BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780145|ref|YP_003064558.1| 50S ribosomal protein L10 [Candidatus Liberibacter asiaticus str. psy62] (172 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780145|ref|YP_003064558.1| 50S ribosomal protein L10 [Candidatus Liberibacter asiaticus str. psy62] Length = 172 Score = 337 bits (863), Expect = 9e-95, Method: Compositional matrix adjust. Identities = 172/172 (100%), Positives = 172/172 (100%) Query: 1 MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60 MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI Sbjct: 1 MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60 Query: 61 AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120 AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI Sbjct: 61 AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120 Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQQG 172 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQQG Sbjct: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQQG 172 >gi|254780151|ref|YP_003064564.1| tRNA-specific 2-thiouridylase MnmA [Candidatus Liberibacter asiaticus str. psy62] Length = 408 Score = 25.8 bits (55), Expect = 0.43, Method: Compositional matrix adjust. Identities = 13/40 (32%), Positives = 25/40 (62%) Query: 83 SDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQ 122 S+ V + + V +++D+NE RVLGG + G D++++ Sbjct: 355 SEVGVASGQACVFYTSDSNEARVLGGGIISGSKRSDAVEE 394 >gi|254780664|ref|YP_003065077.1| bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase [Candidatus Liberibacter asiaticus str. psy62] Length = 536 Score = 23.9 bits (50), Expect = 1.9, Method: Compositional matrix adjust. Identities = 16/52 (30%), Positives = 26/52 (50%), Gaps = 2/52 (3%) Query: 15 KIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVK--IAIRD 64 KI S+ G+ + +GI V + D+ K GG VK ++ ++IRD Sbjct: 42 KIISTGGTCQLLEEEGIPVTSVFDITKFPEIMGGRVKTLHPKIYGGILSIRD 93 >gi|254780713|ref|YP_003065126.1| 16S rRNA-processing protein [Candidatus Liberibacter asiaticus str. psy62] Length = 190 Score = 23.5 bits (49), Expect = 2.3, Method: Compositional matrix adjust. Identities = 10/25 (40%), Positives = 17/25 (68%), Gaps = 1/25 (4%) Query: 82 YSDSPVIAPKISVSFSNDNNEFRVL 106 Y+++P+ + V +SNDN E R+L Sbjct: 28 YANNPIDLNRY-VLYSNDNRELRIL 51 >gi|254780418|ref|YP_003064831.1| 50S ribosomal protein L25/general stress protein Ctc [Candidatus Liberibacter asiaticus str. psy62] Length = 191 Score = 23.1 bits (48), Expect = 2.6, Method: Compositional matrix adjust. Identities = 14/61 (22%), Positives = 27/61 (44%), Gaps = 4/61 (6%) Query: 56 RLVKIAIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVL 115 LV + +D + +SD+ + + S+ + + V F N+N G+ + G L Sbjct: 72 ELVHVIPKDYQLDPVSDILIHADFLQVSEGSTVTVHVPVRFINENKS----PGIKQGGKL 127 Query: 116 N 116 N Sbjct: 128 N 128 >gi|254780711|ref|YP_003065124.1| signal recognition particle protein [Candidatus Liberibacter asiaticus str. psy62] Length = 461 Score = 21.6 bits (44), Expect = 7.9, Method: Compositional matrix adjust. Identities = 13/26 (50%), Positives = 16/26 (61%), Gaps = 1/26 (3%) Query: 36 IKDLRKKMREAGGGVKVAK-NRLVKI 60 IK RKK AG G AK N+L+K+ Sbjct: 394 IKHSRKKRIAAGSGTNAAKINKLLKL 419 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.316 0.133 0.349 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 97,341 Number of Sequences: 1233 Number of extensions: 3768 Number of successful extensions: 19 Number of sequences better than 100.0: 9 Number of HSP's better than 100.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 3 Number of HSP's that attempted gapping in prelim test: 13 Number of HSP's gapped (non-prelim): 9 length of query: 172 length of database: 328,796 effective HSP length: 68 effective length of query: 104 effective length of database: 244,952 effective search space: 25475008 effective search space used: 25475008 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 35 (18.1 bits)