BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780147|ref|YP_003064560.1| 50S ribosomal protein L11 [Candidatus Liberibacter asiaticus str. psy62] (142 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780147|ref|YP_003064560.1| 50S ribosomal protein L11 [Candidatus Liberibacter asiaticus str. psy62] Length = 142 Score = 284 bits (726), Expect = 5e-79, Method: Compositional matrix adjust. Identities = 142/142 (100%), Positives = 142/142 (100%) Query: 1 MAKVVSRIVKLQIESGSAKPSPPVGPAIGQAGIPIMAFCKAFNAATEGMEKGIPIPTTVT 60 MAKVVSRIVKLQIESGSAKPSPPVGPAIGQAGIPIMAFCKAFNAATEGMEKGIPIPTTVT Sbjct: 1 MAKVVSRIVKLQIESGSAKPSPPVGPAIGQAGIPIMAFCKAFNAATEGMEKGIPIPTTVT 60 Query: 61 CYKDKSFTFTMSQPPVSFFLKKEVGIKSGSKLPGKESCGSITRENIRKIAQLKMQDMGAI 120 CYKDKSFTFTMSQPPVSFFLKKEVGIKSGSKLPGKESCGSITRENIRKIAQLKMQDMGAI Sbjct: 61 CYKDKSFTFTMSQPPVSFFLKKEVGIKSGSKLPGKESCGSITRENIRKIAQLKMQDMGAI 120 Query: 121 DIEGAMRMVEGSACSMGISVVD 142 DIEGAMRMVEGSACSMGISVVD Sbjct: 121 DIEGAMRMVEGSACSMGISVVD 142 >gi|254780898|ref|YP_003065311.1| hypothetical protein CLIBASIA_03975 [Candidatus Liberibacter asiaticus str. psy62] Length = 207 Score = 24.6 bits (52), Expect = 0.78, Method: Compositional matrix adjust. Identities = 14/29 (48%), Positives = 18/29 (62%), Gaps = 2/29 (6%) Query: 69 FTMSQPPVSF--FLKKEVGIKSGSKLPGK 95 + +QP +F +LKKE GIKS L GK Sbjct: 53 YRSAQPNGTFIEYLKKEYGIKSILNLRGK 81 >gi|254780444|ref|YP_003064857.1| bacteriophage repressor protein C1 [Candidatus Liberibacter asiaticus str. psy62] Length = 223 Score = 23.1 bits (48), Expect = 1.8, Method: Compositional matrix adjust. Identities = 15/45 (33%), Positives = 20/45 (44%), Gaps = 3/45 (6%) Query: 75 PVSFFLKKEVGIKSGSKLPGKESCGSI---TRENIRKIAQLKMQD 116 P SF K GI+ ++ P ES I T E I ++ L D Sbjct: 35 PTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQLLDLPFSD 79 >gi|254780284|ref|YP_003064697.1| hypothetical protein CLIBASIA_00845 [Candidatus Liberibacter asiaticus str. psy62] Length = 623 Score = 22.3 bits (46), Expect = 3.5, Method: Composition-based stats. Identities = 12/36 (33%), Positives = 17/36 (47%) Query: 42 FNAATEGMEKGIPIPTTVTCYKDKSFTFTMSQPPVS 77 FN+ TEG+ +GI I + D S P +S Sbjct: 377 FNSNTEGIARGISINRDCSLGDDVHRENMFSAPEIS 412 >gi|254781024|ref|YP_003065437.1| electron transfer flavoprotein-ubiquinone oxidoreductase [Candidatus Liberibacter asiaticus str. psy62] Length = 554 Score = 21.9 bits (45), Expect = 5.2, Method: Composition-based stats. Identities = 8/17 (47%), Positives = 13/17 (76%) Query: 92 LPGKESCGSITRENIRK 108 L G+ +CGS+TR+ I + Sbjct: 187 LVGEGACGSLTRQLIER 203 >gi|254781218|ref|YP_003065631.1| hypothetical protein CLIBASIA_05625 [Candidatus Liberibacter asiaticus str. psy62] Length = 205 Score = 21.9 bits (45), Expect = 5.2, Method: Compositional matrix adjust. Identities = 12/37 (32%), Positives = 19/37 (51%), Gaps = 2/37 (5%) Query: 104 ENIRKIAQLKMQDM--GAIDIEGAMRMVEGSACSMGI 138 ++IRK ++M GA +E A+ + E CS I Sbjct: 37 KDIRKANNKTQKEMAIGANQLESAVNLFENGMCSTSI 73 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.317 0.133 0.379 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 80,202 Number of Sequences: 1233 Number of extensions: 2958 Number of successful extensions: 10 Number of sequences better than 100.0: 6 Number of HSP's better than 100.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 5 Number of HSP's gapped (non-prelim): 6 length of query: 142 length of database: 328,796 effective HSP length: 66 effective length of query: 76 effective length of database: 247,418 effective search space: 18803768 effective search space used: 18803768 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 34 (17.7 bits)