RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780145|ref|YP_003064558.1| 50S ribosomal protein L10 [Candidatus Liberibacter asiaticus str. psy62] (172 letters) >gnl|CDD|178862 PRK00099, rplJ, 50S ribosomal protein L10; Reviewed. Length = 172 Score = 170 bits (433), Expect = 2e-43 Identities = 63/172 (36%), Positives = 103/172 (59%), Gaps = 1/172 (0%) Query: 1 MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60 MNR+ K ++EL++ + S VVA Y+G++VAQ+ +LRKK+REAG KV KN L + Sbjct: 1 MNREEKKEIVAELAEKLKKAQSAVVADYRGLTVAQMTELRKKLREAGVEYKVVKNTLARR 60 Query: 61 AIRDTSIRGISDLFVGQSLIVYS-DSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDS 119 A+ T G+ DL G + I +S + PV A K+ F+ DN + + GG +E VL+ + Sbjct: 61 ALEGTGFEGLDDLLKGPTAIAFSYEDPVAAAKVLKDFAKDNKKLEIKGGAIEGKVLDAEE 120 Query: 120 IKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQQ 171 +K +A LP E + A ++ +Q+ AT+L +L P +++ R + A +K + Sbjct: 121 VKALAKLPSREELLAKLLGVLQAPATKLAGVLNAPPSKLARVLKALAEKKEA 172 >gnl|CDD|179712 PRK04019, rplP0, acidic ribosomal protein P0; Validated. Length = 330 Score = 48.7 bits (117), Expect = 8e-07 Identities = 20/79 (25%), Positives = 44/79 (55%), Gaps = 4/79 (5%) Query: 9 EISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDT--- 65 E+ EL ++ S + + +GI Q++++R+K+R +KV+KN L+K A+ + Sbjct: 11 EVEELKELIKSYPVVGIVDLEGIPARQLQEIRRKLRGK-AELKVSKNTLIKRALEEAGEE 69 Query: 66 SIRGISDLFVGQSLIVYSD 84 + + D GQ +++++ Sbjct: 70 DLEKLEDYLEGQVALIFTN 88 >gnl|CDD|162526 TIGR01773, GABAperm, gamma-aminobutyrate permease. GabP is highly homologous to amino acid permeases from B. subtilis, E. coli, as well as to other members of the amino acid permease family (pfam00324). A member of the APC (amine-polyamine-choline) transporter superfamily, GABA permease possesses a "consensus amphiphatic region" (CAR) found to be evolutionarily conserved within this transport family. This amphiphatic region is located between helix 8 and cytoplasmic loop 8-9, forming a potential channel domain and suggested to play a significant role in ligand recognition and translocation. Unique to GABA permeases, a conserved cysteine residue (CYS-300, E.coli) located at the beginning of the amphiphatic domain, has been determined to be critical for catalytic specificity. Length = 452 Score = 26.8 bits (59), Expect = 2.8 Identities = 13/37 (35%), Positives = 26/37 (70%), Gaps = 1/37 (2%) Query: 16 IFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKV 52 + +SSG+I + Y I+V+Q++ +RKK++ G +K+ Sbjct: 363 LVNSSGAIALLVYLVIAVSQLR-MRKKLKANGEAIKI 398 >gnl|CDD|161784 TIGR00238, TIGR00238, KamA family protein. Note that the E. coli homolog was expressed in E. coli and purified and found not to display display lysine 2,3-aminomutase activity. Active site residues are found in 100 residue extension in B. subtilis. Name changed to KamA family protein. Length = 331 Score = 26.0 bits (57), Expect = 4.9 Identities = 10/43 (23%), Positives = 20/43 (46%), Gaps = 3/43 (6%) Query: 120 IKQIASLPDLEGIRAG---IISAIQSNATRLVRLLGTPQTQVV 159 +K++ +P L +R G + Q L LL + + Q++ Sbjct: 182 LKRLEEIPHLVRLRIGTRLPVVIPQRITDELCELLASFELQLM 224 >gnl|CDD|166881 PRK00275, glnD, PII uridylyl-transferase; Provisional. Length = 895 Score = 25.8 bits (57), Expect = 6.1 Identities = 15/87 (17%), Positives = 39/87 (44%), Gaps = 18/87 (20%) Query: 65 TSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQ-- 122 ++ ++DL ++ + + ++A S + N+ F++ G +E + + K+ Sbjct: 314 MALAELNDL-----ILQHFEEVILAADDSGTIQPLNSRFQLRDGYIE--ATHPNVFKRTP 366 Query: 123 ---------IASLPDLEGIRAGIISAI 140 +A P+++G+RA I + Sbjct: 367 FALLEIFVLMAQHPEIKGVRADTIRLL 393 >gnl|CDD|179146 PRK00865, PRK00865, glutamate racemase; Provisional. Length = 261 Score = 25.8 bits (58), Expect = 6.2 Identities = 12/41 (29%), Positives = 15/41 (36%), Gaps = 8/41 (19%) Query: 124 ASLPDLE--------GIRAGIISAIQSNATRLVRLLGTPQT 156 +LPDL GI I A + +L TP T Sbjct: 81 VALPDLRERYDIPVVGIVPAIKPAAALTRNGRIGVLATPGT 121 >gnl|CDD|180000 PRK05298, PRK05298, excinuclease ABC subunit B; Provisional. Length = 652 Score = 25.8 bits (58), Expect = 6.4 Identities = 7/13 (53%), Positives = 10/13 (76%) Query: 34 AQIKDLRKKMREA 46 IK+L K+M+EA Sbjct: 613 KLIKELEKQMKEA 625 >gnl|CDD|180893 PRK07225, PRK07225, DNA-directed RNA polymerase subunit B'; Validated. Length = 605 Score = 25.3 bits (56), Expect = 7.6 Identities = 21/96 (21%), Positives = 40/96 (41%), Gaps = 31/96 (32%) Query: 71 SDLFVGQSLIVYSDSP--------------VIAPKISVSFSNDNNEFRVL--GG------ 108 + ++V LI D P I+ +++VS+ + NE + G Sbjct: 5 AKVYVNGKLIGTHDDPEELVEEIREARRSGEISEEVNVSYKEETNEVIINTDAGRARRPL 64 Query: 109 -VVEKGV--LNQDSIKQIAS----LPDLEGIRAGII 137 VVE G L ++ I+++ + DL ++ G+I Sbjct: 65 IVVENGEPLLTEEHIEKLKNGELTFDDL--VKQGVI 98 >gnl|CDD|150793 pfam10165, Ric8, Guanine nucleotide exchange factor synembryn. Ric8 is involved in the EGL-30 neurotransmitter signalling pathway. It is a guanine nucleotide exchange factor that regulates neurotransmitter secretion. Length = 438 Score = 25.3 bits (56), Expect = 7.7 Identities = 8/20 (40%), Positives = 12/20 (60%) Query: 146 RLVRLLGTPQTQVVRAISAF 165 RL+RL+ +P T + A S Sbjct: 302 RLLRLMTSPDTDLKDAASEL 321 >gnl|CDD|129155 TIGR00044, TIGR00044, pyridoxal phosphate enzyme, YggS family. Members of this protein family include YggS from Escherichia coli and YBL036C, an uncharacterized pyridoxal protein of Saccharomyces cerevisiae. Length = 229 Score = 25.2 bits (55), Expect = 9.1 Identities = 12/32 (37%), Positives = 18/32 (56%) Query: 117 QDSIKQIASLPDLEGIRAGIISAIQSNATRLV 148 Q+ +++I L DL + I +QSN RLV Sbjct: 60 QELVEKIKLLEDLGKLEWHFIGPLQSNKDRLV 91 >gnl|CDD|185639 PTZ00460, PTZ00460, acyl-CoA dehydrogenase; Provisional. Length = 646 Score = 25.2 bits (55), Expect = 9.7 Identities = 13/41 (31%), Positives = 20/41 (48%), Gaps = 6/41 (14%) Query: 108 GVVEKGVLNQDSIKQIASLPDLEGIRAGIISAIQSNATRLV 148 G++EKG + + IK L+ R + I+ NA LV Sbjct: 556 GLIEKGQITVEQIKL------LQETREQLYPIIKPNALGLV 590 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.316 0.133 0.349 Gapped Lambda K H 0.267 0.0613 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 2,640,997 Number of extensions: 163946 Number of successful extensions: 368 Number of sequences better than 10.0: 1 Number of HSP's gapped: 366 Number of HSP's successfully gapped: 22 Length of query: 172 Length of database: 5,994,473 Length adjustment: 87 Effective length of query: 85 Effective length of database: 4,114,577 Effective search space: 349739045 Effective search space used: 349739045 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 54 (24.8 bits)