A+R Sbjct: 1 EWKKEYVEKLTELLKSYPKVLIVDADNVGSKQLQKIRRSLRGKAE-ILMGKNTLIRRALR 59 Query: 64 D-----TSIRGISDLFVGQSLIVYSDS 85 + + + G ++++ Sbjct: 60 NLGDENPELEKLLPYLKGNVGFIFTNG 86 >gnl|CDD|143497 cd06824, PLPDE_III_Yggs_like, Pyridoxal 5-phosphate (PLP)-binding TIM barrel domain of Type III PLP-Dependent Enzymes, Yggs-like proteins. This subfamily contains mainly uncharacterized proteobacterial proteins with similarity to the hypothetical Escherichia coli protein YggS, a homolog of yeast YBL036c, which is homologous to a Pseudomonas aeruginosa gene that is co-transcribed with a known proline biosynthetic gene. Like yeast YBL036c, Yggs is a single domain monomeric protein with a typical TIM-barrel fold. Its structure, which shows a covalently-bound PLP cofactor, is similar to the N-terminal domain of the fold type III PLP-dependent enzymes, bacterial alanine racemase and eukaryotic ornithine decarboxylase, which are two-domain dimeric proteins. YggS has not been characterized extensively and its biological function is still unkonwn. Length = 224 Score = 28.3 bits (64), Expect = 1.0 Identities = 13/32 (40%), Positives = 22/32 (68%) Query: 117 QDSIKQIASLPDLEGIRAGIISAIQSNATRLV 148 Q+++++I +L DL+ I I IQSN T+L+ Sbjct: 58 QEALEKIEALRDLQDIEWHFIGPIQSNKTKLI 89 >gnl|CDD|32910 COG3096, MukB, Uncharacterized protein involved in chromosome partitioning [Cell division and chromosome partitioning]. Length = 1480 Score = 28.1 bits (62), Expect = 1.4 Identities = 9/33 (27%), Positives = 19/33 (57%) Query: 139 AIQSNATRLVRLLGTPQTQVVRAISAFVDKNQQ 171 A +++ +R L + + ++ RA+S + NQQ Sbjct: 829 AFEADPEAEIRQLNSRRNELERALSNHENDNQQ 861 >gnl|CDD|146015 pfam03178, CPSF_A, CPSF A subunit region. This family includes a region that lies towards the C-terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit. CPSF is involved in mRNA polyadenylation and binds the AAUAAA conserved sequence in pre-mRNA. CPSF has also been found to be necessary for splicing of single-intron pre-mRNAs. The function of the aligned region is unknown but may be involved in RNA/DNA binding. Length = 319 Score = 27.6 bits (62), Expect = 2.1 Identities = 10/32 (31%), Positives = 16/32 (50%) Query: 54 KNRLVKIAIRDTSIRGISDLFVGQSLIVYSDS 85 K++L+ A DT I + L V + I+ D Sbjct: 115 KDKLLPKAFLDTPITYVVSLKVFGNRIIVGDL 146 >gnl|CDD|35507 KOG0286, KOG0286, KOG0286, G-protein beta subunit [General function prediction only]. Length = 343 Score = 27.2 bits (60), Expect = 2.5 Identities = 19/60 (31%), Positives = 27/60 (45%), Gaps = 5/60 (8%) Query: 64 DTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVL-GGVVEKGVLNQDSIKQ 122 D + R + DL Q L VYS +I SV+FS R+L G + D++K Sbjct: 250 DATCR-LYDLRADQELAVYSHDSIICGITSVAFSKSG---RLLFAGYDDFTCNVWDTLKG 305 >gnl|CDD|30673 COG0325, COG0325, Predicted enzyme with a TIM-barrel fold [General function prediction only]. Length = 228 Score = 26.4 bits (58), Expect = 4.2 Identities = 12/32 (37%), Positives = 19/32 (59%) Query: 117 QDSIKQIASLPDLEGIRAGIISAIQSNATRLV 148 Q+++ +I +L DL I I +QSN +LV Sbjct: 59 QEALDKIEALKDLPDIEWHFIGPLQSNKVKLV 90 >gnl|CDD|33490 COG3694, COG3694, ABC-type uncharacterized transport system, permease component [General function prediction only]. Length = 260 Score = 25.6 bits (56), Expect = 7.4 Identities = 12/40 (30%), Positives = 20/40 (50%), Gaps = 2/40 (5%) Query: 55 NRLVKIAIRDTSIRGISDLFVGQSLIVYSDS--PVIAPKI 92 N +++R SI + DL +G L+VY+ + KI Sbjct: 105 NSQFNVSVRTFSIWRVPDLLIGVGLLVYAVKSIVLTPTKI 144 >gnl|CDD|29350 cd01166, KdgK, 2-keto-3-deoxygluconate kinase (KdgK) phosphorylates 2-keto-3-deoxygluconate (KDG) to form 2-keto-3-deoxy-6-phosphogluconate (KDGP). KDG is the common intermediate product, that allows organisms to channel D-glucuronate and/or D-galacturinate into the glycolysis and therefore use polymers, like pectin and xylan as carbon sources.. Length = 294 Score = 25.6 bits (56), Expect = 7.5 Identities = 13/42 (30%), Positives = 23/42 (54%), Gaps = 4/42 (9%) Query: 27 HYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIR 68 H GI++A + R+ + EA ++ AK R V ++ D + R Sbjct: 129 HLSGITLALSESAREALLEA---LEAAKARGVTVSF-DLNYR 166 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.316 0.133 0.349 Gapped Lambda K H 0.267 0.0774 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 1,788,014 Number of extensions: 88740 Number of successful extensions: 234 Number of sequences better than 10.0: 1 Number of HSP's gapped: 231 Number of HSP's successfully gapped: 16 Length of query: 172 Length of database: 6,263,737 Length adjustment: 87 Effective length of query: 85 Effective length of database: 4,383,754 Effective search space: 372619090 Effective search space used: 372619090 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 54 (24.5 bits)