RPSBLAST alignment for GI: 254780146 and conserved domain: pfam00687

>gnl|CDD|144329 pfam00687, Ribosomal_L1, Ribosomal protein L1p/L10e family. This family includes prokaryotic L1 and eukaryotic L10. Length = 203
 Score =  290 bits (745), Expect = 2e-79
 Identities = 124/203 (61%), Positives = 161/203 (79%), Gaps = 1/203 (0%)

Query: 21  LYGLSDAVVMLKERATARFDETVEIAMNLGIDPRHANQMVRGVVTMPNGTGVNVRVAVFA 80
           LY + +A+ +LKE AT +FDETVE+A+NLG+DP+ A+Q VRG V +P+GTG  V+VAVFA
Sbjct: 1   LYAIKEALELLKETATRKFDETVELAINLGVDPKKADQRVRGTVVLPHGTGKTVKVAVFA 60

Query: 81  TSSKADEAREAGADIVGGEDLFE-IVKGGQIDFDRCIATPDMMPLVGRLGRILGPRGIMP 139
              KA EA+ AGAD VGG++L E I K G +DFD  IATPDMMP VG+LGRILGPRG+MP
Sbjct: 61  KGEKAKEAKAAGADYVGGDELLEKIKKDGWLDFDVFIATPDMMPQVGKLGRILGPRGLMP 120

Query: 140 NLRVGTVTTDVATAVRESKSGAVDFRSEKAGIIHAGIGKVSFENKKIEENVLAFVSAVVK 199
           N + GTVT DVA AV+E KSG+V+FR++KAGIIH  +GKVSF+++K+ EN+ A ++A+VK
Sbjct: 121 NPKTGTVTPDVAKAVKELKSGSVEFRADKAGIIHVPVGKVSFDDEKLAENIKAVLNALVK 180

Query: 200 AKPSVAKGDYVKRVTLSSTMGCG 222
            KPS+ KG Y+K V + STMG G
Sbjct: 181 LKPSLKKGWYIKSVYIKSTMGPG 203