HHsearch alignment of GI: 254780146 and MMDB domain: 1ad2_A_1-68_160-228

>1ad2_A (A:1-68,A:160-228) TL2, ribosomal protein L1; RNA binding, protein synthesis, mutant; 1.90A {Thermus thermophilus}
Probab=100.00  E-value=6.5e-38  Score=255.23  Aligned_cols=137  Identities=40%  Similarity=0.728  Sum_probs=132.8

Q ss_pred             CCCCHHHHHHHHHCCCCCCCCHHHHHHHHHHCCCCCCCCCEEEEEEECCCCCCCCCCCEEEEEECCCCCCCCCEEEEECH
Q ss_conf             42234379898513847688989999999860878998629999995378764544301379952778865406999750
Q gi|254780146|r    3 SKISKRMQQISQGIDRSALYGLSDAVVMLKERATARFDETVEIAMNLGIDPRHANQMVRGVVTMPNGTGVNVRVAVFATS   82 (232)
Q Consensus         3 ~k~~Kr~~~~~~~~~~~~~ysi~eAi~~lk~~~~~kf~esvel~i~L~id~~k~~~~irg~v~LPh~~gk~~kV~Vf~~~   82 (232)
                      .|+||||+++.+.+|..+.|+++||++++++.+.+|||||||++++||+||+|+||+|||+|.||||+            
T Consensus         1 pk~~Kr~~~~~~~v~~~~~y~~~eAi~l~k~~~~aKFdetve~~~~L~iDprk~dQ~vRg~v~LP~G~------------   68 (137)
T 1ad2_A            1 PKHGKRYRALLEKVDPNKIYTIDEAAHLVKELATAKFDETVEVHAKLGIDPRRSDQNVRGTVSLPHGL------------   68 (137)
T ss_dssp             ----CCCTTTTTSCCTTCCBCHHHHHHHHHTTCCSSSCCEEEEEEEESSCTTCGGGCCEEEEECSSSC------------
T ss_pred             CCCCHHHHHHHHCCCCCCCCCHHHHHHHHHHHCCCCCCCCEEEEEEECCCCCCCCCCEEEEEEECCCC------------
T ss_conf             97248899988515756676999999999982789988528999997446765452201145412666------------


Q ss_pred             HHHHHHHHCCCCCCCHHHHHHHHHCCCCCCCEEEECHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHCCCC
Q ss_conf             44576874120000278999997517533346886446778888643320010017422335666557999999860111
Q gi|254780146|r   83 SKADEAREAGADIVGGEDLFEIVKGGQIDFDRCIATPDMMPLVGRLGRILGPRGIMPNLRVGTVTTDVATAVRESKSGAV  162 (232)
Q Consensus        83 ~~~~~Ak~aGa~~vg~~eli~~i~~~~~~fd~~iAt~~~m~~i~klgriLGPkglMPn~k~GTv~~di~~~i~~~k~g~i  162 (232)
                                                                                                    ++
T Consensus        69 ------------------------------------------------------------------------------~V   70 (137)
T 1ad2_A           69 ------------------------------------------------------------------------------RI   70 (137)
T ss_dssp             ------------------------------------------------------------------------------EE
T ss_pred             ------------------------------------------------------------------------------EE
T ss_conf             ------------------------------------------------------------------------------58


Q ss_pred             CCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHHHCCCCCCCCCEEEEEEEEECCCCCEEEECHH
Q ss_conf             0223575267875315778989999999999999986086625443377999992389727740010
Q gi|254780146|r  163 DFRSEKAGIIHAGIGKVSFENKKIEENVLAFVSAVVKAKPSVAKGDYVKRVTLSSTMGCGIKVDLSS  229 (232)
Q Consensus       163 ~~r~~k~g~i~~~IG~~~m~~e~i~eNi~~~~~~i~~~kp~~~kg~~Ik~v~lssTmGp~i~id~~~  229 (232)
                      +||+|+.|+||++||+++|+++||.||+.+++++|.+.+|.+.||.||+++|||||||||++||+++
T Consensus        71 efR~dk~g~ih~~IGk~sf~~e~L~eNi~a~i~~i~k~kP~~~Kg~yIk~i~issTMGPgi~Id~~s  137 (137)
T 1ad2_A           71 EFRNDKTGAIHAPVGKACFPPEKLADNIRAFIRALEAHKPEGAKGTFLRSVYVTTTMGPSVRINPHS  137 (137)
T ss_dssp             EEECCTTSEEEEEEEETTSCHHHHHHHHHHHHHHHHTTCCTTCCSCSEEEEEEECTTSCCEEECTTC
T ss_pred             EEEECCCCEEEEEECCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCEEEEEEEECCCCCCEEECCCC
T ss_conf             9864788646202220258999999999999999998495645787486999989989897829999